Zeitschriften/Aufsätze
-
(2021): The effect of nitrogen alloying on hydrogen-assisted plastic deformation and fracture in FeMnNiCoCr high-entropy alloys, Scripta Materialia 194, 2021, 113642
DOI: 10.1016/j.scriptamat.2020.113642 -
(2021): Influence of Pre-strain on Very-Low-Cycle Stress–Strain Response and Springback Behavior, J. of Materi Eng and Perform 5, 2021 (3), 4353
DOI: 10.1007/s11665-020-05399-0 -
(2021): Contact Geometry Modification of Friction-Welded Semi-Finished Products to Improve the Bonding of Hybrid Components, Metals 11, 2021 (1), 115
DOI: 10.3390/met11010115 -
(2021): Changes in Mechanical and Microstructural Properties of Magnesium Alloys Resulting from Superimposed High Current Density Pulses, Materials Science Forum (THERMEC 2021) 1016, 2021, 385-391
ISSN: 1662-9752 -
(2021): Crack initiation of an industrial 7XXX aluminum alloy in humid air analyzed via slow strain rate testing and constant displacement testing, Materials Science and Engineering: A 804, 2021 (10), 140776
DOI: 10.1016/j.msea.2021.140776 -
(2020): Improving the accuracy of FE simulations of induction tempering towards a microstructure-dependent electromagnetic model, IEEE Trans. Magn. 56, 2020 (10), 1-9
DOI: 10.1109/TMAG.2020.3013562 -
(2020): Ion Beam Processing for Sample Preparation of Hybrid Materials with Strongly Differing Mechanical Properties, Metallogr. Microstruct. Anal. 9, 2020 (1), 54-60
DOI: 10.1007/s13632-019-00605-5 -
(2020): Microstructural Evolution and Mechanical Properties of Hybrid Bevel Gears Manufactured by Tailored Forming, Metals 10, 2020 (10), 1365
DOI: 10.3390/met10101365 -
(2020): New Multistage Sheet-Bulk Metal Forming Process Using Oscillating Tools, Metals 10, 2020 (5), 617
DOI: 10.3390/met10050617 -
(2020): Characterization and Modeling of Intermetallic Phase Formation during the Joining of Aluminum and Steel in Analogy to Co-Extrusion, Metals 10, 2020 (12), 1582
DOI: 10.3390/met10121582 -
(2020): Numerical investigations regarding a novel process chain for the production of a hybrid bearing bushing, Prod. Eng. Res. Devel. 14, 2020 5-6, 569-581
DOI: 10.1007/s11740-020-00992-7 -
(2020): Investigation of the temporal rearrangement of zirconium hydride precipitates in cladding material for the interim and final storage period, Kerntechnik 85, 2020 (6), 433-439
DOI: 10.3139/124.200070 -
(2020): Investigations on Tailored Forming of AISI 52100 as Rolling Bearing Raceway, Metals 10, 2020 (10), 1363
DOI: 10.3390/met10101363 -
(2020): Simulation assisted process chain design for the manufacturing of bulk hybrid shafts with tailored properties, Int J Adv Manuf Technol 108, 2020 7-8, 2409-2417
DOI: 10.1007/s00170-020-05532-2 -
(2020): Influence of nitrogen in process atmospheres on the corrosion and the fatigue behavior of brazed stainless steel joints, Welding and Cutting 19, 2020 (4), 312-317
-
(2020): Deformation-induced martensitic transformation in AISI304 by cryogenic machining, Materials Letters, 2020, 129090
DOI: 10.1016/j.matlet.2020.129090 -
(2020): Eddy Current Detection of the Martensitic Transformation in AISI304 Induced upon Cryogenic Cutting, Steel Research Int. 2, 2020, 2000299
DOI: 10.1002/srin.202000299 -
(2020): Prozessbegleitende Erfassung der Gefügeumwandlung im Randbereich bainitischer Schmiedeteile bei der Abkühlung im Warmbad, massivUMFORMUNG, 2020 (2), 58-63
-
(2020): Investigation of degraded bone substitutes made of magnesium alloy using scanning electron microscope and nanoindentation, Journal of the Mechanical Behavior of Biomedical Materials 109, 2020, 103825
DOI: 10.1016/j.jmbbm.2020.103825 -
(2020): A simulation model for the degradation of magnesium-based bone implants, Journal of the Mechanical Behavior of Biomedical Materials 101, 2020, 103411
DOI: 10.1016/j.jmbbm.2019.103411 -
(2020): Plasma nitriding Ti-6Al-4V with the aid non-transmitted plasma-arc using different protection atmosphere, Materials Today: Proceedings, Volume 30, Part 3, 2020, Pages 694-699, ISSN 2214-7853,
DOI: https://doi.org/10.1016/j.matpr.2020.01.524 -
(2020): Properties and anisotropy behaviour of a nickel base alloy material produced by robot-based wire and arc additive manufacturing, Weld World 64, 1921–1931, 2020
DOI: https://doi.org/10.1007/s40194-020-00971-7 -
(2020): Pattern-forming nanoprecipitates in NiTi-related high entropy shape memory alloys, Scripta Materialia 186, 2020, 132-135
DOI: 10.1016/j.scriptamat.2020.05.007 -
(2020): The Effect of Increasing Chemical Complexity on the Mechanical and Functional Behavior of NiTi-Related Shape Memory Alloys, Shap. Mem. Superelasticity 122, 2020, 106792
DOI: 10.1007/s40830-020-00284-0 -
(2020): Influence of stick electrode coating’s moisture content on the diffusible hydrogen in underwater wet shielded metal arc welding, Advances In Materials Science 20, 2020 4 (66), 27-37
DOI: 10.2478/adms-2020-0020 -
(2020): Reducing the risk of hydrogen-induced cold cracks in hyperbaric wet welding of high strength steels by using austenitic welding consumables, Welding and Cutting, 2020 (1), 54-60
-
(2020): Effect of the water depth on the hydrogen content in SMAW wet welded joints, Springer Nature Applied Sciences 2, 2020 (7), 25
DOI: 10.1007/s42452-020-3066-8 -
(2020): Control of the diffusible hydrogen content in different steel phases through the targeted use of different welding consumables in underwater wet welding, Materials and Corrosion 8, 2020 (3), 11
DOI: 10.1002/maco.202011963 -
(2020): The Applicability of the Standard DIN EN ISO 3690 for the Analysis of Diffusible Hydrogen Content in Underwater Wet Welding, Materials 13, 2020 (17), 3750
DOI: 10.3390/ma13173750 -
(2020): Order and Temperatures of Magnetic Transitions in a Ni₅₁.₉Mn₂₇.₀Ga₂₁.₁ Alloy, IEEE Trans. Magn. 56, 2020 (7), 1-5
DOI: 10.1109/TMAG.2020.2991317 -
(2020): Influence of incorporated nanoparticles on superelastic behavior of shape memory alloys, Materials Science and Engineering: A 776, 2020, 139025
DOI: 10.1016/j.msea.2020.139025 -
(2020): Towards Dry Machining of Titanium-Based Alloys: A New Approach Using an Oxygen-Free Environment, Metals 10, 2020 (9), 1161
DOI: 10.3390/met10091161 -
(2020): Magnesium Alloys for Open-Pored Bioresorbable Implants, JOM 72, 2020 (5), 1859-1869
DOI: 10.1007/s11837-020-04078-8 -
(2020): Fracture Behavior of Ultrafine-Grained Titanium Under Tension at Elevated Temperatures, Journal of Engineering Materials and Technology 142, 2020 (4), 041009
DOI: 10.1115/1.4047747 -
(2020): A multiscale study of hot-extruded CoNiGa ferromagnetic shape-memory alloys, Materials & Design 196, 2020, 109118
DOI: 10.1016/j.matdes.2020.109118 -
(2020): Numerical Simulation of the Abrasive Wear Behavior of Selectively Oxidized α-Fe2O3 Oxide Layers on Tool Steel Surfaces, JOM 72, 2020 (7), 2536-2547
DOI: 10.1007/s11837-020-04172-x -
(2020): Characterization of Molybdenum Based Coatings on 100Cr6 Bearing Steel Surfaces, Tribology Online 15, 2020 (3), 181-185
DOI: 10.2474/trol.15.181 -
(2020): Effects of Cryogenic Treatment on the Microstructure and Mechanical Properties of High-alloyed Tool Steels, HTM 75, 2020 (5), 287-307
DOI: 10.3139/105.110422 -
(2020): Lateral Angular Co-Extrusion: Geometrical and Mechanical Properties of Compound Profiles, Metals 10, 2020, 1162
DOI: 10.3390/met10091162 -
(2020): The effects of severe plastic deformation on the mechanical and corrosion characteristics of a bioresorbable Mg-ZKQX6000 alloy, Materials Science and Engineering: C 115, 2020, 111130
DOI: 10.1016/j.msec.2020.111130 -
(2020): Strain path dependency in incremental sheet-bulk metal forming, Int J Mater Form 90, 2020 (7), 3585
DOI: 10.1007/s12289-020-01537-0 -
(2019): Preparation Methods for Scanning Electron Microscope Characterization of Nano-Carbides in Cold Work Steel X153CrMoV12, Pract. Metallogr. 56, 2019 (5), 303-316
DOI: 10.3139/147.110555 -
(2019): Influence of Alternating Short-Cycle Bending on the Mechanical Properties of Copper, α-Titanium and the Mild Steel DC01, J. of Materi Eng and Perform 28, 2019 (11), 7165-7170
DOI: 10.1007/s11665-019-04458-5 -
(2019): Simulation-Aided Process Chain Design for the Manufacturing of Hybrid Shafts, HTM 74, 2019 (2), 115-135
DOI: 10.3139/105.110378 -
(2019): Manufacturing and Evaluation of Multi-Material Axial-Bearing Washers by Tailored Forming, Metals 9, 2019 (2), 232
DOI: 10.3390/met9020232 -
(2019): Optimierung des Tragverhaltens unter Wasser gefügter Bolzenschweißverbindungen großer Dimensionen für Reparatur- und Instandhaltungsmaßnahmen, Schweißen und Schneiden 71, 2019 (5), 278-284
-
(2019): Hubzündungsbolzenschweißen großer Dimensionen unter Wasser Qualifiziert bis 50 m Wassertiefe, Der Praktiker, 2019 1-2, 26-31
-
(2019): Compressive response of high-strength [001]-oriented single crystals of a Co35Ni35Al30 shape memory alloy, Journal of Alloys and Compounds 787, 2019, 963-971
DOI: 10.1016/j.jallcom.2019.02.185 -
(2019): Untersuchungen zum Einfluss von Stickstoff in der Lötatmosphäre auf die Lebensdauerfestigkeit Ni-Basis-gelöteter CrNi-Stahl-Verbindungen unter korrosiver Belastung, Schweißen und Schneiden 71, 2019 (4), 230-237
-
(2019): Anomalous twinning in AZ 31 magnesium alloy during electrically assisted forming, Materials Letters 255, 2019, 126516
DOI: 10.1016/j.matlet.2019.126516 -
(2019): Brazing in SiH4-Doped Inert Gases - A New Approach to an Environment Friendly Production Process, Int. J. of Precis. Eng. and Manuf.-Green Tech. 495, 2019 (1), 187
DOI: 10.1007/s40684-019-00109-1 -
(2019): Investigation of the Prediction Accuracy of a Finite Element Analysis Model for the Coating Thickness in Cross-Wedge Rolled Coaxial Hybrid Parts, Materials 12, 2019 (18), 2969
DOI: 10.3390/ma12182969 -
(2019): Assessing printability maps in additive manufacturing of metal alloys, Acta Materialia 176, 2019, 199-210
DOI: 10.1016/j.actamat.2019.07.005 -
(2019): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2019): Tailoring the Microstructure in Polycrystalline Co–Ni–Ga High-Temperature Shape Memory Alloys by Hot Extrusion, Shap. Mem. Superelasticity 5, 2019 (1), 84-94
DOI: 10.1007/s40830-019-00208-7 -
(2019): Fatigue behavior of As-built selective laser melted titanium scaffolds with sheet-based gyroid microarchitecture for bone tissue engineering, Acta Biomaterialia 94, 2019, 610-626
DOI: 10.1016/j.actbio.2019.05.046 -
(2019): Comparison of degradation behaviour and osseointegration of the two magnesium scaffolds, LAE442 and La2, in vivo, Materialia 8, 2019, 100436
DOI: 10.1016/j.mtla.2019.100436 -
(2019): Verminderung des Risikos wasserstoffinduzierter Kaltrisse durch den Einsatz austenitischer Schweißzusatzwerkstoffe beim hyperbar nassen Schweißen höherfester Baustähle, Schweißen und Schneiden 71, 2019 (9), 588-594
-
(2019): Giant reversible stress-induced change of resistivity in Ni-Mn-In-Co alloys, Journal of Applied Physics 125, 2019 (19), 195103
DOI: 10.1063/1.5088233 -
(2019): Microstructure Formation in Cast TiZrHfCoNiCu and CoNiCuAlGaIn High Entropy Shape Memory Alloys: A Comparison, Materials 12, 2019 (24)
DOI: 10.3390/ma12244227 -
(2019): Impact of Heating–Cooling Rates on the Functional Properties of Ti–20Ta–5Al High-Temperature Shape Memory Alloys, Shap. Mem. Superelasticity 5, 2019 (1), 95-105
DOI: 10.1007/s40830-019-00207-8 -
(2019): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2019): Development of a tool concept with selectively oxidised inserts for dry deep drawing, Dry Met. Forming OAJ FMT 5, 2019, 46-49
-
(2019): Compressive shape memory actuation response of stress-induced martensite aged Ni51Fe18Ga27Co4 single crystals, Materials Science and Engineering: A 746, 2019, 448-455
DOI: 10.1016/j.msea.2019.01.004 -
(2019): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2019): Werkstofftechnisch basiertes Modell für die Simulation des Unterwasserschweißens, Schweißen und Schneiden 71, 2019 (8), 513-519
-
(2019): Visualization and Observation of Morphological Peculiarities of Twin Formation in Mg-Based Samples After Electrically Assisted Forming, Metallogr. Microstruct. Anal. 8, 2019 (6), 806-814
DOI: 10.1007/s13632-019-00589-2 -
(2019): Automatisierung der Verbindungsvorbereitung von Stahlseilfördergurten - Einsatz von Wasserstrahlverfahren, Schüttgut 25, 2019 (2), 84-88
-
(2019): Cyclic deformation response of ultra-fine grained titanium at elevated temperatures, International Journal of Fatigue 122, 2019, 228-239
DOI: 10.1016/j.ijfatigue.2019.01.021 -
(2019): Joining of blanks by cold pressure welding: Incremental rolling and strategies for surface activation and heat treatment, Materialwiss. Werkstofftech. 50, 2019 (8), 924-939
DOI: 10.1002/mawe.201900031 -
(2019): Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfaces, Wear 426-427, 2019, 1603-1615
DOI: 10.1016/j.wear.2019.01.009 -
(2019): Evolution of surface characteristics of two industrial 7xxx aluminium alloys exposed to humidity at moderate temperature, Surface and Interface Analysis 51, 2019 (19), 5775
DOI: 10.1002/sia.6652 -
(2019): Generating Ultrabroadband Deep-UV Radiation and Sub-10 nm Gap by Hybrid-Morphology Gold Antennas, Nano letters 19, 2019 (7), 4779-4786
DOI: 10.1021/acs.nanolett.9b02100 -
(2019): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2019): Material models for the thermoplastic material behaviour of a dual-phase steel on a microscopic and a macroscopic length scale, Journal of the Mechanics and Physics of Solids 129, 2019, 205-228
DOI: 10.1016/j.jmps.2019.04.012 -
(2018): Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt Coatings, Adv. Eng. Mater. 20, 2018 (9), 1800102
DOI: 10.1002/adem.201800102 -
(2018): Decommissioning of Nuclear Facilities: An Interdisciplinary Task for Junior Staff, atw - International Journal for Nuclear Power 63, 2018 (11/12), 601-604
-
(2018): On the Utility of Crystal Plasticity Modeling to Uncover the Individual Roles of Microdeformation Mechanisms on the Work Hardening Response of Fe-23Mn-0.5C TWIP Steel in the Presence of Hydrogen, J. Eng. Mater. Technol 140, 2018 (3), 31002
DOI: 10.1115/1.4038801 -
(2018): A Numerical Study on Co-Extrusion to Produce Coaxial Aluminum-Steel Compounds with Longitudinal Weld Seams, Metals 8, 2018 (9), 717
DOI: 10.3390/met8090717 -
(2018): Shaping single atomic junctions in ultra-thin Ag structures by electromigration, Appl. Phys. Lett. 113, 2018 (1), 13106
DOI: 10.1063/1.5040405 -
(2018): Manufacturing of High-Performance Bi-Metal Bevel Gears by Combined Deposition Welding and Forging, Metals 8, 2018 (11), 898
DOI: 10.3390/met8110898 -
(2018): Influence of High Current-Density Impulses on the Stress-Strain Response and Microstructural Evolution of the Single Crystal Superalloy CMSX-4, Materials Research 21, 2018 (6), 1063
DOI: 10.1590/1980-5373-MR-2018-0428 -
(2018): Effect of Electrical Pulses on the Mechanical Behavior of Single Crystals of Nickel-Based CMSX-4 Superalloy and the Mobility of Low-Angle Grain Boundary in Aluminum Bicrystals, Bulletin of the Russian Academy of Sciences: Physics 82, 2018 (9), 1079-1085
DOI: 10.3103/S106287381809006X -
(2018): The Influence of Alternating Low-Cycle Bending Loads on Sheet Properties Having an Hcp Crystal Lattice, J. of Materi Eng and Perform 27, 2018 (2), 541-549
DOI: 10.1007/s11665-018-3123-2 -
(2018): Surface integrity of turned laser-welded hybrid shafts, Prod. Eng. Res. Devel., 2018
DOI: 10.1007/s11740-018-0862-8 -
(2018): Technology-based re-contouring of blade integrated disks after weld repair, J. Eng. Gas Turbines Power, 2018
DOI: 10.1115/1.4040738 -
(2018): Investigation of the γ′-Strengthened Quaternary Co-Based Alloys Co-Al-W-Ta, Metall and Mat Trans A 49, 2018 (9), 4042-4057
DOI: 10.1007/s11661-018-4756-3 -
(2018): Development of B2 Shape Memory Intermetallics Beyond NiAl, CoNiAl and CoNiGa, Shap. Mem. Superelasticity 4, 2018 (3), 360-368
DOI: 10.1007/s40830-018-0180-1 -
(2018): Magnetic pulse controlled microstructure development in Co 49 Ni 21 Ga 30 single crystals, Materials Science and Technology 34, 2018 (16), 1954-1964
DOI: 10.1080/02670836.2018.1497129 -
(2018): Internal pressure as a key thermodynamic factor to obtain high-temperature superelasticity of shape memory alloys, Materials Letters 210, 2018, 252-254
DOI: 10.1016/j.matlet.2017.09.034 -
(2018): Direct Observation of Nano-dimensional Internal Structure of Ferromagnetic Domains in the Ferromagnetic Shape Memory Alloy Co-Ni-Ga, Journal of Magnetism and Magnetic Materials, 2018
DOI: 10.1016/j.jmmm.2018.06.066 -
(2018): Kontinuierliches Unterwasserschweißen mit Massivdrahtelektroden, Schweißen und Schneiden 70, 2018 (10), 720-726
-
(2018): Strategies for the Heat Treatment of Steel-Aluminium Hybrid Components, HTM 73, 2018 (5), 268-282
DOI: 10.3139/105.110368 -
(2018): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2018): Crystallographic Structure Analysis of a Ti-Ta Thin Film Materials Library Fabricated by Combinatorial Magnetron Sputtering, ACS combinatorial science 20, 2018 (3), 137-150
DOI: 10.1021/acscombsci.7b00135 -
(2018): Thermal Properties of Intermetallic Phases at the Interface of Aluminum-Copper Compound Castings, Adv. Eng. Mater. 20, 2018 (6), 1701027
DOI: 10.1002/adem.201701027 -
(2018): The Effect of SiC Addition on Microstructure and Mechanical Properties of Gas Tungsten Arc-Welded Ti-6Al-4V Alloy, J. of Materi Eng and Perform 27, 2018 (1), 253-260
DOI: 10.1007/s11665-017-3091-y -
(2018): Herstellungsprozess und Wälzfestigkeit von hybriden Hochleistungsbauteilen, Konstruktion 70, 2018 (9), 84-89 Weitere Informationen
-
(2018): Hydrogen-assisted failure in a bimodal twinning-induced plasticity steel: Delamination events and damage evolution, International Journal of Hydrogen Energy 43, 2018 (4), 2492-2502
DOI: 10.1016/j.ijhydene.2017.11.177 -
(2018): Future regeneration processes for high-pressure turbine blades, CEAS Aeronaut J 9, 2018 (1), 85-92
DOI: 10.1007/s13272-017-0277-9 -
(2018): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2018): Laser welding of dissimilar low-alloyed steel-steel butt joints and the effects of beam position and ultrasound excitation on the microstructure, Journal of Laser Applications 30, 2018 (3), 32417
-
(2018): Two-way shape memory effect and thermal cycling stability in Co 35 Ni 35 Al 30 single crystals by low-temperature martensite ageing, Scripta Materialia 150, 2018, 18-21
DOI: 10.1016/j.scriptamat.2018.02.013 -
(2018): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2018): Spiky Nickel Electrodes for Electrochemical Oxygen Evolution Catalysis by Femtosecond Laser Structuring, International Journal of Electrochemistry, 2018 (12), 1-12
DOI: 10.1155/2018/9875438 -
(2018): Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatings, Thermal Spray Bulletin 70, 2018 (2), 104-111
-
(2018): Inductive heat treatment as an alternative tempering method for the selective oxidation of 1.2379 tool steel surfaces, Dry Met. Forming OAJ FMT 4, 2018, 13-17
-
(2018): Resonant-Plasmon-Assisted Subwavelength Ablation by a Femtosecond Oscillator, Phys. Rev. Applied 9, 2018 (2), 024001-10
DOI: 10.1103/PhysRevApplied.9.024001 -
(2018): Impact of Plasmon-Induced Atoms Migration in Harmonic Generation, ACS Photonics 5, 2018 (4), 1208-1214
DOI: 10.1021/acsphotonics.7b01560 -
(2018): Modelling of the fatigue crack growth of a coated single crystalline nickel-based superalloy under thermal mechanical loading, International Journal of Fatigue 116, 2018, 268-274
DOI: 10.1016/j.ijfatigue.2018.06.015 -
(2018): The effect of temperature gradients in thermo-mechanical fatigue testing, Materials at High Temperatures 36, 2018 (2), 97-103
DOI: 10.1080/09603409.2018.1466500 -
(2018): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2018): Effects of microstructural mechanisms on the localized oxidation behavior of NiTi shape memory alloys in simulated body fluid, J Mater Sci 53, 2018 (2), 948-958
DOI: 10.1007/s10853-017-1586-4 -
(2018): Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-Beschichtungen, Unter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
-
(2018): Effect of Different Intercritical Annealing Treatments without and with Overaging on the Mechanical Material Behavior, Steel Research Int. 89, 2018 (10), 1800196
DOI: 10.1002/srin.201800196 -
(2018): Ion polishing as a method of imaging the magnetic structures in CoNiGa monocrystal, Results in Physics 10, 2018, 277-280
DOI: 10.1016/j.rinp.2018.06.020 -
(2017): How dry is dry? - A critical analysis of surface conditions used in dry metal forming, Dry Met. Forming OAJ FMT 3, 2017, 90-94
-
(2017): Hydrogen-enhanced Orientation Dependence of Stress Relaxation and Strain-aging in Hadfield Steel Single Crystals, Scripta Materialia 136, 2017, 101-105
DOI: 10.1016/j.scriptamat.2017.04.028 -
(2017): The Influence of the Thermomechanical Processing Regime on the Structural Evolution of Mo-Nb-Ti-V Microalloyed Steel Subjected to High-Pressure Torsion, Metall and Mat Trans A 48, 2017 (7), 3400-3409
DOI: 10.1007/s11661-017-4085-y -
(2017): Application of mechanical surface finishing processes for roughness reduction and fatigue improvement of additively manufactured Ti-6Al-4V parts, International Journal of Fatigue 102, 2017, 135-142
DOI: 10.1016/j.ijfatigue.2017.05.008 -
(2017): Influences on the formability and mechanical properties of 7000-aluminum alloys in hot and warm forming, J. Phys.: Conf. Ser. 896, 2017, 12004
DOI: 10.1088/1742-6596/896/1/012004 -
(2017): Investigation of the coating thickness of plasma-transferred arc deposition welded and cross wedge rolled hybrid parts, Prod. Eng. Res. Devel. 11, 2017 (3), 255-263
DOI: 10.1007/s11740-017-0734-7 -
(2017): Influence of High-Current-Density Impulses on the Compression Behavior: Experiments with Iron and a Nickel-Based Alloy, Journal of Materials Engineering and Performance 26, 2017 (1), 177-184
DOI: 10.1007/s11665-016-2457-x -
(2017): Residual stress formation after re-contouring of micro-plasma welded Ti−6Al−4 V parts by means of ball end milling, Mat.-wiss. u. Werkstofftech. 48, 2017 (11), 1034-1039
DOI: 10.1002/mawe.201600743 -
(2017): Rückbau von Stahlstrukturen unter Wasser mittels Laserstrahlschneiden, Schiff und Hafen 69, 2017 (11), 40-44
-
(2017): Formation and growth of voids in dual-phase steel at microscale and nanoscale levels, Journal of Materials Science 52, 2017 (8), 4234-4243
DOI: 10.1007/s10853-016-0678-x -
(2017): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics 26, 2016 (8), 1147-1169
DOI: 10.1177/1056789516650245 -
(2017): Microstructural characterization and simulation of damage for geared sheet components, J. Phys.: Conf. Ser. 896, 2017, 12076
DOI: 10.1088/1742-6596/896/1/012076 -
(2017): Pulsed magnetic field-induced changes in the meso- and nanostructure of Co49Ni21Ga30 martensite, Funct. Mater. Lett. 10, 2017 (04), 1750044
DOI: 10.1142/S1793604717500448 -
(2017): Manuelles und halbautomatisches Elektrokontakttrennen von Spundwänden unter Wasser, Schweißen und Schneiden 69, 2017 (5), 244-251
-
(2017): Die Sonnenscheibe aus Moordorf - Bronzezeit oder Fälschung, DGM-Jahresmagazin - Materialographie/Metallographie 2017, 44-46
-
(2017): Microstructure and Mechanical Properties of Friction Welded Steel-Aluminum Hybrid Components after T6 Heat Treatment, Materials Science and Engineering: A 696, 2017, 33-41
DOI: 10.1016/j.msea.2017.04.052 -
(2017): Method for Semi-Automated Measurement and Statistical Evaluation of Iron Aluminum Intermetallic Compound Layer Thickness and Morphology, Metallogr. Microstruct. Anal. 6, 2017 (5), 367-374
DOI: 10.1007/s13632-017-0378-1 -
(2017): Influence of martensitic transformation on the magnetic transition in Ni-Mn-Ga, Journal of Magnetism and Magnetic Materials 432, 2017, 266-270
DOI: 10.1016/j.jmmm.2017.02.008 -
(2017): Laserstrahlschneiden unter Wasser für höhere Produktivität, Schweißen und Schneiden 69, 2017 (11), 774-780
-
(2017): Microstructural evolution and functional fatigue of a Ti–25Ta high-temperature shape memory alloy, J. Mater. Res. 32, 2017 (23), 4287-4295
DOI: 10.1557/jmr.2017.319 -
(2017): Influence of Cross Wedge Rolling on the Coating Quality of Plasma-Transferred Arc Deposition Welded Hybrid Steel Parts, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (7), 1-7
-
(2017): Influence of silicon on the structure and weldability of steel-aluminium joints processed by non-vacuum electron beam welding, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (9), 348-356
-
(2017): A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/Al, J Therm Spray Tech 26, 2017 (7), 1659-1668
DOI: 10.1007/s11666-017-0612-z -
(2017): Surface modification of an austenitic stainless steel wire by a multi-pulse treatment with a high-power electric current, Journal of Materials Science 52, 2017 (13), 8007-8015
DOI: 10.1007/s10853-017-1003-z -
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten Druckgussbauteilen, Giesserei Special, 2017 (1), 74-89 Weitere Informationen
-
(2017): Two-way shape memory effect under multi-cycles in [001]-oriented Ni 49 Fe 18 Ga 27 Co 6 single crystal, Materials Science and Engineering: A 706, 2017, 95-103
DOI: 10.1016/j.msea.2017.08.108 -
(2017): An EBSD Evaluation of the Microstructure of Crept Nimonic 101 for the Validation of a Polycrystal–Plasticity Model, J. of Materi Eng and Perform 26, 2017 (12), 6087-6098
DOI: 10.1007/s11665-017-3046-3 -
(2017): Einschluss oder Zugriff, Tiefenlagerung ohne oder mit Vorkehrungen zur Rückholbarkeit, GAiA Ökologische Perspektiven für Wissenschaft und Gesellschaft, 2017 (2), 114-117
DOI: 10.14512/gaia.26.2.13 -
(2017): Engineering of biodegradable magnesium alloy scaffolds to stabilize biological myocardial grafts, Biomedizinische Technik. Biomedical engineering 62, 2017 (5), 493-504
DOI: 10.1515/bmt-2016-0205 -
(2017): Investigating the origin of third harmonic generation from diabolo optical antennas, Appl. Phys. Lett. 111, 2017 (17), 173102
DOI: 10.1063/1.5001005 -
(2017): Self-optimization of plasmonic nanoantennas in strong femtosecond fields, Optica 4, 2017 (9), 1038-1043
DOI: 10.1364/OPTICA.4.001038 -
(2017): Robotic guided waterjet cutting technique for high tibial dome osteotomy: A pilot study, The international journal of medical robotics + computer assisted surgery MRCAS 4, 2017 (2), 174-179
DOI: 10.1002/rcs.1825 -
(2017): Mechanical Properties of Co-Extruded Aluminium-Steel Compounds, Key Engineering Materials 742, 2017, 512-519
DOI: 10.4028/www.scientific.net/KEM.742.512 -
(2017): Peculiarities of high-temperature superelasticity in Ni–Fe–Ga single crystals in compression, Tech. Phys. Lett. 43, 2017 (3), 320-323
DOI: 10.1134/S1063785017030245 -
(2017): 1-Step “Quenching and Partitioning” of the Press-Hardening Steel 22MnB5, Steel Research Int. 88, 2017 (6), 1600307
DOI: 10.1002/srin.201600307 -
(2017): The Effect of Intercritical Annealing on the Microstructure and Mechanical Properties of Ferritic-Martensitic Two-Phase Steels, Steel Research Int. 88, 2017 (2), 271-280
DOI: 10.1002/srin.201600107 -
(2017): Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal forming, Wear 376-377, 2017, 1789-1803
DOI: 10.1016/j.wear.2017.01.084 -
(2017): Wear Testing of Thermally Oxidised Tool Steel Specimens with α-Fe2O3 Layers, Dry Met. Forming OAJ FMT 3, 2017, 45-49
-
(2017): Automatable Splicing Method for Steel Cord Conveyor Belts – Evaluation of Water Jetting as a Preparation Process, Journal of Mechanical Engineering 63, 2017 (10), 590-596
DOI: 10.5545/sv-jme.2017.4363 -
(2017): Zn-Li alloy after extrusion and drawing: Structural, mechanical characterization, and biodegradation in abdominal aorta of rat, Materials Science and Engineering: C 76, 2017, 301-312
DOI: 10.1016/j.msec.2017.02.167 -
(2016): Effect of strain rate on hydrogen embrittlement susceptibility of twinning-induced plasticity steel pre-charged with high-pressure hydrogen gas, International Journal of Hydrogen Energy 41, 2016 (34), 15362-15372
DOI: 10.1016/j.ijhydene.2016.06.259 -
(2016): Process Integrated Heat Treatment of a Microalloyed Medium Carbon Steel: Microstructure and Mechanical Properties, J. of Materi Eng and Perform 25, 2016 (4), 1453-1462
DOI: 10.1007/s11665-016-2004-9 -
(2016): Role of nanotwins on fatigue crack growth resistance – Experiments and theory, International Journal of Fatigue 84, 2016, 28-39
DOI: 10.1016/j.ijfatigue.2015.11.012 -
(2016): Biocompatibility and degradation of LAE442-based magnesium alloys after implantation of up to 3.5years in a rabbit model, Acta Biomaterialia 44, 2016, 355-365
DOI: 10.1016/j.actbio.2016.08.002 -
(2016): Umformtechnische Herstellung hybrider Lagerbuchsen, wt Werkstattstechnik online 106, 2016 (10), 743-748
-
(2016): Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf Titanbasis, Forsch. Ingenieurwes. 81, 2017 (1), 1-12
DOI: 10.1007/s10010-016-0209-6 -
(2016): Qualifying Electrically Conductive Cold Embedding-Media for Scanning Electron Microscopy, Metallogr. Microstruct. Anal. 5, 2016 (4), 332-341
DOI: 10.1007/s13632-016-0286-9 -
(2016): Induction heat treatment of sheet-bulk metal-formed parts assisted by water-air spray cooling, Steel Research Int. 87, 2016 (9), 1220-1227
DOI: 10.1002/srin.201500404 -
(2016): Ion Beam Processing in the Sample Preparation for the Analysis of Ductile Damage in Deep Drawing Steels, Prakt. Metallogr. 53, 2016 (4), 221-236
DOI: 10.3139/147.110377 -
(2016): Specimen Preparation by Ion Beam Slope Cutting for Characterization of Ductile Damage by Scanning Electron Microscopy, Microsc. Res. Tech. 79, 2016 (4), 321-327
DOI: 10.1002/jemt.22633 -
(2016): Ductile Damage and Fatigue Behavior of Semi-Finished Tailored Blanks for Sheet-Bulk Metal Forming Processes, Journal of Materials Engineering and Performance 25, 2016 (3), 1136-1142
DOI: 10.1007/s11665-016-1908-8 -
(2016): Modelling the Plasma Jet in Multi-Arc Plasma Spraying, J Therm Spray Tech 25, 2016 (6), 1111-1126
DOI: 10.1007/s11666-016-0438-0 -
(2016): Impact of intraprosthetic drilling on the strength of the femoral stem in periprosthetic fractures: A finite element investigation, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Engineering in Medicine 230, 2016 (7), 675-681
DOI: 10.1177/0954411916647078 -
(2016): Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling process, Mat.-wiss. u. Werkstofftech 47, 2016 (8), 780-788
DOI: 10.1002/mawe.201600612 -
(2016): Effect of Deformation Texture on the Anisotropy of Elasticity and Damage of Two Phase Steel Sheets, The Physics of Metals and Metallography 117, 2016 (7), 719-724
DOI: 10.1134/S0031918X16050033 -
(2016): MgNd2 alloy in contact with nasal mucosa: an in vivo and in vitro approach, J Mater Sci: Mater Med 27, 2016 (2), 25
DOI: 10.1007/s10856-015-5636-7 -
(2016): Thermal Stability of the Structure of a Heat-Resistant Cobalt Alloy Hardened with Intermetallic γ'-Phase Precipitates, Russian Metallurgy, 2016 (4), 286-291
-
(2016): The effect of texture in modeling deformation processes of bcc steel sheets, Materials Letters 164, 2016, 356-359
DOI: 10.1016/j.matlet.2015.11.007 -
(2016): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics, 2016
DOI: 10.1177/1056789516650245 -
(2016): Cutting and Welding of High-Strength Steels Using Non-Vacuum Electron Beam as a Universal Tool for Material Processing, WJET 04, 2016 (04), 598-607
DOI: 10.4236/wjet.2016.44056 -
(2016): Holistic consideration of grain growth behavior of tempering steel 34CrNiMo6 during heating processes, Journal of Materials Processing Technology 229, 2016, 61-71
DOI: 10.1016/j.jmatprotec.2015.09.015 -
(2016): Determination of heat transfer coefficients for complex spray cooling arrangements, International Journal of Microstructure and Materials Properties 11, 2016 3/4, 229-246
DOI: 10.1504/IJMMP.2016.079149 -
(2016): Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter Prozessgase, Schweißen und Schneiden 68, 2016 (5)
-
(2016): Influence of the Surface and Heat Treatment on the Bond Strength of Galvanized Steel/Aluminum Composites Joined by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (8), 1371-1380
DOI: 10.1002/adem.201600085 -
(2016): Molecular Engineering of Aluminum-Copper Interfaces for Joining by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (6), 1066-1074
DOI: 10.1002/adem.201500501 -
(2016): Effect of Pre-Rolling Heat Treatments on the Bond Strength of Cladded Galvanized Steels in a Cold Roll Bonding Process, Steel Research Int. 87, 2016 (12), 1619-1626
DOI: 10.1002/srin.201600021 -
(2016): Evaluation of Void Nucleation and Development during Plastic Deformation of Dual-Phase Steel DP600, Steel Research Int. 87, 2016 (12), 1583-1591
DOI: 10.1002/srin.201500483 -
(2016): Investigations of ductile damage in DP600 and DC04 deep drawing steel sheets during punching, Procedia Structural Integrity 2, 2016, 673-680
DOI: 10.1016/j.prostr.2016.06.087 -
(2016): Investigations of ductile damage during the process chains of toothed functional components manufactured by sheet-bulk metal forming, Production Engineering 10, 2016 (1), 5-15
DOI: 10.1007/s11740-016-0656-9 -
(2016): Experimental and numerical investigation of increased formability in combined quasi-static and high-speed forming processes, Journal of Materials Processing Technology 237, 2016, 254-269
DOI: 10.1016/j.jmatprotec.2016.06.007 -
(2016): Corrosion behavior, biocompatibility and biomechanical stability of a prototype magnesium-based biodegradable intramedullary nailing system, Materials Science and Engineering: C 59, 129-135
DOI: 10.1016/j.msec.2015.10.006 -
(2016): Cyclic Degradation of Co49Ni21Ga30 High-Temperature Shape Memory Alloy: On the Roles of Dislocation Activity and Chemical Order, Shap. Mem. Superelasticity 2, 2016 (1), 37-49
DOI: 10.1007/s40830-015-0049-5 -
(2016): 57Fe Mössbauer, SEM/EDX, p-XRF and μ-XRF studies on a Dutch painting, Hyperfine Interact 237, 2016 (1)
DOI: 10.1007/s10751-016-1296-3 -
(2016): Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging Die, Advanced Materials Research 1140, 2016, 91-98
DOI: 10.4028/www.scientific.net/AMR.1140.91 -
(2016): Ex-situ and in-situ investigations of thermal anti-oxidation treatments of stainless steels by reflection mode EXAFS, J. Phys.: Conf. Ser. 712, 2016, 12047
DOI: 10.1088/1742-6596/712/1/012047 -
(2016): Analysis of Microstructure and Damage Evolution in Ultra-Thin Wires of the Magnesium Alloy MgCa0.8 at Multipass Drawing, JOM 68, 2016 (12), 3063-3069
DOI: 10.1007/s11837-016-2127-3 -
(2016): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, Thermal Spray Bulletin 68, 2016 (1), 54-59
-
(2016): Micro-Scale Cyclic Bending Response of NiTi Shape Memory Alloy, Materials Transactions 57, 2016 (3), 472-475
DOI: 10.2320/matertrans.M2015423 -
(2016): Intelligente Schmiedewerkzeuge – Effizienter Verschleißschutz durch zyklische Randschichthärtung?, massivUMFORMUNG, 2016 (3), 44-48
-
(2016): Phosphate conversion coating reduces the degradation rate and suppresses side effects of metallic magnesium implants in an animal model, J. Biomed. Mater. Res., 2016
DOI: 10.1002/jbm.b.33704 -
(2016): Turbine blade wear and damage – An overview of advanced characterization techniques, Materials Testing 58, 2016 (5), 389-394
DOI: 10.3139/120.110872 -
(2016): Influence of surface pre-treatments on the high-cycle fatigue behavior of Ti–6Al–4V – From anodizing to laser-assisted techniques, International Journal of Fatigue 91, 2016, 195-203
DOI: 10.1016/j.ijfatigue.2016.06.010 -
(2016): An exploration of plastic deformation dependence of cell viability and adhesion in metallic implant materials, Journal of the Mechanical Behavior of Biomedical Materials 60, 2016, 177-186
DOI: 10.1016/j.jmbbm.2016.01.001 -
(2016): Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und Festwalzen, Werkstoffe in der Fertigung, 2016 (4), 27-28
-
(2016): New Specimen Design for Wear Investigations in Dry Sheet Metal Forming, Dry Met. Forming OAJ FMT 2, 2016, 62-66
-
(2015): Numerical Modelling of the Tribology of a Selective Oxidised 1.2379 Tool Steel Surface Developed for Dry Metal Forming , Dry Met. Forming OAJ FMT 1, 2015; 91-95
-
(2015): Testing of pipe sections, Materials Testing 57, 2015 (7-8); 643-648.
DOI: 10.3139/120.110759 -
(2015): On the micro-deformation mechanisms active in high-manganese austenitic steels under impact loading, Materials Science and Engineering: A, 632; 29-34
DOI: 10.1016/j.msea.2015.02.054 -
(2015): The influence of storage and heat treatment on a magnesium-based implant material: an in vitro and in vivo study, BioMedical Engineering OnLine 14 (1), 1680
-
(2015): In-situ-Erfassung der Werkstoffumwandlung und Gefügeausbildung von Schmiedebauteilen im Abkühlpfad, HTM Journal of Heat Treatment and Materials 70 (3), 2015; S. 150-161
DOI: 10.3139/105.110259 -
(2015): Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatment, La Metallurgia Italiana - International Journal of the Italian Association for Metallurgy 2015 (11/12), 29-37
-
(2015): Mechanical response of low stacking fault energy Co–Ni alloys – Continuum, mesoscopic and atomic level treatments, International Journal of Plasticity 71, 2015; 32-61
-
(2015): Biodegradable nasal stents (MgF 2 -coated Mg-2 wt %Nd alloy)-A long-term in vivo study, Journal of Biomedical Materials Research Part B: Applied Biomaterials
DOI: 10.1002/jbm.b.33559 -
(2015): A novel biodegradable frontal sinus stent (MgNd2): a long-term animal study, European Archives of Oto-Rhino-Laryngology
DOI: 10.1007/s00405-015-3774-7 -
(2015): Verbundguss von Aluminium und Kupfer für Anwendungen als Hochleistungskühlkörper, Giesserei Praxis 66 (10); 459-462
-
(2015): Characterization of the Microstructure Evolution in IF-Steel and AA6016 during Plane-Strain Tension and Simple Shear, Materials 8; 285-301
DOI: 10.3390/ma8010285 -
(2015): Extrusion of the bimetallic aluminum-magnesium rods and tubes, Forsch Ingenieurwes 79, 2015 (1-2); 17–27
DOI: 10.1007/s10010-015-0184-3 -
(2015): Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-Coatings, Applied Mechanics and Materials 788, 2015, 143-150
DOI: 10.4028/www.scientific.net/AMM.788.143 -
(2015): The effectiveness of spheroidization pearlitic steel with regard to the degree of plastic deformation, Interdisciplinary Journal of Engineering Sciences, 3, 2015 (1); 6-9
-
(2015): Twinning activities in high-Mn austenitic steels under high-velocity compressive loading, Materials Science and Engineering: A 648; 104-112.
DOI: dx.doi.org/10.1016/j.msea.2015.09.045 -
(2015): Systematic investigation into wet arc welding under water with covered stick electrodes, Welding and Cutting 14, 2015 (1), 48-53
-
(2015): Kraftschlüssiger Spaltausgleich an imperfekten Flanschverbindungen, Schiff und Hafen 10, 2015; 40-42.
-
(2015): Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVER, Welding and Cutting 14 (1), 2015, S. 48-53
-
(2015): Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steel, Welding and Cutting, 14, 2015 (5), 280-288
-
(2015): Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-Stahl, Schweißen und Schneiden, 67, 2015 (4), 174-182
-
(2015): Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating, Acta Biomaterialia 11, S. 488–493
DOI: 10.1016/j.actbio.2014.09.042 -
(2015): Martensite stabilization in shape memory alloys – Experimental evidence for short-range ordering, Materials Letters 159, 2015; S. 16-19.
DOI: 10.1016/j.matlet.2015.06.048 -
(2015): Microstructure and transformation related behaviors of a Ni45.3Ti29.7Hf20Cu5 high temperature shape memory alloy, Materials Science and Engineering: A 627, S. 82–94
DOI: 10.1016/j.msea.2014.12.111 -
(2015): Finite element analysis of combined forming processes by means of rate dependent ductile damage modelling, International Journal of Material Forming, 2015
DOI: 10.1007/s12289-015-1278-z -
(2015): Friction-locked gap compensation in imperfect flange connections, Ship & Offshore 6, 2015, 36 - 38.
-
(2015): Transplantation von thermisch gespritzten Schichten, Thermal Spray Bulletin 8, 2015 (1), 50-55.
-
(2015): Stress-induced resistivity changes in a Ni-Mn-In alloy, Applied Physics Letters, 2015, 106; 131908.
DOI: 10.1063/1.4917016 -
(2015): Functional Fatigue and Tension–Compression Asymmetry in [001]-Oriented Co49Ni21Ga30 High-Temperature Shape Memory Alloy Single Crystals, Shape Memory and Superelasticity 1 (1), 2015; 6-17.
DOI: 10.1007/s40830-015-0003-6 -
(2015): Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine blades, Thermal Spray Bulletin, 2015, 8; S. 56-61.
-
(2015): Martensite aging – Avenue to new high temperature shape memory alloys, Acta Materialia 89, S. 298-304
DOI: 10.1016/j.actamat.2015.01.042 -
(2015): Cyclic degradation of titanium–tantalum high-temperature shape memory alloys — the role of dislocation activity and chemical decomposition, Functional Materials Letters 8, 2015; S. 1550062-1 - 1550062-5
DOI: 10.1142/S1793604715500629 -
(2015): Superelasticity in high-strength heterophase single crystals of Ni51.0Ti36.5Hf12.5 alloy, Technical Physics Letters 41 (8), 2015; 797-800.
DOI: 10.1134/S1063785015080283 -
(2015): A Single-Crystal Co-Base Superalloy Strengthened by γ′ Precipitates: Structure and Mechanical Properties, Advanced Engineering Materials 17 (6) 2015, 755-760
DOI: 10.1002/adem.201500088 -
(2015): Alkalization is responsible for antibacterial effects of corroding magnesium, Journal of Biomedical Materials Research Part A, 2015
DOI: 10.1002/jbm.a.35503 -
(2015): In vitro and in vivo corrosion of the novel magnesium alloy Mg–La–Nd–Zr: influence of the measurement technique and in vivo implant location, Biomedical Materials 10 (4) 2015, 045021
DOI: 10.1088/1748-6041/10/4/045021 -
(2015): Neue Anwendungsbereiche numerischer Simulation beim induktiven Randschichthärten mit Feldkonzentratoren, HTM Journal of Heat Treatment and Materials 70 (1), S. 40-49
DOI: 10.3139/105.110250 -
(2015): Investigation of cold pressure welding: cohesion coefficient of copper, Key Engineering Materials 651-653 (2015), S. 1421-1426
DOI: 10.4028/www.scientific.net/KEM.651-653.1421 -
(2015): Herstellung, biomechanische Prüfung und Integrationsverhalten biologischer Interferenzschrauben aus ossärem Material, Fuß & Sprunggelenk 13, 2015, 182–191
DOI: 10.1016/j.fuspru.2015.06.001 -
(2015): Processing of New Materials by Additive Manufacturing: Iron-Based Alloys Containing Silver for Biomedical Applications, Metall. Mater. Trans. A 46, 2015; S. 2829-2833
DOI: 10.1007/s11661-015-2932-2 -
(2015): One-way and two-way shape memory effect in ferromagnetic NiFeGaCo single crystals, Materials Science and Engineering: A 640, 2015; 465-470
DOI: 10.1016/j.msea.2015.06.024 -
(2015): Influence of the Gap Width on the Geometry of the Welded Joint in Hybrid Laser-Arc Welding, Physics Procedia 78, 2015, 14-23
DOI: 10.1016/j.phpro.2015.11.013 -
(2015): Damage Evolution in Pseudoelastic Polycrystalline Co-Ni-Ga High-temperature Shape Memory Alloys, Journal of Alloys and Compounds 633, 2015; 288-295.
DOI: 10.1016/j.jallcom.2015.01.282 -
(2015): Biocompatibility of MgF2-coated MgNd2 specimens in contact with mucosa of the nasal sinus – A long term study, Acta Biomaterialia 18, 2015; 249-261
DOI: 10.1016/j.actbio.2015.03.003 -
(2015): Magnesium-containing layered double hydroxides as orthopaedic implant coating materials-An in vitro and in vivo study, J. Biomed. Mater. Res. (Journal of Biomedical Materials Research Part B: Applied Biomaterials) 04/2015
DOI: DOI: 10.1002/jbm.b.33422 -
(2015): Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal Forming, Dry Met. Forming OAJ FMT 1, 2015, 72-78
-
(2014): Twin Nucleation in Fe-based BCC Alloys - Modeling and Experiments, Modell. Sim. Mater. Sci. Eng., 22, S. 075010-1 - 075010-21
DOI: 10.1088/0965-0393/22/7/075010 -
(2014): Microstructure and mechanical response of single-crystalline high-manganese austenitic steels under high-pressure torsion: The effect of stacking-fault energy, Materials Science and Engineering A., (604), S. 166-175
DOI: 10.1016/j.msea.2014.03.029 -
(2014): Non-vacuum electron-beam carburizing and surface hardening of mild steel, Applied Surface Science 322; S. 6-14
DOI: 10.1016/j.apsusc.2014.09.137 -
(2014): Metalle, die sich erinnern: Mit Formgedächtnis immer in der richtigen Fassung, Unimagazin 01/02 2014, S. 30-33
-
(2014): A method to detect the level and direction of mechanical forces with the aid of load-induced martensitic phase transformation, Prod. Eng. Res. Devel., vol 8, 63-72
-
(2014): Verbundbohrwerkzeug vereint Eigenschaftsvorteile der Fügepartner, Forum Schneidwerkzeug- und Schleiftechnik, Forum Schneidwerkzeug- und Schleiftechnik, 2014, 102-109
-
(2014): Active brazed ceramic cemented carbide compound drills for machining lamellar graphite cast iron, Prod. Eng. Res. Devel. (Production Engineering), 2014, vol. 8, 3
DOI: 10.1007/s11740-014-0547-x -
(2014): Texture and Mechanical Properties of AZ31 Magnesium Alloy Sheets Rolled of Blanks, Technology of Metals 2, S. 12-18
-
(2014): Mechanical Properties of AZ31 Alloy Sheets Deformed by Low-Cycle Reverse Bending, The Physics of Metals and Metallography 115 (1), S. 98-105
DOI: 10.1134/S0031918X14010037 -
(2014): EcoForge – Ressourceneffiziente Prozessketten für Hochleistungsbauteile , Schmiede Journal (2), S. 22-27
-
(2014): Analyse der Biofilmbildung auf kieferorthopädischen Apparaturen, ZWR - Das Deutsche Zahnärzteblatt 123, 2014 (05), 192-199
DOI: 10.1055/s-0034-1383514 -
(2014): Kurzer Prozess – Umformen und Härten, Technologie-Informationen, Innovation Niedersachsen, 2/2014, S. 7 Weitere Informationen
-
(2014): Microstructural evolution in the bonding zones of co-extruded aluminium/titanium, J Mater Sci, 2014, vol. 49, 2442-2455
DOI: 10.1007/s10853-013-7912-6 -
(2014): Joining with electrochemical support (ECUF): Cold pressure welding of copper, Journal of Materials Processing Technology, 2014, vol. 214, 2179–2187
DOI: http://dx.doi.org/10.1016/j.jmatprotec.2014.04.015 -
(2014): Non-destructive detection of weld seams in extruded aluminium profiles, In: Key Engineering Materials 585, S. 103–110.
-
(2014): EcoForge Energieeffiziente Prozesskette zur Herstellung von Hochleistungs-Schmiedebauteilen, HTM Journal of Heat Treatment and Materials, 69 (4), S. 209-219
DOI: 10.3139/105.110220 -
(2014): Interfacial adhesion of zirconia/veneer bilayers with different thermal characteristics, Dent. Mater. J. 33 (5), S. 583–590.
DOI: 10.4012/dmj.2013-181 -
(2014): Structural Evolution of Thin Lamellar Cementite during Cold Drawing of Eutectoid Steels, Procedia Engineering 2014 (81), S. 694–699
DOI: 10.1016/j.proeng.2014.10.062 -
(2014): Characterization of the interface of co-extruded asymmetric aluminum-titanium composite profiles, Materialwissenschaft und Werkstofftechnik, 2014, 45; S. 1054-1060
DOI: 10.1002/mawe.201400353 -
(2014): Formation and Properties of Mixed Ferritic-Martensitic Microstructures in the Air-Hardening Steel LH800, steel research int. 85 (9), S. 1340-1347
DOI: 10.1002/srin.201300420 -
(2014): Suitable Impact Parameters for High-Speed Joining and Influence on the Bonding Zone Microstructure, Journal of Materials Engineering and Performance 23 (3), S. 944-953
DOI: 10.1007/s11665-013-0845-z -
(2014): Digital image correlation at high temperatures for fatigue and phase transformation studies, The Journal of Strain Analysis for Engineering Design (49), S. 204-211
DOI: 10.1177/0309324713498737 -
(2014): Effect of thermal cycling on the martensitic transformation in Ni-Mn-In alloys, Journal of Applied Physics, 116; S. 103515
DOI: 10.1063/1.4895585 -
(2014): Thermal Cycling Behavior of an Aged FeNiCoAlTa Single-crystal Shape Memory Alloy, Scripta Materialia (81), S. 28–31
DOI: 10.1016/j.scriptamat.2014.02.020 -
(2014): Microstructural and Tribological Characterization of Atmospheric Plasma-Nitrided HS6-5-2C Tool Steel, Applied Mechanics and Materials, 2014, 698; S. 345-350
DOI: 10.4028/www.scientific.net/AMM.698.345 -
(2014): Thermal anti-oxidation treatment of CrNi-steels as studied by EXAFS in reflection mode: the influence of monosilane additions in the gas atmosphere of a continuous annealing furnace, Journal of Material Science, 49, 2014, 5454-5461
DOI: 10.1007/s10853-014-8257-5 -
(2014): Geometric adaption of biodegradable magnesium alloy scaffolds to stabilise bio-logical myocardial grafts. Part I, Journal of Materials Science: Materials in Medicine (Springer Verlag), Volume 25, S. 909-916 Weitere Informationen
DOI: 10.1007/s10856-013-5100-5 -
(2014): Sandwich rolling of twin-roll cast aluminium-steel clad strips, Procedia Engineering 2014 (81) S. 1541-1546
DOI: 10.1016/j.proeng.2014.10.187 -
(2014): Setting Discrete Yield-stress Sensors for Recording Early Component Loading Using Eddy-current Array Technology and Induction Thermography, Procedia Technology (15), S. 484–493
DOI: 10.1016/j.protcy.2014.09.008 -
(2014): Characterisation of electron beams generated by a plasma cathode gun, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 242-248, ISSN: 0861-4717
-
(2014): On the functional degradation of binary titanium–tantalum high-temperature shape memory alloys — A new concept for fatigue life extension, Funct. Mater. Lett.; 2014
DOI: 10.1142/S1793604714500428 -
(2014): Functional and structural fatigue of titanium tantalum high temperature shape memory alloys (HT SMAs), Materials Science and Engineering: A (620), S. 359-366
DOI: 10.1016/j.msea.2014.10.038 -
(2014): Spray cooling of extruded EN AW-6082 aluminium alloy sheets: spatial heat transfer coefficients, Forsch Ingenieurwes 78 (1-2), S. 1-7
DOI: 10.1007/s10010-014-0181-y -
(2014): Twin Migration in Fe-based BCC Crystals: Theory and Experiments, Philosophical Magazine, 2014, vol. 94:16, 1816-1840
DOI: http://dx.doi.org/10.1080/14786435.2014.898123 -
(2014): Cyclic Degradation Mechanisms in Aged FeNiCoAlTa Shape Memory Single Crystals, Acta Materialia 79, S. 126-137
DOI: http://dx.doi.org/10.1016/j.actamat.2014.06.019 -
(2014): Two-way Shape Memory Effect in Ferromagnetic Co₃₅Ni₃₅Al₃₀ Single Crystals Aged Under Stress, Scripta Materialia, 2014, Vol. 90-91, S. 10-13
DOI: 10.1016/j.scriptamat.2014.06.034 -
(2014): Complex Investigations of the Influence of Low Cycle Sign-Variable Bending on the Mechanical Properties of Magnesium Alloy AZ31 Sheet , Plastic Deformation of Metals 1, S. 23-27
-
(2014): Joining with electrochemical support: cold pressure welding of copper – weld formation and characterization, Advanced Materials Research, 2014, vol. 966-967, 453-460
DOI: 10.4028/www.scientific.net/AMR.966-967.453 -
(2014): In vivo degradation effects of alloy MgNd2 in contact with mucous tissue, Journal of biomedical materials research. Part A.
DOI: 10.1002/jbm.a.35382 -
(2014): Effect of Reverse Bending on Texture, Structure and Mechanical Properties of Sheets of Magnesium Alloys with Zinc and Zirconium, The Physics of Metals and Metallography 115 (6), S. 609-616
DOI: 10.1134/S0031918X1406012X -
(2014): Composite wires for flux-free arc brazing, WIRE – English edition of the magazine for the spring, wire and cable industry, 64 (1), S. 62-64
-
(2014): Zusatzwerkstoffe zum Lichtbogen-Hartlöten, DRAHT – Deutsche Ausgabe der Zeitschrift für die Feder-, Draht- und Kabelindustrie 65 (2), S. 72-74
-
(2014): Non-vacuum electron beam cutting - A new high performance process, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 303-309, ISSN: 0861-4717
-
(2014): Systematische Untersuchung zum nassen Lichtbogenschweißen unter Wasser mit umhüllten Stabelektroden, Schweißen und Schneiden, 2014, vol. 66, 05, 250-256 Weitere Informationen
-
(2014): On the Role of Slip - Twin Interactions on the Impact Behavior of High-Manganese Austenitic Steels, Mater. Sci. Eng. A., vol. 593, 120–126.
-
(2014): New design and construction of expandable casing tubes, Forschung im Ingenieurwesen 78 (3-4), S. 145-149 Weitere Informationen
-
(2014): Dislocation slip stress prediction in shape memory alloys, International Journal of Plasticity 54, S. 247–266
DOI: 10.1016/j.ijplas.2013.08.017 -
(2014): Novel magnesium alloy Mg-2La caused no cytotoxic effects on cells in physiological conditions, Materials science & engineering. C, Materials for biological applications 41, S. 267–273
DOI: 10.1016/j.msec.2014.04.063 -
(2014): The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloys, IJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
DOI: 10.3139/146.111022 -
(2013): Fatigue crack initiation in Hastelloy X - the role of boundaries, Fatigue & Fracture of Engineering Materials & Structures, 2013, 36 (8); 809-826.
DOI: 10.1111/ffe.12048 -
(2013): Increased accumulation of magnetic nanoparticles by magnetizable implant materials for the treatment of implant-associated complications, Journal of nanobiotechnology 11, S. 34
DOI: 10.1186/1477-3155-11-34 -
(2013): Magnesium‐based bone implants: Immunohistochemical analysis of peri‐implant osteogenesis by evaluation of osteopontin and osteocalcin expression, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.34828/full.
-
(2013): Influence of Heat Treatment on the Degradation Behaviour of Degradable Magnesium Based Implants, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4057/bmt-2013-4057.xml.
-
(2013): Die Qualität im Blick: Der Bainitsensor ermöglicht Einblicke in die Werkstoffumwandlung, phi - Produktionstechnik Hannover informiert, S. 6-7
-
(2013): Modeling Fatigue Crack Growth Resistance of Nanocrystalline Alloys, In: Acta Materialia 61, S. 2531–2547
-
(2013): Experimental characterization of microstructure development during loading path changes in bcc sheet steels, In: Journal of Materials Science 48 (2), S. 674–689
-
(2013): Biocompatibility of fluoride-coated magnesiumcalcium alloys with optimized degradation kinetics in a subcutaneous mouse model, In: J Biomed Mater Res Part A 101A, S. 33–43
-
(2013): The Biodegradable Magnesium Stent as an Alternative Treatment in Cases of chronic Ventilation Disorders of the Paranasal Sinuses, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4049/bmt-2013-4049.xml.
-
(2013): Laserbeschriftung von Hartferritmagneten zur Kennzeichnung von Druckgussteilen, In: Forschung im Ingenieurwesen 77 (1), S. 39–47. Online verfügbar unter http://link.springer.com/content/pdf/10.1007%2Fs10010-013-0161-7.pdf
-
(2013): Twin-roll casting of aluminum–steel clad strips, In: Journal of Manufacturing Processes 15 (4), S. 501–507.
-
(2013): Influence of Hot Deformation on Mechanical Properties and Microstructure of a Twin-Roll Cast Aluminium Alloy EN AW-6082, Journal of Materials Engineering and Performance 23 (3), S. 937-943 Weitere Informationen
DOI: 10.1007/s11665-013-0816-4 -
(2013): Evaluation of the biocompatibility of two magnesium alloys as degradable implant materials in comparison to titanium as non‐resorbable material in the rabbit, In: Materials Science and Engineering: C 33 (1), S. 317–326. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0928493112004237#.
-
(2013): Economical joining of tubular steel towers for wind turbines employing non-vacuum electron beam welding for high-strength steels in comarsion with sub-merged arc welding, In: Welding in the World. Online verfügbar unter http://www.springerlink.com/openurl.asp?genre=article&id=doi:10.1007/s40194-013-0050-6.
-
(2013): Nonvacuum electron beam cutting and welding—two partnering processes for fast and highly efficient metal working, In: Welding in the World 57 (3), S. 315–322. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs40194-013-0032-8.
-
(2013): Topographieoptimierende Präparation metallischer Werkstoffverbunde, In: Praktische Metallographie / Practical Metallography 50 (7), S. 491–500. Online verfügbar unter http://www.practical-metallography.com/PM110242.
-
(2013): Distribution of Microdefects in Sheets of St1.03-12 Low-Carbon Steel in Tension at Different Rates, Materials Science, Vol. 49, Nr. 2, S. 199–205
DOI: 10.1007/s11003-013-9599-x -
(2013): Korrosionsverhalten binärer Magnesium-Zink-Legierungen in salzhaltigen Medien, In: Materialwissenschaft und Werkstofftechnik 44 (1), S. 84–93.
-
(2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und Verschleißbeanspruchungen, In: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract
-
(2013): Verbund-Gießschmieden hybrider Aluminiumbauteile, Mat.-wiss. u. Werkstofftech. (Materialwissenschaft und Werkstofftechnik), S. 819-824
DOI: 10.1002/mawe.201300125 -
(2013): Inconel 939 Processed by Selective Laser Melting: Effect of Microstructure and Temperature on the Mechanical Properties Under Static and Cyclic Loading, In: Materials Science and Engineering A 588, S. 188–195.
-
(2013): Effects of Nanoprecipitation on the Shape Memory and Material Properties of an Ni-rich NiTiHf High Temperature Shape Memory Alloy, In: Acta Materialia 61, S. 7422–7431.
-
(2013): Influence of Cobalt on the Properties of Load-Sensitive Magnesium Alloys, In: Sensors 13, S. 106–118. Online verfügbar unter http://www.mdpi.com/1424-8220/13/1/106/.
-
(2013): Strong and tough magnesium wire reinforced phosphate cement composites for load-bearing bone replacement, In: Journal of the Mechanical Behavior of Biomedical Materials 20, S. 36–44.
-
(2013): Laser Induced Surface Nano-structuring of Ti-6Al-4V for Adhesive Bonding, In: Int. J. Adhesion & Adhesives 45, S. 112–117.
-
(2013): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: J Mater Sci: Mater Med 24, S. 417–436
-
(2013): Texture development and formability prediction for pre-textured cold rolled body-centred cubic steel, In: International Journal of Engineering Science 68 (July 2013), S. 24–37
DOI: 10.1016/j.ijengsci.2013.03.003 -
(2013): Annealing Behavior of Ultrafine Grained Structure in Low-carbon Steel Produced by Equal Channel Angular Pressing, In: Mater. Sci. Eng. A 581, S. 104–107
-
(2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von Turbinenschaufeln, In: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
-
(2013): Water-Air Spray Cooling of Extruded Profiles: Process Integrated Heat Treatment of the Alloy EN AW-6082, Journal of Materials Engineering and Performance 22, 2013 (9), 2580-2587
-
(2013): Polymer-bioceramic composite coatings on magnesium for biomaterial applications, In: Surface and Coatings Technology 236 (15), S. 420–428. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0257897213009638.
-
(2013): A numerical investigation of the interplay between cohesive cracking and plasticity in polycrystalline materials, In: Computational Materials Science 77, S. 81–92.
-
(2013): Creep Deformation and Mechanisms in Haynes 230 at 800 °C and 900 °C, In: J Nuclear Materials 443, S. 484–490.
-
(2013): Slip transmission in bcc FeCr polycrystal, Materials Science & Engineering A, 588 (2013); 308–317.
DOI: 10.1016/j.msea.2013.08.050 -
(2013): Degrading magnesium screws ZEK100: biomechanical testing, degradation analysis and soft-tissue biocompatibility in a rabbit model, In: Biomedical Materials 8 (4).
-
(2013): Assessment of cellular reactions to magnesium as implant material in comparison to titanium and to glyconate using the mouse tail model, In: JABFM 11 (2), S. 89–94.
-
(2013): Non-destructive determination of local damage and material condition in high-performance components, HTM (HTM Journal of Heat Treatment and Materials), S. 59-67
DOI: 10.3139/105.110176 -
(2013): Modeling of Spray Cooling during Induction Hardening of Spur Gearwheels Made from 42CrMo4 Hardening and Tempering Steel, Steel Research Int. 85 (5), S. 741-755
DOI: 10.1002/srin.201300201 -
(2013): Tempering Induction Hardened 42CrMo4 Steel Helical Gearwheels from Residual Heat Using Spray Cooling, steel research int. 85 (3), S. 415-425
DOI: 10.1002/srin.201300133 -
(2013): Microstructure evolution of the air-hardening steel LH800 due to heat treatment, In: Journal of Heat Treatment and Materials 68 (1), S. 42–48
-
(2013): In vivo degradation of magnesium alloy LA63 scaffolds for temporary stabilisation of biological myocardial grafts in a swine model, In: Biomedical Engineering/Biomedizinische Technik 58 (5), S. 407–416.
-
(2013): Partial Joining of Blanks with Electrochemical Support (ECUF), In: Key Engineering Materials 554-557, S. 1091–1095.
-
(2013): Magnesium Degradation Products: Effects on Tissue and Human Metabolism, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.35023/full.
-
(2013): MgNd2 : A Future Resorbable Magnesium-Based Implant Material?, In: Emerging Materials Research 2 (5), S. 239–247. Online verfügbar unter http://www.icevirtuallibrary.com/content/article/10.1680/emr.13.00034.
-
(2013): The effects of handling and storage on magnesium based implants — First results, In: Materials Science and Engineering: C 33 (5), S. 3010–3017.
-
(2013): Influence of the grain size on the in vivo degradation behaviour of the magnesium alloy LAE442, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Enginee-ring in Medicine 227 (3), S. 317–326.
-
(2013): Biodegradable magnesium implants for orthopedic applications, In: Journal of Materials Science 48 (1), S. 39–50. Online verfügbar unter http://www.springerlink.com/content/n33l6487g9388578/.
DOI: 10.1007/s10853-012-6572-2 -
(2013): Comparative in vitro study and biomechanical testing of two different magnesium alloys, Journal of Biomedical Applications 28, 2013 (8), 1264-1273
DOI: 10.1177/0885328213506758 -
(2013): Applicability of Degradable Magnesium LAE442 Alloy Plate-Screw-Systems in a Rabbit Model, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4059/bmt-2013-4059.xml.
-
(2013): Grain refining of aluminium alloys and silicon by means of boron-nitride particles, International Journal of Material Research (IJMR), S. 266-274
DOI: 10.3139/146.110866 -
(2012): Oberflächenveredelung durch Metall-Kapillardruckgießen, In: Mikroproduktion 2012/03, S. 62–67
-
(2012): Numerische Berechnung einer integrierten Wärmebehandlung für präzisionsge-schmiedete Bauteile, In: Journal of Heat Treatment and Materials 67, S. 337–343. Online verfügbar unter http://www.htm-journal.de/HT110156.
-
(2012): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK. Ein Überblick zum Abschluss des Projektes, Atw. Internationale Zeitschrift für Kernenergie 57, 2012 (4), 250-254
-
(2012): Effect of reversed bending on texture, structure and mechanical properties of low-carbon steels, In: Technologija Metallov (Technology of metals) (11), S. 19–24.
-
(2012): Long Term In Vivo Degradation Behaviour and Biocompatibility of the Magnesium Alloy ZEK100 for Use as Biodegradable Bone Implant, In: Acta Biomaterialia. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112004047
DOI: 10.1016/j.actbio.2012.08.028 -
(2012): Extrusion of hybrid sheet metals, Journal of Materials Processing Tech. 212 (2012), pp. 1030-1038 (Final version published online 18. Feb 2012)
DOI: 10.1016/j.jmatprotec.2011.12.013
ISBN: 0924-0136 -
(2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma Spraying, Journal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/
-
(2012): Preparation Routine for In Situ Strain Analysis of deep drawing Steel DC04 by Means of Transmission Electron Microscopy, In: Praktische Metallographie 2012 (9), S. 577–587
-
(2012): Investigation of ductile damage development in ferritic steel subject to uniaxial deformation, In: Fatigue & Fracture of Engineering Materials & Structures 35 (10), S. 936–942. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1111/j.1460-2695.2012.01679.x/full.
-
(2012): Analiz parametrov vodo-vozdušnogo sprejernogo ohlaždeniâ metalla v integrirovannyh tehnologičeskih processah, Metallurgičeskaja i gornorudnaja promyšlennost' 7, 2012, 208-212
-
(2012): Analiz izmeneniya temperatury metalla pri osevom vodovozdushnom spreyernom okhlazhdenii stalnykh tsilindricheskikh obraztsov, Metallurgičeskaja i gornorudnaja promyšlennost' 6, 2012, 33-39
-
(2012): Features of austenitic steels’ microstructure following plastic deformation, Materialwissenschaft und Werkstofftechnik, 43, (2012), No. 3
-
(2012): Increase the deformability of NiCo single crystals using of electrical pulse-like currents, Key Engineering Materials, 504-506, 143
DOI: 10.4028/www.scientific.net/KEM.504-506.143 -
(2012): Investigation of the Water-Air Cooling Process of the Thick-Walled Extruded Profile Made of Alloy AW-6060 on the Output Table, Metallurgical and mining industry 4 (2), S. 66–74
-
(2012): Issledovanie processa vodo-vozdušnogo ohlaždeniâ tolstostennogo pressovannogo profilâ iz splava EN AW-6060 na vyhodnom stole, In: Metallurgičeskaja i gornorudnaja promyšlennost' (2), S. 33–38
-
(2012): Influence of Cold Forming and Heat Treatment on the Microstructure and Mechani-cal Properties of an Air-Hardening Steel, In: Steel Research International 83 (11), S. 1020–1028. Weitere Informationen
-
(2012): Research on the Biocompatibility of the New Magnesium Alloy LANd442—An In Vivo Study in the Rabbit Tibia over 26 Weeks, Adv. Eng. Mater.; 14; pp. B28–B37
-
(2012): Sensorkontrolliertes Bainitisieren im Spraydüsenfeld, GWI Gaswärme International, 3, pp. 77-85
-
(2012): Influence of Aluminium on the Corrosion Behaviour of Binary Magnesium-Aluminium Alloys in Saline Solutions, Materials and Corrosion, DOI: 10.1002/maco.201206531
-
(2012): Einfluss der Oberflächenbehandlung auf das Korrosionsverhalten von Magnesiumlegierungen, In: Materialwissenschaft und Werkstofftechnik 43 (12), S. 1067–1073
-
(2012): In vivo assessment of the host reactions to the biodegra-dation of the two novel magnesium alloys ZEK100 and AX30 in an animal model, BioMedical Engineering OnLine; Vol.11 Iss. 14
-
(2012): Experimental and Numerical Investigations on Metal Flow during Direct Extrusion of EN AW-6082, Key Engineering Materials Vol. 491 (2012) pp 137-144
-
(2012): On the Improvement of Formability and the Prediction of Forming Limit Diagrams at Fracture by Means of Constitutive Modelling, KEM (Key Engineering Materials), S. 29-34
DOI: 10.4028/www.scientific.net/KEM.504-506.29 -
(2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing Processes, In: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.
-
(2012): Ressourceneffizienz bei der Herstellung von dichtereduzierten Stählen mit dem Bandgießverfahren, In: Chemie Ingenieur Technik 84 (10), S. 1740–1748. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/cite.201200061/abstract.
-
(2012): Magnetic Magnesium Alloys Based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 14, 1-2 S. 28-34
-
(2012): Mit magnetischen Legierungen werden ganze Bauteile zu Sensoren, In: Maschinenmarkt (39), S. 62–65. Online verfügbar unter http://www.maschinenmarkt.vogel.de/themenkanaele/konstruktion/werkstoffe/articles/379106/.
-
(2012): Casting Process and Comparison of the Properties of Adapted Load-Sensitive Magnesium Alloys, In: Production Engineering Research & Development. Online verfügbar unter http://link.springer.com/article/10.1007/s11740-012-0413-7.
-
(2012): Low-temperature degradation of different zirconia ceramics for dental applications , In: Acta Biomaterialia 8 (3), S. 1213–1220. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706111005034.
-
(2012): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: Journal of Materials Science: Materials in Medicine. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs10856-012-4812-2?LI=true.
-
(2012): Material Model Identification for DC04 Based on the Numerical Modelling of the Polycrystalline Microstructure and Experimental Data, Key Engineering Materials 504-506 pp.993–998
-
(2012): A Comparative Study of the Cytotoxicity and Corrosion Resistance of Nickel--titanium and Titanium-niobium Shape Memory Alloys, In: Acta Biomaterialia 8, S. 2863–2870
-
(2012): Numerical investigation of in situ TEM tensile tests, In: Metallurgical and mining industry 4 (4), S. 37–44
-
(2012): Investigation of the surface residual stresses in spray cooled induction hardened gearwheels, International Journal of Materials Research, Vol. 103, Nr. 1, pp. 73-79
DOI: 10.3139/146.110622 -
(2012): Stahlerzeugung am laufenden Band: Ressourcensparendes Walzgießen, In: Phi – Produktionstechnik Hannover informiert 13 (2), S. 16–17.
-
(2012): Neue Nickelhartlote für den Schutzgasdurchlaufofen, Schweissen und Schneiden 6 (64), S. 326–330
-
(2012): Application of a Bioactive Coating on Resorbable, Neodymium Containing Magnesium Alloys, and Analyses of their Effects on the In Vitro Degradation Behavior in a Simulated Body Fluid, Advanced Engineering Materials; DOI: 10.1002/adem.201180078; http://onlinelibrary.wiley.com/doi/10.1002/adem.201180078/full
-
(2012): Characterization of MgNd2 alloy for potential applications in bioresorbable implantable devices, In: Acta Biomaterialia 8 (10), S. 3852–3864. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112002371
-
(2012): Reverse Bending Effect on the Texture, Structure, and Mechanical Properties of Sheet Copper, In: The Physics of Metals and Metallography 112 (8), S. 810–816.
-
(2012): An investigation of the blanking process of the quenchable boron alloyed steel 22MnB5 before and after hot stamping process, Journal of Materials Processing Technology 212 (2012), 437– 449
DOI: 10.1016/j.jmatprotec.2011.10.006 -
(2012): Vlijanie bokovyh ogranichitelei na formirovanie tonkih polos pri valkovoi razlivke-prokatke, In: Metallurgiceskaja i gornorudnaja promyvlennost' 277 (5), S. 32–36
-
(2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von Aluminiumlegierungen, In: Schweißen und Schneiden 64 (8), S. 490–496.
-
(2012): Influence of reversed bending on texture, strcture and mechanical properties of α-titanium sheets, In: Deformation and Fracture of Materials (Deformatsiya I Razrushenie materialov) (9), S. 32–37.
-
(2012): Grain refining of aluminium alloys and silicon by means of boron nitride particles, In: International Journal of Material Research (IJMR). Online verfügbar unter http://www.ijmr.de/web/o_archiv.asp?ps=MK110866&task=03&o_id=25112811648-50.
-
(2012): Modeling the relationship between hardness and spray cooling parameters for pinion shafts using a neuro-fuzzy model strategy, In: Journal of Heat Treatment and Materials 67 (1), S. 39–47.
-
(2012): Repair Preparation of Fiber-Reinforced Plastics by the Machining of a Stepped Peripheral Zone, In: Journal of Mechanical Engineering 58 (10), S. 571–577.
-
(2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnaces, International Journal of Materials Research 2011/08, pp. 964-971
DOI: 10.3139/146.110549 -
(2011): Process Principle for the Production of Sintered Dynamic Component-inherent Data Storage, Production Engineering Vol. 5, Nr. 3, S. 233-240, 2011. Weitere Informationen
DOI: 10.1007/s11740-010-0290-x -
(2011): Acoustic Process Monitoring during Transient Precision Forging of High Strength Components., Metallurgical and mining industry 3 (7), S. 91–97.
-
(2011): Phenomenological modeling of anisotropy induced by evolution of the dislocation structure on the macroscopic and microscopic scale, International Journal of Material Forming, 2011.
DOI: 10.1007/s12289-010-1017-4 -
(2011): Prozessoptimiertes Presshärten mittels Sprühkühlung – prozessintegrierte Wärme-behandlung von Blechen des Werkstoffes 22MnB5, In: HTM - Journal of Heat Treatment and Materials 2011 (6), S. 316–322. Online verfügbar unter http://www.htm-journal.de/HT110118
-
(2011): Comparative analysis of supra- and subgingival biofilm formation on polytetrafluorethylene and titanium surfaces of implant abutments., Int J. Prosthodontics (24), S. 373–375.
-
(2011): Mikrostrukturelle Pressschweißnahtcharakterisierung im strangpressten Zustand für Al-Mg-Si-Legierungen: Microstructural weld seam characterisation in the as extruded condition for Al-Mg-Si-alloys, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 531-541, 2011.
-
(2011): Das Institut für Werkstoffkunde der Leibniz Universität Hannover stellt seinen Bereich FORTIS vor, Thermal Spray Bulletin, Nr. 4/11, S. 14-19, 2011.
-
(2011): Präparations- und Analysestrategie zur Untersuchung verformungsinduzierter Poren in kaltverfomtem Stahl, Praktische Metallographie Vol. 48, Nr. 5, S. 232-238, 2011.
-
(2011): Correlation of temperature-speed extrusion parameters; tool design and quality of profiles of magnesium alloys, Metallurgical and mining industry 3, 2011 (7), 23-31
-
(2011): Mit Spraykühlung Ressourcen schonen , Phi – Produktionstechnik Hannover informiert 2/2011, S. 12-13
-
(2011): Economic surface hardening by spray cooling, HTM - Journal of Heat Treatment and Materials 66 (5), S. 290–296.
-
(2011): Modification of the mechanical anisotropy in extrudet AZ31 sheets, Key Engineering Materials Vol. 473, S. 490-497, 2011.
-
(2011): Twin-roll casting of high-strength age-hardened aluminium alloys., Metallurgical and mining industry 7 (3), S. 7–16.
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell, Biomaterialien; 12; 1-4; S. 51
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell., Biomaterialien 12 (1-4), S. 51.
-
(2011): Structure and properties of beaded welds created under water by power wire, Obrabotka Metallov 50 (1), S. 31–37
-
(2011): Investigation of the influence of low cycle bending on the properties of thin sheets, International Aluminium Journal Vol. 87, Nr. 7-8, S. 60-62, 2011.
-
(2011): Investigation of the influence of low cycle alternating bending loads on the properties of thin sheets possessing different crystal lattice structures, Metallurgical and mining industry 3 (7), S. 69–73
-
(2011): Einsatz innovativer Fügetechnologien und korrosionsschutzgerechter Designs an 200-l-Gebinden zur sicheren Lagerung schwach- und mittelradioaktiver Abfälle, atw-International Journal for Nuclear Power 56 (10), S. 553–558
-
(2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structures, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
-
(2011): Novel Repair Concept for Composite Materials by Repetitive Geometrical Interlock Elements, Materials 2011, 4; pp. 2219-2230.
-
(2011): Magnetic Magnesium Alloys based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 13, S. 1-7
DOI: 10.1002/adem.201100197 -
(2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die Druckindustrie, In: Thermal Spray Bulletin 4 (2), S. 114–120.
-
(2011): Comparative analysis of long-term biofilm formation on metal and ceramic brackets , Angle Orthodontist, 81-5, S. 907-914
-
(2011): Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2, Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
-
(2011): The multi-scale physical and numerical modeling of fracture phenomena in the MgCa0.8 alloy, Computers & Structures 89, S. 1038–1049
-
(2011): The development with help of boundary element method, calibration and verifica-tion of the model of fracture of special magnesium alloys in microscale, In: Rudy i metale niezelazne 56 (11), S. 581–587
-
(2011): Schneiden und Schweißen von Kupfer mit dem Elektronenstrahl, Metall - Internationalle Fachzeitschrift für Metallurgie 65 (11), S. 507–511
-
(2011): Microstructural Behaviour of Tempering Steels during Precision Forging and Quenching from Hot-forming Temperatures, Metallurgical and Mining Industry, 2011, Vol. 3, No. 7, S. 79-86
-
(2011): Process Design for the Manufacturing of Magnetic Pulse Welded Joints, Key Engineering Materials Vol. 473, S. 243-250, 2011.
DOI: 10.4028/www.scientific.net/KEM.473.243 -
(2011): Orts- und temperaturabhängige Wärmeübergangskoeffizienten bei der Sprühkühlung von AlSi10Mg-Gussplatten, Forschung im Ingenieurwesen Vol. 75, Nr. 1, S. 25-34, 2011.
DOI: 10.1007/s10010-011-0131x -
(2011): Induction hardening of spur gearwheels made from 42CrMo4 hardening and tempering steel by employing spray cooling, Steel Research International Vol. 82, Nr. 4, S. 329-336, 2011.
DOI: 10.1002/srin.201000218 -
(2011): Sheet-bulk Metal Forming a New Process for the Production of Sheet Metal Parts with Functional Components, In: Metallurgical and mining industry 3 (7), S. 53–58.
-
(2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und Schneidwerkzeugen, Info-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
-
(2011): Ex vivo examination of the biocompatibility of biodegradable magnesium via microdialysis in the isolated perfused bovine udder model, Int. J. Artif. Organs Vol. 34, Nr. 1, S. 34-43, 2011.
-
(2011): Front Cover Advanced Materials 12/2011, Advanced Engineering Materials; Vol. 13; Iss. 12; http://onlinelibrary.wiley.com/doi/10.1002/adem.201190032/abstract; doi: 10.1002/adem.201190032
-
(2011): The Effect of Different Sterilization Methods on the Mechanical Strength of Magnesium Based Implant Materials, Advanced Engineering Materials.
DOI: 10.1002/adem.201100074 -
(2011): Comparison of the Corrosion Behavior of Coated and Uncoated Magnesium Alloys in an In Vitro Corrosion Environment, Advanced Engineering Materials
DOI: 10.1002/adem.201080144 -
(2011): Designentwicklung für einen resorbierbaren Magnesiumstent für die Nasennebenhöhlen, Biomaterialien 12 (1-4), S. 183
-
(2011): The manufacture of resorbable suture material from magnesium - drawning and stranding of thin wires, Advanced Engineering Materials 13, 2011, S. 1087-1095
DOI: 10.1002/adem.201100152 -
(2011): An Experimental and Numerical Assessment of Sheet-Bulk Formability of Mild Steel DC04, Journal of Manufacturing Science and Engineering 133 (6). Online verfügbar unter http://link.aip.org/link/?MAE/133/061008 Weitere Informationen
-
(2011): Influence of reactive process gases on zinc solders on aluminium and steel, Welding and Cutting 10 (5), S. 314–317
-
(2011): In Vivo Degradation Behavoir of the Magnesium Alloy LAN442 in Rabbit Tibiae, Materials, 4; 12; P. 2197
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, Uni Magazin (01|02 2011), S. 48–51
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, AlumniCampus (6), S. 32–35
-
(2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloy, Journal of Materials Science, Doi: 10.1007/s10853-011-5785-0
-
(2010): Friction and Temperature Development in the Hot Roll Cladding Process, Steel Research International Vol. 81, Nr. 1, S. 48-54, 2010.
-
(2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnaces, Key Engineering Materials, Nr. 438, S. 73-80, 2010.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn, Schweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
-
(2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfaces, Key Engineering Materials, Nr. 438, S. 123-129, 2010.
-
(2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus Leichtmetalllegierungen, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
-
(2010): Computation of isothermal transformation diagrams of 42CrMo4 steel from dilatometer measurements with continuous cooling., International Heat Treatment and Surface Engineering Vol. 4, Nr. 4, S. 171-175, 2010.
-
(2010): In vitro und in vivo Modelle zur molekularen Evaluierung der zellulären Reaktionen auf Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 19-21. Berlin: Walter de Gruyter, 2010.
-
(2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-Schneidstempelinlays, UTF science, Nr. III, S. 1-12, 2010.
-
(2010): Influence of hydrothermal and mechanical conditions on the strength of zirconia, Acta Biomaterialia Vol. 2010, Nr. 6, S. 4547-4552, 2010.
-
(2010): Anisotropy of Mechanical Properties of Magnesium Alloy AZ31 Sheets as a Result of Sign-Variable Bending Deformation, Metallurgical and Mining Industry. Vol. 2, Nr. 3, S. 215-219, 2010.
-
(2010): Vlijanie deformacii znakoperemennym izgibom na teksturu i anizotropiju uprugich svojstv listov nizkouglerodistoj stali, Materialovedenie Vol. 163, Nr. 10, S. 33-38, 2010.
-
(2010): Vlijanie cholodnoj pravki na teksturu i anizotropiju svojstv listov magnievogo splava AZ31, Deformacija i razruvenie, Nr. 8, S. 34-41, 2010.
-
(2010): Extrusion and Air-Water Cooling of AlSi1MgMn Alloy Extruded Profiles, Metallurgical and mining industry 2, 2010 (5), 355-362
-
(2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Galvanotechnik, Nr. 11, S. 2646-2650, 2010.
-
(2010): Reduction of biofilm on orthodontic brackets by use of a polytetrafluorethylene (PTFE) coating, European Journal of Orthodontics, Nr. 32, S. 414-418, 2010.
-
(2010): Setting of Gradient Material Properties and Quality Control of High Tension 3D NVEB-Weld Joints, Advanced Materials Research, Nr. 137, S. 375-411, 2010.
-
(2010): Development and biocompatibility of a novel corrodible fluoride-coated magnesium-calcium alloy with improved degradation kinetics and adequate mechanical properties for cardiovascular applications., Journal of Biomedical Materials Research Part A 93A (2), S. 763–775.
-
(2010): Suspension Plasma Spraying of triboactive coatings for high temperature applications, Key Engineering Materials, Nr. 438, S. 139-146, 2010.
-
(2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying process, Materialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
-
(2010): Mittendrin statt nur dabei: Die Werkstoffkunde, elementare Säule der Ingenieurwissenschaften, Phi Vol. 11, Nr. 2, S. 8-9, 2010.
-
(2010): The Possible Mechanism of Slip Band Formation, Sistemnye Technologii Vol. 70, Nr. 5, S. 162-166, 2010.
-
(2010): Untersuchung der mikrostrukturellen Werkstoffcharakteristik des Stahls DC06 bei der plastischen Umformung: Analysis on the micro structural material characteristic of the DC06 steel by the plastic deformation, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 10, S. 844-852, 2010.
-
(2010): Zerstörungsfreie Messmethoden zur Bestimmung des Warmauslagerungszustandes von Aluminiumlegierungen am Beispiel der Legierung EN AW-6082, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 8, S. 646-651, 2010.
-
(2010): Experimental twin-roll casting equipment for production of thin strips, Metallurgical and Mining Industry. Vol. 2, Nr. 5, S. 348-354, 2010.
-
(2010): Non-destructive, high-resolution 3D visualization of a cardiac defect in the chick embryo resembling complex heart defect in humans using Micro-Computed Tomography. Double outlet right ventricle (DORV) with left juxtaposition of atrial appendages (LJAA)., Circulation Vol. 122, Nr. 22, S. 561-564, 2010. Weitere Informationen
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, In: Key Engineering Materials 438, S. 147–154.
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, Key Engineering Materials Vol. 2010, Nr. 438, S. 147-154, 2010.
-
(2010): Einfluss einer alternierenden Biegebeanspruchung auf die mechanischen Eigenschaften der Magnesiumlegierung AZ31, Aluminium, Nr. 5, S. 55-58, 2010.
-
(2010): Comparison of the In Vivo Degradation Progress of Solid Magnesium Alloy Cylinders and Screw-Shaped Magnesium Alloy Cylinders in a Rabbit Model, Materials Science Forum, Nr. 638-642, S. 742-747, 2010.
-
(2010): The effect of two point mutations in GDF-5 on ectopic bone formation in a γ-tricalciumphosphate scaffold, Biomaterials Vol. 31, Nr. 14, S. 3878-3884, 2010.
-
(2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels Tomographie, Thermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
-
(2010): Kontrolliertes Bainitisieren trumpft in puncto Wirtschaftlichkeit auf, Maschinenmarkt, Nr. 24, S. 58-61, 2010.
-
(2010): Wirtschaftlich Bainitisieren mit neuem Wirbelstrom-Messsystem, Gaswärme International Vol. 59, Nr. 6, S. 472, 2010.
-
(2010): Degradation behaviour and mechanical properties of magnesium implants in rabbit tibiae., Journal of Materials Science (45), S. 624–632.
-
(2010): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach einer induktiven Hochgeschwindigkeitsaustenitisierung mit anschließendem Abschrecken, Journal of Heat Treatment and Materials Vol. 65, Nr. 2, S. 96-101, 2010.
-
(2010): Multi scale physical and numerical modelling of MgCa0,8 alloy tensile test in micro tensile/compression stage for a SEM, Computer Methods in Materials Science Vol. 10, Nr. 2, S. 61-68, 2010.
-
(2010): A model of ductility phenomena of MgCa0,8 alloy in cold forming process, Rudy i metale niezelazne Vol. 55, Nr. 4, S. 200-208, 2010.
-
(2010): Microstructure transformations in tempering steels during continuous cooling from hot forging temperatures, Steel Research Vol. 81, Nr. 3, S. 224-233, 2010.
-
(2010): Investigations into manufacturing composite profiles having local magnesium-foam reinforcements, Advanced Materials Research, Nr. 137, S. 129-160, 2010.
-
(2010): Simulation of gas and spray quenching during extrusion of aluminium alloys, Key Engineering Materials., Nr. 424, S. 57-64, 2010.
-
(2010): Der Forschungsverbund "Geothermie und Hochleistungsbohrtechnik", Geothermische Energie - Mitteilungsblatt des GtV-Bundesverbandes Geothermie e.V. Vol. 19, Nr. 68, S. 21-23, 2010.
-
(2010): Phase diagram of PMMA/PVDF-blends and effect of mixture-intensity on crystallization behavior, Polym. Mater. Sci. Eng, Nr. 239, S. 5951-5952, 2010.
-
(2010): Primäre porcine Nasenepithelzellen als Modell zur Untersuchung der Biokompatibilität von Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 79-81. Berlin: Walter de Gruyter, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, AlumniCampus, Nr. 4, S. 44-46, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, Unimagazin, Nr. 1, S. 48-50, 2010.
-
(2010): The Manufacture of Resorbable Suture Material from Magnesium, Advanced Engineering Materials Vol. 12, Nr. 11, S. 1099-1105, 2010.
-
(2010): Comparison of the Cross Sectional Area, the Loss in Volume and the Mechanical Properties of LAE442 and MgCa0.8 as Resorbable Magnesium Alloy Implants after 12 Months Implantation Duration, Materials Science Forum, Nr. 638-642, S. 675-680, 2010.
-
(2010): Development and application of magnetic magnesium for data storage in gentelligent products, Journal of Magnetism and Magnetic Materials Vol. 322, Nr. 9-12, S. 1134-1136, 2010.
-
(2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen Diamanten, Schweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
-
(2010): Izmenenie mechaniceskich svojstv lista iz splava AZ31 v rezul'tate rolikovoj pravki, Rolling, Nr. 1, S. 3-6, 2010.
-
(2009): Crystallization of supercooled silicon droplets initiated through small silicon nitride particles, Journal of Crystal Growth Vol. 311, Nr. 5, S. 1250-1255, 2009.
-
(2009): Nonvacuum electron beam welding of structural steels, The Paton Welding Journal, Vol. 2009, Nr. 5, pages 22-26.
-
(2009): Entfestigung von Blechen aus der Mg-Legierung AZ31 beim alternierenden Biegen, Deformation & Fracture of Materials, Nr. 5, 2009.
-
(2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im Schutzgasdurchlaufofen, INFO-SERVICE, Nr. 20, S. 16-19, 2009.
-
(2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im Schutzgasofen, INFO-SERVICE, Nr. 20, S. 6-11, 2009.
-
(2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle, Schweißen und Schneiden, Nr. 7, S. 358-368, 2009.
-
(2009): Gießformen mit Kapillareffekt, Gießerei-Erfahrungsaustausch, Nr. 3, S. 22-23. Düsseldorf: Gießerei-Verlag GmbH, 2009.
-
(2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und Korrosionsschutz, Thermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
-
(2009): Manufacturing of Reinforced High Precision Forging Dies, Steel Research International, Nr. 12, S. 878-886, 2009.
-
(2009): New Developments in Non-destructive Testing for Quality Assurance in Component Manufacturing, Steel research int Vol. 80, Nr. 12, S. 916-928, 2009.
-
(2009): Kleine Poren - große Wirkung: Magnesiumschwämme als bioresorbierbare Implantate, Orthopädie im Profil, Nr. 1, S. 14-15, 2009.
-
(2009): Analysis of supra- and subgingival long-term biofilm formation on orthodontic bands, European Journal of Orthodontics, Nr. 31, S. 202-206, 2009.
-
(2009): Surface Hardening Spline Geometries of Heat-Treatable Steel Cf53 using Water-Air Spray Cooling, Materials Working by Pressure - Collection of science papers Vol. 20, Nr. 1, S. 270-275, 2009.
-
(2009): Experimental research of pressing strips made of Mg-Al-Zn-Mn system alloy through precombustion chamber matrixes, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 255, Nr. 3, S. 88-91, 2009.
-
(2009): Das Zwei-in-einem-Prinzip. Integrierte Wärmebehandlung präzisionsgeschmiedeter Bauteile, Technologie-Informationen, Innovation Niedersachsen, Nr. 2, S. 10, 2009.
-
(2009): Manufacturing Surface Hardened Components of 42CrMo4 by Water-Air Spray Cooling, Steel Research International Vol. 80, Nr. 12, S. 906-915, 2009.
-
(2009): Verbundstrangpressen von Titan-Aluminium-Verbindungen, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 12, S. 901-906, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Magnesium-based Resorbable Implants on the Degradation Behaviour in Rabbits, Advanced Engineering Materials Vol. 11, Nr. 5, S. B47-B54, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Resorbable Magnesium Alloy Implants on Degradation: EDX-Analysis and Histology Results, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 88-93, 2009.
-
(2009): Im Fertigungsprozess lassen sich Bauteile spezifisch optimieren, Maschinenmarkt Vol. 44, S. 26-29, 2009.
-
(2009): In-situ high temperature microstructural analysis during tempering of 42CrMo4 using transmission electron microscopy, International Journal of Materials Research Vol. 2009, Nr. 7, S. 991-1000, 2009.
-
(2009): Multiscale modeling and interpretation of tensile test of magnesium alloy in microchamber for the SEM, Computer Methods in Materials Science Vol. 9, Nr. 2, S. 207-214, 2009.
-
(2009): Isothermal Microstructural Transformations of the Heat-treatable Steel 42CrMo4 during Heat-treatment following Hot-forming, Steel Research International Vol. 80, Nr. 12, S. 892-898, 2009.
-
(2009): Simulation of Integrated Heat-treatment of Precision Forged Components, Steel Research International Vol. 80, Nr. 12, S. 899-905, 2009.
-
(2009): Spray cooling of aluminium chassis frames, Sucasni problemy metalurhii Vol. 12, S. 92-99, 2009.
-
(2009): Prediction of continuous cooling diagrams for the precision forged tempering steel 50CrMo4 by means of artificial neural networks, Advances in Materials Science and Engineering, 2009.
-
(2009): Legierungsentwicklung zur Verschleißreduzierung von Schmiedegesenken -Einfluss von Mangan auf die Absenkung der Ac1b-Temperatur, HTM - Journal of Heat Treatment and Materials Vol. 64, Nr. 5, S. 291-296, 2009.
-
(2009): Eddy current technology - a new procedure for the detection of zero-gap grooves during laser welding, Welding and Cutting Vol. 8, Nr. 6, S. 359-364, 2009.
-
(2009): Experimentelle Untersuchungen der Mikrostrukturentwicklung und mechanischen Eigenschaften von Metallen mittels Zug/Druck/Biegemodul im Rasterelektronen-mikroskop, In: Praktische Metallographie 41 (Sonderband zur 43. Metallographie-Tagung), S. 139–144.
-
(2009): In Vitro Testing of Biodegradable Implants, Journal of Veterinary Pharmacology and Therapeutics Vol. 32, Nr. s1, S. 264-265, 2009.
-
(2009): In-Vitro Biocompatibility Testing of Degradable Magnesium-Based Alloys on Murine Fibroblasts L929, Naunyn-Schmiedeberg's Archives of Pharmacology Vol. 379, Nr. Suppl.1, S. 70, 2009.
-
(2009): Structure investigation of austenitic steel after cold rolling deformation, Sucasni problemy metalurhii Vol. 12, S. 107-113, 2009.
-
(2009): Wirbelstromtechnik - ein neues Verfahren zur Detektion von Nullspaltfugen bei Laserstrahlschweißen, Schweissen und Schneiden Vol. 61, Nr. 9, S. 520-527, 2009.
-
(2009): Scale-dependent hierarchy of structural elements in the microstructure of thermomechanical treated ferritic steels with residual austenite, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 9, S. 704-712, 2009.
-
(2009): Comparison of the resorbable magnesium alloys LAE442 und MgCa0.8 concerning their mechanical properties, their progress of degradation and the bone-implant-contact after 12 months implantation duration in a rabbit model, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 82-87, 2009.
-
(2009): Influence of a magnesium-fluoride coating of magnesium-based implants (MgCa0.8) on degradation in a rabbit model, Journal of Biomedical Materials Research, 2009.
-
(2009): Nanopartikel als Kornfeiner: Jahresbericht Produktionstechnisches Zentrum Hannover 2008, , S. 74, 2009.
-
(2009): Thermographic analysis of AlSi12 during crystallization as a function of cooling rate, International Journal of Materials Research Vol. 100, Nr. 1, S. 97-103, 2009.
-
(2009): Effect of alternating bending on the structure and properties of strips from AZ31 magnesium alloy, Metallovendenie Vol. 646, Nr. 4, S. 20-25, 2009.
-
(2008): Hybrides Walzen am Beispiel von Titan-Aluminium-Verbunden, Materialwissenschaft und Werkstofftechnik Vol. 39, Nr. 9, S. 588-593, 2008.
-
(2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Schweißen und Schneiden, Nr. 4, S. 192-199, 2008.
-
(2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
-
(2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten Pulvern, Schweißen und Schneiden, Nr. 11, S. 625-631, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
-
(2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal spraying, Thermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
-
(2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von Aluminiumwerkstoffen, Materialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
-
(2008): Verfahren zur Einbringung und Wiedergabe von Daten in Sinterbauteilen, Metall - Internationalle Fachzeitschrift für Metallurgie Vol. 62, Nr. 5, S. 298-301, 2008.
-
(2008): Investigation of Load Adapted Gears and Shafts Manufactured by Compound-Forging, Journal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
-
(2008): Analyse der Besonderheiten beim Strangpressen von bimetallischen Aluminium-Magnesium-Verbunden, Theorie und Praxis der Metallurgie, Nr. 5-6, S. 46-50, 2008.
-
(2008): Efficient Modelling and Simulation of Process Chains in Sheet Metal Forming and Processing, Steel Research International Vol. 79, Nr. 10, S. 731-737, 2008.
-
(2008): Supra- and subgingival biofilm formation on implant abutments with different surface characteristics, International Journal of Oral & Maxillofacial Implants Vol. 23, Nr. 2, S. 327-334, 2008.
-
(2008): Influence of the die geometry parameters on the quality of the aluminum thick -wall extruded strips, Herald of the DSEA, Nr. 3E (14), S. 27-39, 2008.
-
(2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Schweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
-
(2008): Analyse der initialen Biofilmbildung auf oberflächenmodifizierten Healing-Abutments, Deutsche Zahnärztliche Zeitschrift Vol. 63, Nr. 9, S. 632-638, 2008.
-
(2008): Einfluss verschiedener Implantate aus Magnesiumlegierungen auf den periostalen Knochenzuwachs in der Kaninchentibia, Biomaterialien Vol. 9, Nr. 1/2, S. 66, 2008.
-
(2008): Bainite Sensor - A new tool for process and quality control of the bainite transformation, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 3, S. 174-180, 2008.
-
(2008): Resorbierbare Marknägel auf Magnesiumbasis, Schweizer Maschinenmarkt, Nr. 1/2, S. 94-99, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Spraykühlung, HMT - Journal of Heat Treatment and Materials - Zeitschrift für Werkstoffe, Wärmebehandlung, Fertigung Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Sprühkühlung., HTM, Härterei-Technische Mitteilungen Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Wärmeübergangs- und Tropfencharakteristik für eine Spraykühlung im Temperaturbereich von 900 °C bis 100 °C, Forschung im Ingenieurwesen Vol. 72, Nr. 3, S. 163-173, 2008.
-
(2008): Herstellung von offenporigen Magnesium-Keramik-Implantaten, Biomaterialien Vol. 9, Nr. 3/4, S. 110, 2008.
-
(2008): Are resorbable implants about to become a reality? , Cardiology in the Young (16), S. 107–116.
-
(2008): The Manufacture and Characterisation of Reinforced Magnesium Foams, Steel Research International Vol. 79, Nr. 3, S. 185-190, 2008.
-
(2008): High Strength 3D Non-Vacuum Electron Beam Weld Joints - Setting of Gradient Material Properties and Testing of Weld Quality, Steel research int Vol. 79, Nr. 3, 2008.
-
(2008): Nachweis von Anrissen in der Randzone von Hochleistungsbauteilen mit Wirbelstromtechnik und induktiv angeregter Thermographie, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 5, S. 284-297, 2008.
-
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, Schweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
-
(2008): Einfluss einer Magnesiumfluoridbeschichtung auf die Degradation von MgCa0,8-Implantaten in vivo, Biomaterialien Vol. 9, Nr. 3/4, S. 99, 2008.
-
(2008): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, Schweissen und Schneiden Vol. 60, Nr. 4, S. 205-210, 2008.
-
(2007): Magnesium sponges as a bioabsorbable Material: Attributes and Challenges, Zeitschrift für Metallkunde: International Journal of Materials Research Vol. 98, Nr. 7, S. 609-612, 2007.
-
(2007): Developments for the Production of Locel Foamed Hollow Sections, Advanced Engineering Materials, Nr. 22, S. 37-47, 2007.
-
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folien, Schweißen und Schneiden, Nr. 2, S. 78-83, 2007.
-
(2007): Schneid- und Dekontiminationstechnologien für den kostengünstigen Rückbau kerntechnischer Anlagen, awt Vol. 52, Nr. 4, S. 256-262, 2007.
-
(2007): The FEM simulation of a magnesium alloy wire drawing for chirurgical applications, Hutnik - Polish Journal of Metallurgy Vol. 74, Nr. 1-2, S. 8-11, 2007.
-
(2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit Kupfer, Materialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
-
(2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal Composites, The Welding Journal, Nr. 86, S. 373-378, 2007.
-
(2007): Zerstörungsfreie Bestimmung von Härtekennwerten zur Qualitätssicherung von Hochleis-tungsbauteilen in der Fertigung, HTM - Journal of Heat Treatment and Materials Vol. 62, Nr. 6, S. 265-273, 2007.
-
(2007): Wasserstrahl erstetzt die Säge, Krankenhaus Technik + Management, Ausgabe 6, Juni 2007, S.40
ISBN: ISSN 1619-4772 B 1494 -
(2007): Wasserabrasivstrahlen als medizinisches Werkzeug, Schweizer Maschinenmarkt, Ausgabe 14/15, 108. Jahrgang, Juli 2007, S. 62-63
-
(2007): Untersuchungen zur Biokompatibilität von Magnesiumlegierungen als degradable Implantatwerkstoffe, Biomaterialien Vol. 8, Nr. 3, S. 183, 2007.
-
(2007): Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron Microscope, Microscopy and Microanalysis, S. 104-105, 2007.
-
(2007): Analysis of early biofilm formation on oral implants in man, Journal of Oral Rehabilitation Vol. 34, Nr. 5, S. 377-382, 2007.
-
(2007): Einfluss unterschiedlicher Oberflächenbearbeitung von resorbierbaren Magnesiumimplantaten: Histologische Ergebnisse, Biomaterialien Vol. 8, Nr. 3, S. 213, 2007.
-
(2007): Application of Ti-6Al-4V for Tissue Engineering, Engineering of Biomaterials, Nr. 69-72, S. 18-22, 2007.
-
(2007): Zellkulturmodelle zur Evaluierung von Magnesiumlegierungen als degradierbare Implantatmaterialien, Biomaterialien Vol. 8, Nr. 3, S. 189, 2007.
-
(2007): ABRASIVE WATER SUSPENSION JET TECHNOLOGY - FUNDAMENTALS; APPLICATION AND DEVELOPMENTS, Welding in the World Vol. 51, Nr. 9/10, 2007.
-
(2007): Entwicklung der mechanischen Eigenschaften von degradablen intramedullären Implantaten auf Magnesiumbasis nach unterschiedlicher Implantationsdauer, Biomaterialien Vol. 8, Nr. 3, S. 180, 2007.
-
(2007): Mit neuen Prozessketten zu wirtschaftlicher Mikrofertigung, Mikroproduktion, Nr. 4, S. 18-22, 2007.
-
(2007): Der Einfluss von Subchondralen Magnesiumimplantaten auf das peri-implantäre Gewebe, Biomaterialien Vol. 8, Nr. 3, S. 188, 2007.
-
(2007): Setting of gradient material properties and quality control of high tension 3D-weld joints, Advanced Materials Research Vol. 22, S. 113-125, 2007.
-
(2007): Vergleich der resorbierbaren MagnesiumlegierungenLAE442 und MGCa0,8 bezüglich der Degradation und Biokompatibilität im Zeitraum von 12 Monaten, Biomaterialien Vol. 8, Nr. 3, S. 182, 2007.
-
(2006): Resorbowalne, metaliczne implanty kostne/Resorbing Metallic Bone Implants, Orthopedic Quarterly, Nr. 2, S. 105-110, 2006.
-
(2006): Magnesium Compound Structures for the Treatment of Bone Defects, Engineering of Biomaterials, Nr. 56-57, S. 58-61, 2006.
-
(2006): Design and Resorption Properties of the Metal bone Implants: Application in-vivo, Engineering of Biomaterials, Nr. 56-57, S. 54-58, 2006.
-
(2006): Particle Image Velocimetry in Thermal Spraying, Advanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.
-
(2006): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, Schweißen und Schneiden, Nr. 2, S. 84-90, 2006.
-
(2006): Simulation des Abschreckhärtens mittels Spraykühlung~- Wärmeübergang, Gefüge und Härte, HTM Vol. 61, Nr. 3, S. 142-147, 2006.
-
(2006): Bestimmung der Streckgrenze und der Hall-Petch-Konstanten des Vergütungsstahles 42CrMo4 unterschiedlichen Gefügezustandes mittels Eindruckprüfungen, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 8, S. 668-673, 2006.
-
(2006): Heat Generation During Abrasive Water-Jet Osteotomies Measured by Thermocouples, Journal of Mechanical Engineering, Vol. 52, No. 7-8, July/Aug.2006, S. 451-457
ISBN: ISSN 0039-2480 -
(2006): New resorbable metal and polymer implants for bone surgery, Materialy i Technologie, Nr. 4, S. 57-62, 2006.
-
(2006): The influence of direct extrusion process parameters on the temperature of profile of aluminium alloy, Metallurgiceskaja i gornorudnaja promyvlennost', Nr. 6, S. 39-42, 2006.
-
(2006): Einfluss der Oberflächenbearbeitung von resorbierbaren Implantaten wus verschiedenen Magnesium-Calciumlegierungen auf die Degradation: Erste Ergebnisse einer Pilotstudie am Kaninchenmodell, Deutsche tierärztliche Wochenschrift Vol. 113, Nr. 10, S. 439-446, 2006.
-
(2006): The Influence of the Surface Machining of Resorbable Implants made of Magnesium Alloys on Degradation in rabbits, Biomaterialien Vol. 7, Nr. 1, S. 122, 2006.
-
(2006): Messung der Spraycharakteristik zur Bestimmung des Wärmeübergangskoeffizienten bei der Spraykühlung, Forschung im Ingenieurwesen, Springer Verlag Vol. 70, Nr. 4, S. 237-242, 2006.
-
(2006): Annealing of the edge-layer of precision forged gears of 42CrMo4 by a two-phase spray cooling, Vestnik NTUU KPI, Nr. 48, S. 33-36, 2006.
-
(2006): Contact-Arc-Metal-Cutting (CAMC) - Eine junge Schneidtechnologie ist den Kinderschuhen entwachsten, awt Vol. 51, Nr. 3, S. 170-172, 2006.
-
(2006): Changes of the surfaces of different magnesium alloys as degradable implants during degradation in rabbit tibiae, Biomaterialien Vol. 7, Nr. 1, S. 92, 2006.
-
(2006): Simulation of the γ-grain size evolution during precision forging of helical gears made of tempering steel 42CrMo4, Vestnik NTUU KPI, Nr. 48, S. 36-41, 2006.
-
(2006): Cartilage repair on magnesium implants as scaffolds used as subchondral bone replacement, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 6, S. 504-508, 2006.
-
(2005): Macroscopic damage by the formation of shear bands during the rolling and deep drawing of magnesium sheets, JOM Journal of the Minerals, Metals and Materials Society 57 (5), S. 57–61.
-
(2005): Joining of Steel-Aluminium Hybrid Structures with Electron Beam on Atmosphere, Advanced Materials Research 6-8, 2005, 143-150
DOI: 10.4028/www.scientific.net/AMR.6-8.143 -
(2005): Elektrochemisch induzierte Abscheidung von Calciumphosphat auf der Oberfläche von kompakten und zellularen Strukturen aus Magnesiumlegierungen, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6)
-
(2005): Resorbierbare Implantate aus Magnesium durch Mikrolegieren mit Calcium, deren Verarbeitung und Eigenschaften, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Calculation of the flow field during contact arc metal cutting under water, Welding and Cutting Vol. 4, Nr. 4, 2005.
-
(2005): Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter Beschichtungen, Materialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.
-
(2005): Ultraschallassistiertes Flammlöten von Aluminiumlegierungen, Schweißen und Schneiden, Nr. 9, S. 482-487, 2005.
-
(2005): Simulation of the microstructure transformation in quenched gears after precision forging of the tempering steel 42CrMo4, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 232, Nr. 4, S. 48-51, 2005.
-
(2005): Außen hart und Innen weich - Randschichtvergüten durch Zweiphasenspray, phi - Produktionstechnik Hannover informiert Vol. 6, Nr. 4, S. 10-11, 2005.
-
(2005): Statistische Beschreibung der Tropfengrößenverteilung bei stationären Zerstäubungsprozessen., Forschung im Ingenieurwesen Vol. 69, Nr. 3, S. 181-186, 2005.
-
(2005): Lasergepulster Reinwasserstrahl zur Erhöhung der Abtragsleistung, Laser Magazin, Ausgabe 5, Okt. 2005, S. 9-12
-
(2005): Selten Erden-haltige Magnesiumlegierungen als degradable, intramedulläre Implantate in Kanninchentibae, Biomaterialien Vol. 6, Nr. 3, S. 190, 2005.
-
(2005): Evaluation verfahrensspezifischer Risikopotentiale der Wasserabrasivstrahl-Osteotomie in-vivo, Biomedizinische Technik, Band 50, Heft 10, Okt. 2005, S. 337-342
ISBN: ISSN 0013-5585 -
(2005): Ionen-Leakage aus Implantaten führt zu Materialversagen und Inflammation des peri-Implantat Gewebes, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Korrosion kardiovaskulärer Implantate auf Wolframbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2004): Non-Vacuum-Electron-Beam-Welding - A BEAM PROCESS FOR WELDING ZINC COATED HIGH-STRENGTH STEELS AND STEEL-ALUMINIUM HYBRID STRUCTURES, Laser Assisted Net Shape Engineering Vol. 4, 2004.
-
(2004): Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work step, Welding and Cutting, Nr. 2, 2004.
-
(2004): Brechnung des Strömungsfelds beim Kontakt-Lichtbogen-Metallschneiden unter Wasser, Welding and Cutting Vol. 56, Nr. 11, S. 586-592, 2004.
-
(2004): Precision brazing processes for MEMS technology, Welding and Cutting, Nr. 6, S. 340-342, 2004.
-
(2004): Particle Image Velocimetry in Thermal Spraying, Materials Science and Engineering A, S. 146-152., 2004.
-
(2004): Mathematical model for the decision of temperature task at production of types from magnesium alloys, Metallurgiceskaja i gornorudnaja promyvlennost', Nr. 5, S. 37-40, 2004.
-
(2004): Schutzschichten für Lötmaschinen zum bleifreien Löten, Schweißen und Schneiden, Nr. 5, S. 244-248, 2004.
-
(2003): Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem Arbeitsschritt, Schweißen und Schneiden, Nr. 10, S. 560-565, 2003.
-
(2003): Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide Matrix, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.
-
(2003): Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, in, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Jahrbuch Schweißtechnik 2003, S. 138-143, 2003.
-
(2003): Präzisionslötverfahren für die MEMS-Technik, Schweißen und Schneiden, Nr. 12, S. 672-674, 2003.
-
(2003): Hartlöten dünner Bauteile aus Titanlegierungen mit partieller Erwärmung, Schweißen und Schneiden, Nr. 8, S. 432-435, 2003.
-
(2003): Partial-heating brazing of thin components made of titanium alloys, Welding and Cutting, Nr. 6, S. 340-342, 2003.
-
(2003): Influence of lithium on hcp magnesium alloys, Trans Tech Publ Materials Science Forum (419-422), S. 1037–1042.
-
(2003): Non vacuum electron beam welding of light sheet metals and steel sheets, Welding in the World 47, 2003 (3-4), 4-10
-
(2003): Oberflächentechnik für moderne Lötanlagen für bleifreie Lote, Der Praktiker, Nr. 4, S. 116ff., 2003.
-
(2002): Magnesiumkorrosion - Prozesse, Schutz von Anode und Kathode, Magnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.
-
(2001): Entwicklung einer neuen Metallgießtechnik für die Mikromechanik, Zeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.
-
(2001): Keramik-HM-Bohrer für kleine Durchmesser, Werkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.
-
(2000): Gießtechnisches Herstellverfahren für Magnesiumschäume, Materialwissenschaft und Werkstofftechnik Vol. 31, Nr. 6, S. 419-421, 2000.
-
(1999): Löten - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.
-
(1999): Gelötete Metall-Keramik-Verbunde, Metallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.
-
(1999): Dünnschichttechnologie - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.
-
(1999): Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von Modellsystemen, Metallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.
Bücher
-
(2019): Das ENCON-Behälterkonzept – Generische Behältermodelle zur Einlagerung radioaktiver Reststoffe für den interdisziplinären Optionenvergleich, Hannover, ENTRIA-Arbeitsbericht-16
ISSN: 2367-3532 -
(2019): Handbuch Hochtemperatur-Werkstofftechnik. Grundlagen, Werkstoffbeanspruchungen, Hochtemperaturlegierungen und -beschichtungen, 6. Auflage, Springer Vieweg, Wiesbaden, 2019
ISBN: 978-3-658-25313-4 -
(2012): Forschung für die Praxis P 714. Qualifizierung des Nonvakuum-Elektronenstrahlschweißens zum Fügen höherfester Stahlfeinbleche im Automobilbau, Düsseldorf: Verlag und Vertriebsgesellschaft mbH
ISBN: 978-3-942541-20-6 -
(2010): "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme". Vortragsband zum Kolloquium des Graduiertenkolleg 1378/1., LWT, TU Dortmund. Unter Mitarbeit von W. Tillmann, T. Plorin und B. Rüther. Garbsen: PZH Produktionstechnisches Zentrum. Online verfügbar unter http://www.gbv.de/dms/tib-ub-hannover/626868181.pdf. Weitere Informationen
Beiträge in Büchern
-
(2021): Fatigue Behavior of Sheet-Bulk Metal Formed Components, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 412-433
DOI: 10.1007/978-3-030-61902-2_18 -
(2021): Analysis of Path-Dependent Damage and Microstructure Evolution for Numerical Analysis of Sheet-Bulk Metal Forming Processes, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 378-411
DOI: 10.1007/978-3-030-61902-2_17 -
(2021): Numerical Development of a Tooling System for the Co-extrusion of Asymmetric Compound Profiles on a Laboratory Scale, In: Behrens, B.-A. et al. (Hrsg.): Production at the leading edge of technology. WGP2020, Dresden, 23.09.-24.09.2020. Springer, Berlin, 2021, S. 66-75
DOI: 10.1007/978-3-662-62138-7_7 -
(2021): Fatigue Life Compliant Process Design for the Manufacturing of Cold Die Rolled Components, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 568-585
DOI: 10.1007/978-3-030-61902-2_26 -
(2020): Manufacturing and Virtual Design to Tailor the Properties of Boron-Alloyed Steel Tubes, In: Wriggers, P.; Allix, O.; Weissenfels, C. (Hrsg.): Virtual Design and Validation. Lecture Notes in Applied and Computational Mechanics 93. Springer, Cham, 2020, S. 21-44
-
(2018): Fluiddurchströmbare, transpirierende thermisch gespritzte Schichten, In: Clausthaler Zentrum für Materialtechnik, C. Z. f. (Hrsg.): Berichtsband Clausthaler Zentrum für Materialtechnik. Shaker, Herzogenrath, 2018, S. 137-147
-
(2017): Storing the load history of a component in the subsurface region, In: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 67-84
ISBN: 978-0-12-811939-6 -
(2017): Data storage within the subsurface of a component by local heat treatment, In: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 85-99
-
(2017): Cardiovascular Applications of Magnesium Alloys, In: Aliofkhazraei, M. (Hrsg.): Magnesium Alloys. InTech, Rijeka, Croatia, 2017, S. 191-217
DOI: 10.5772/66182 -
(2016): Verfahren und Methoden zur Transplantation thermisch gespritzter Schichten für Druckgussteile, In: Biermann, D. (Hrsg.): Spanende Fertigung. Prozesse, Innovationen, Werkstoffe. Vulkan, Essen, 2016, S. 88-93
ISBN: 978-3-8027-2989-8 -
(2015): Development of Magnesium Alloy Scaffolds to Support Biological Myocardial Grafts: A Finite Element Investigation, Lenarz, T.; Wriggers, P. (Hg.): Biomedical Technology, Publishing Lecture Notes in Applied and Computational Mechanics 74, Springer International Publishing, Switzerland, S. 81-100
DOI: 10.1007/978-3-319-10981-7_6
ISBN: 978-3-319-10980-0 -
(2014): Microstructured thermally sprayed surfaces, B. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92
-
(2014): Mess- und Prüftechnik, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 311-430
-
(2014): High Frequency Eddy-Current and Induction Thermography Inspection Techniques, In: Capova, K. (Hrsg.): Electromagnetic nondestructive evaluation (XVII), ISBN 978-1-61499-407-7, S. 226-233
DOI: 10.3233/978-1-61499-407-7-226
ISBN: 978-1-61499-407-7 -
(2014): Werkzeugtechnologie, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 53-125
ISBN: 978-3-642-34663-7 -
(2014): Hot Stamping and subsequent spray cooling: A new manufacturing approach, Prof. O. N. Golovko, Plastic Deformation of Metals, 2014, Akzent PP, Dnipropetrovsk, S. 36-55
ISBN: 978-617-7109-18-0 -
(2014): Wärmebehandlung, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 127–220
-
(2012): Rare Earth Metals as Alloying Components in Magnesium Implants for Orthopaedic Applications, In: W.A Monteiro (Hg.): New Features on Magnesium Alloys: InTech, S. Chapter 4.
-
(2012): Thermal Spraying of Oxide Ceramic and Ceramic Metallic Coatings, In: F. Shi (Hg.): Ceramic Coatings - Applications in Engineering. Rijeka (Kroatien): InTech - Open Access Publisher.
-
(2011): ZrO2-Keramiken mit oberflächennahen Diffusionsschichten zur Anwendung in der dentalen Prothetik, E. Steinhauser und H.-F. Zeilhofer (Hg.): Biomaterialien (1-4, 12), S. 132.
-
(2010): Entwicklung und Herstellung von selbstschützenden Doppelmantel-Fülldrahtelektroden zum kontinuierlichen Unterwasserschweißen, DVS (Hg.): DVS - Jahrbuch Schweißtechnik 2011: DVS-Verl., Verl. für Schweißen und Verwandte Verfahren, S. 183–191.
-
(2010): Stabilisierende Magnesiumstrukturen zur Unterstützung von kardiovaskulärem Gewebeersatz im Hochdrucksystem, Zukunftsfähige bioresorbierbare und permanente Implantate aus metallischen und keramischen Werkstoffen, Sonderforschungsbereich SFB 599, Druckerei der Medizinischen Hochschule Hannover, November 2010
ISBN: 978-3-00-032924-1 -
(2005): Herstellung und Deformationsanalyse zur Qualifizierung einer Schutzschicht aus Magnesiumfluorid zur gesteuerten Degration von Implantatlegierungen auf Magnesiumbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Einsatz von Beschichtungsverfahren in der Löttechnik, Fr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Deutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143
-
(2000): Oberflächenbehandlung und thermochemische Stabilität von Magnesiumlegierungen, Magnesium-Taschenbuch, S. 308-311,
ISBN: ISBN-10: 3870172649
Konferenz
-
(2020): Kaltpressschweissen unter XHV-adäquater Atmosphäre beim Walzplattieren, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 151
-
(2020): Tailored Forming of Hybrid Bevel Gears with Integrated Heat Treatment, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 301-308
DOI: 10.1016/j.promfg.2020.04.234 -
(2020): Prozessintegrierte metallische Sinterbeschichtung für das Formhärten mit konduktiver Erwärmung, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 152-153
-
(2020): Development of a Modified Tool System for Lateral Angular Co-Extrusion to Improve the Quality of Hybrid Profiles, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 224–230
DOI: 10.1016/j.promfg.2020.04.200 -
(2020): Ermüdungsprüfung von blechmassivumgeformten Bauteilen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020. TEWISS, Garbsen, 2020, S. 100-104
-
(2020): Investigation of the temporal rearrangement behaviour of zirconium hydride precipitates in interim and final storage, In: GRS Forschungszentrum (Hrsg.): 4th Workshop on Safety of Extended Dry Storage of Spent Nuclear Fuel. Online-Konferenz. 202003.06.-04.06.2020
-
(2020): Testing of Formed Gear Wheels at Quasi-Static and Elevated Strain Rates, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 623-628
DOI: 10.1016/j.promfg.2020.04.191 -
(2020): Manufacturing of Large-Diameter Rolling Element Bearings by Steel-Steel Multimaterial Systems, In: J. M. Beswick (Hrsg.): Bearing Steel Technologies: 12th Volume, Progress in Bearing Steel Metallurgical Testing and Quality Assurance. 12th International Symposium on Rolling Bearing Steels. Denver, USA. 15.05.-17.05.2019. ASTM International, West Conshohocken, 2020, S. 277-299
DOI: 10.1520/STP162320190064 -
(2020): Herstellung von Großwälzlagern durch Stahl-Stahl-Werkstoffsysteme, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 143-144
-
(2020): Casting Manufacturing of Cylindrical Preforms Made of Low Alloy Steels, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 445-449
DOI: 10.1016/j.promfg.2020.04.333 -
(2020): Influence of the Material on the Measurement of Surface Roughness Using Eddy Current Technology, In: 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC). Dubrovnik, Croatia. 25.5.-28.5.2020, S. 1-6
DOI: 10.1109/I2MTC43012.2020.9128881 -
(2020): Analyse der belastungspfadabhängigen Schädigungs- und Mikrostrukturentwicklung zur numerischen Auslegung von Blechmassivumformprozessen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 185-186
-
(2020): Sonderforschungsbereich 1368 „Sauerstofffreie Produktion“: Prozesse und Wirkzonen in sauerstofffreier Atmosphäre zur Entwicklung zukunftsfähiger Produktionstechniken und Fertigungsverfahren, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 154-155
-
(2020): Wärmebehandlung für belastungsangepasste Werkstoffeigenschaften von Tailored- Forming-Komponenten, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 117-118
-
(2020): Temperaturgesteuerte Werkstoffaufmischung beim Laser-Draht- sowie Plasma-Pulver Auftragschweißen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 121
-
(2020): Temperaturgesteuerte Werkstoffaufmischung beim Laser-Draht- sowie Plasma-Pulver Auftragschweißen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 121
-
(2020): Einfluss von Silan dotierten Umgebungsatmosphären auf die tribologischen Eigenschaften von Titan, In: Gesellschaft für Tribologie (Hrsg.): 61. Tribologie-Fachtagung. 28.09.-30.09.2020, 2020, S. 12/1–12/10
-
(2020): Herstellung koaxialer Verbundprofile mittels Lateral Angular Co-Extrusion, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 115-116
-
(2020): Entwicklung und Analyse der duktilen Schädigung beim Kaltgesenkwalzen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020. TEWISS, Garbsen, 2020, 27-34
-
(2019): Characterization of a modified hot-working steel with increased wear resistance, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P63
-
(2019): Deep Cryogenic Treatment of X153CrMoV12 Cold-work Tool Steel, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P31
-
(2019): Influence of Increased Manganese Content on the Precipitation Behaviour of AISI H10 in Thermomechanical Fatigue Tests, In: WGP (Hrsg.): WGP Kongress 2019. Hamburg. 29.09.-02.10.2019, S. 189-197
-
(2019): In-vivo Vergleich der Degradation und Osseointegration von LAE442-Magnesiumschwämmen mit zwei verschiedenen Porengrößen, In: Osteologie 2019. Frankfurt am Main. 28.05.-30.05.19. Georg Thieme Verlag KG, Stuttgart, 2019, S. 60-61
DOI: 10.1055/s-0039-1680000 -
(2019): Dry sheet metal forming through selective oxidized tool surfaces, In: TMS 2019, 148th Annual Meeting. San Antonio, USA. 10.03.-14.03.2019, S. 719-731
DOI: 10.1007/978-3-030-05861-6_71 -
(2019): Numerical modeling of the development of intermetallic layers between aluminium and steel during co-extrusion, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05. – 10.05.2019, S. 40029
DOI: 10.1063/1.5112563 -
(2019): Development of an intelligent hot-working steel to increase the tool wear resistance, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P64
-
(2019): Investigation into the bond strength of the joining zone of compound forged hybrid aluminium-steel bearing bushing, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05. – 10.05.2019, S. 40028
DOI: 10.1063/1.5112562 -
(2019): Investigation of the temporal rearrangement behaviour of zirconium hydride precipitates in interim and final storage, In: GRS Forschungszentrum (Hrsg.): 3rd Workshop on Safety of Extended Dry Storage of Spent Nuclear Fuel. Garching, Germany. 04.06.-07.06.2019
-
(2019): Induktion als Wärmetechnologie beim nassen Unterwasserschweißen höherfester Stähle, In: 7. Tagung Unterwassertechnik. DVS Berichte Band 359. Hamburg. 12.11.-13.11.2019. DVS Media GmbH, Düsseldorf, 2019, S. 5-13
-
(2019): Analyse und Modellierung von Schädigung und Versagen in der Blechmassivumformung, In: Merklein, M.; Behrens, B.-A.; Tekkaya, A.E. (Hrsg.): 4. Workshop Blechmassivumformung. Hannover, 12.03.2019. FAU University Press, Erlangen, 2019, S. 33-60
DOI: 10.25593/978-3-96147-280-2 -
(2019): Influence of process atmosphere on the fatigue behavior of brazed stainless steel joints before and after corrosive attack, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 137-141
-
(2019): Integration von Wirbelstromsensoren in eine Drehmaschine als Grundlage für eine prozessbegleitende Regelung – Eine Übersicht über resultierende Störeinflüsse, In: Berichtsband zur DGZfP-Jahrestagung 2019. Friedrichshafen. 27.05.–29.05.2019, S. 58
-
(2019): Investigations on the development of process emissions during oxy-fuel flame cutting of plated thick-walled unalloyed materials, In: 72nd IIW Annual Assembly and International Conference. Bratislava, Slovakia. 07.07.-12.07.2019
-
(2019): Properties and anisotropy behaviour of a nickel base alloy material produced by robot based wire and arc additive manufactured (WAAM), In: 72nd IIW Annual Assembly and International Conference. Bratislava, Slovakia. 07.07.-12.07.2019
-
(2019): Investigation of residual stresses in high-temperature-brazed hybrid Cr-CrNi-steel joints, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 149-155
-
(2019): In situ Chromium carbide formation in carbon modified brazed NiCrP-coatings, In: Brazing, high temperature brazing and diffusion bonding. In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 228-234
-
(2019): In-vivo Vergleich der Osseointegration und des Degradationsverhaltens der Magnesium-Scaffolds La2 und LAE442, In: Osteologie 2019. Frankfurt am Main. 28.05.-30.05.19. Georg Thieme Verlag KG, Stuttgart, 2019, S. 50
DOI: 10.1055/s-0039-1679977 -
(2019): Verminderung des Risikos wasserstoffinduzierter Kaltrisse beim hyperbar nassen Schweißen durch den Einsatz austenitbildender Schweißzusätze, In: 7. Tagung Unterwassertechnik. DVS Berichte Band 359. Hamburg. 12.11.-13.11.2019. DVS Media GmbH, Düsseldorf, 2019, S. 39-44
-
(2019): Cross-wedge rolling of PTA-welded hybrid steel billets with rolling bearing steel and hard material coatings, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05.–10.05.2019, S. 40019
DOI: 10.1063/1.5112553 -
(2019): Kinetic investigations for brazing Zn-surfaced AlSi dublex braze metal coatings with NH4Cl-doped process gas, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 306-314
-
(2019): Feasibility of soft tissue preparation using high-pressure water jet technology, In: WJTA-IMCA Conference & Expo 2019. New Orleans, 2019
-
(2019): Application of Ni-based filler metal repair coating by thermal spraying for high pressure turbines – A hybrid coating, brazing and aluminizing process, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 71-76
-
(2019): Ultrasonic evaluation of tailored forming bearing components, In: 12th International Symposium on Rolling Bearing Steels – Progress in Bearing Steel Metallurgical Testing and Quality Assurance. Denver. 15.05.-17.05.2019
DOI: 10.13140/RG.2.2.28034.53443 -
(2019): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, In: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 3. Niedersächsisches Symposium Materialtechnik. Clausthal-Zellerfeld. 14.02.-15.02.2019. Shaker, Aachen, 2019, S. 483-494
-
(2019): Development an application of thermoplastic-coated particles for joining with powdered brazing alloys, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Lectures and Posters of the 12th International Conference taking place in Aachen on 21th to 23th May. Aachen. 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 215-221
-
(2019): Surface deoxidation mechanisms of stainless steels in vacuum brazing processes, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 247-251
-
(2019): Hot Forming of Cast Steel Cylinders, In: Conference Proceedings of the 28th International Conference on Metallurgy and Materials, METAL2019. Brno, Czech Rep. 22.05.-24.05., 2019
-
(2018): Advanced high pressure turbine blade repair technologies, In: 10th CIRP Conference on Photonic Technologies (LANE 2018), Procedia CIRP 74, 2018, S. 214-217
DOI: 10.1016/j.procir.2018.08.097 -
(2018): Entwicklung einer Bainit-Sensortechnik zur Charakterisierung gradierter Gefügeausbildungen in der Bauteil-Rand und Kernzone, In: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
-
(2018): Investigation of the composite strength of hybrid steel-steel semi-finished products manufactured by laser beam welding and friction welding, In: 5th International Conference Recent Trends in Structural Materials, COMAT2018. Pilsen, Czech Rep. 14.11.-16.11.2018. IOP Conf. Ser.: Mater. Sci. Eng. 461, 2018, S. 12049
DOI: 10.1088/1757-899X/461/1/012049 -
(2018): Numerical investigations on the lateral angular co-extrusion of aluminium and steel, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 30001
DOI: 10.1063/1.5034844 -
(2018): Wear investigation of selective α-Fe2O3 oxide layers generated on surfaces for dry sheet metal forming, In: 17th International Conference on Metal Forming. Toyohashi, Japan. 16.09.-19.09.2018, S. 923-930
DOI: 10.1016/j.promfg.2018.07.404 -
(2018): Micro-Scale Residual Stress Measurement Using Focused Ion Beam Techniques and Digital Image Correlation, In: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 32
-
(2018): Anwendung der Induktion für schweißtechnische Erwärmung beim nassen Lichtbogenhandschweißen unter Wasser, In: 2. Kolloquium Induktionserwärmung in der Schweißtechnischen Fertigung. Halle. 17.10.2018
-
(2018): Halbnasses Lichtbogenbolzenschweißen großer Dimensionen mit Hubzündung im Unterwasserbereich, In: DVS Berichte Band 344. DVS Congress 2018. DVS Media GmbH, Düsseldorf, S. 420-427
-
(2018): Ball end milling of titanium TIG weld material and the effect of SiC addition – process forces and shape deviations, 6th International Conference on Through-life Engineering Services, Bremen, 7.11.-8.11.2017. Procedia Manufacturing 19, 2018, 74-81
DOI: 10.1016/j.promfg.2018.01.011 -
(2018): Technology-based re-contouring of blade integrated disks after weld repair, In: Proceedings of the ASME Turbo Expo 2018. Oslo, Norway. 11.06.-15.06.2018
-
(2018): The effects of stress-induced martensite ageing on shape memory behavior in Co35Ni35Al30 single crystals, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Strategies for high entropy shape memory alloy design - from motivation to structure and properties, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Entwicklung einer Hochfrequenz-Induktionsthermografie und -Wirbelstromtechnik zur Fehlerprüfung und Charakterisierung der Schichtsysteme von Triebwerksbeschaufelung im Schaufelkanal, In: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
-
(2018): Near-Wing Multi-Sensor Diagnostics of Jet Engine Components, In: American Society of Mechanical Engineers (ASME) (Hrsg.): ASME Turbo Expo 2018: Turbomachinery Technical Conference and Exposition. Oslo, Norway. 11.06.-15.06.2018, V006T05A026
ISBN: 978-0-7918-5112-8 -
(2018): Evaluation of micro-damage by acoustic methods, In: 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan, 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 527-534
DOI: 10.1016/j.promfg.2018.07.273 -
(2018): Manufacturing of seamless tubes of the alloy Al-5Mg-0,2Sc by direct extrusion and sink drawing, In: Materials Science and Engineering, MSE 2018. European Congress and Exhibition on Advanced Materials and Processes. Darmstadt. 26-28.09.2018
-
(2018): Experimental setup to characterize flow-induced anisotropy of sheet metals, In: IOP Conf. Series: Materials Science and Engineering 418. International Deep Drawing Research Group 37th Annual Conference. Waterloo, Kanada. 03.06.-07.06.2018, S. 12085
DOI: 10.1088/1757-899X/418/1/012085 -
(2018): Beam extraction using non vacuum electron beam by reduced acceleration voltage, Journal of Physics: Conference Series 1109, 2018 Weitere Informationen
DOI: 10.1088/1742-6596/1109/1/011001 -
(2018): Chracterization of Heat Transfer in Complex Air-Water Spray Quenching Set-Ups, In: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 21
-
(2018): Phase transformations in a boron-alloyed steel at high heating rates, In: Mori, K.-I.; Abe, Y.; Maeno, T. (Hrsg.): Proceedings of the 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan. 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 1062-1070
DOI: 10.1016/j.promfg.2018.07.386 -
(2018): Influence of heat-pretreatments on the microstructural and mechanical properties of galfan-coated metal bonds, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 40007
DOI: 10.1063/1.5034861 -
(2018): Schweißen unter Wasser als Fertigungs- und Reparaturverfahren, und was der Werkstoff dazu sagt, In: 22. Kolloquium Reparaturschweißen. Halle (Saale), 2018, S. 37-42
-
(2018): Fluxless Brazing of aluminum alloys using non vacuum electron beam by 60kV acceleration voltage, Journal of Physics: Conference Series 1109, 2018 Weitere Informationen
DOI: 10.1088/1742-6596/1109/1/011001 -
(2018): Effect of the heating-cooling rate on the functional properties of Ti-Ta-Al HT-SMAs, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Simulation of bone ingrowth into bone substitutes on implant level length scale, In: 89th Annual Meeting of the International Association of Applied Mathematics and Mechanics (GAMM). München. 19.3.- 23.3.2018, Proc. Appl. Math. Mech. 18, 2018 (1), e201800297
DOI: 10.1002/pamm.201800297 -
(2018): Synchrotron radiation and transmission electron microscopy investigations on the formation and dissolution temperatures of the w -phase in Ti-Ta high temperature shape memory alloys, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Influence of ultrasonic amplitude and position in the vibration distribution on the microstructure of a laser welded aluminum alloy, In: International Congress on Applications of Lasers & Electro-Optics, ICALEO 2018. Orlando, Fl. USA. 14.10.-18.10.2018
-
(2018): Stress-induced martensite ageing in single crystals of Ni-based Heusler alloy: processing, effect of orientation and functional properties, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Entwicklung eines numerischen Simulationsmodells für das nasse Unterwasserschweißen von höherfesten Spundwandstählen, In: Schafstall, H.; Wohlmuth, M. (Hrsg.): Tagungsband 19. RoundTable Simulating Manufacturing. Marburg, 16.05. -17.05.2018. Simufact Engineering GmbH, Hamburg, S. 122-132
-
(2018): Cold pressure welding of aluminium-steel blanks: Manufacturing process and electrochemical surface preparation, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 50007
DOI: 10.1063/1.5034880 -
(2018): Selective oxidation of tool steel surfaces under a protective gas atmosphere using inductive heat treatment, In: Vollertsen, F. et al. (Hrsg.): 5th International Conference on New Forming Technology, ICNFT 2018. Bremen, 18.09.-21.09.18. MATEC Web Conf. 190, 2018, S. 14003
DOI: 10.1051/matecconf/201819014003 -
(2018): Effect of Manganese on Nitriding and Softening Behaviour of Steel AISI H10 Under Cyclic Thermal Loads, In: Schmitt, R.; Schuh, G. (Hrsg.): Advances in Production Research. WGP 2018. Aachen. 19.11.-20.11.2018, S. 423-432
DOI: 10.1007/978-3-030-03451-1_42 -
(2018): Two-way shape memory effect in [001]-oriented Ni49Fe18Ga27Co6 single crystals, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2017): Erzeugung hybrider Umformhalbzeuge durch Auftragschweißen und Evaluierung der Fügezone vor und nach dem Umformen, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 195
-
(2017): Local stress investigation of periprosthetic fractures by total hip replacement - a finite element analysis, BMTMedPhys 2017. Poster session 11: Modelling and simulation I. Dresden, 10.09. - 13.09.2017, S. 152
DOI: 10.1515/bmt-2017-5032 -
(2017): Full automatization of waterjet cutting, WJTA-IMCA Conference & Expo 2017. New Orleans. 24.-27.10.2017
-
(2017): Wear Behavior of MoS2 Lubricant Layers During Sheet Metal Forming, In: Proceedings of the 17th International Conference on Sheet Metal SHEMET17, Procedia Engineering 183, 357-362
-
(2017): Aktuelle Forschungsschwerpunkte in der Massivumformung, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017. TEWISS, Garbsen, 2017, S. 15-32
-
(2017): Clinchen für Anwendungen mit zyklisch thermischer und mechanischer Belastung, In: Gemeinsame Forschung in der Mechanischen Fügetechnik. Tagungsunterlagen des 7. Fügetechnischen Gemeinschaftskolloquiums. Dresden. 12-13 Dezember, 2017, S. 91-96
-
(2017): Fatigue Behavior of Sheet-Bulk Metal Formed Components, In: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 859–864
DOI: 10.7449/2017/MST_2017_859_864 -
(2017): Ermüdungsverhalten blechmassivumgeformter Bauteile, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 221
-
(2017): JoiningTWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologies, 7. Fügetechnisches Gemeinschaftskolloquium, EFB, FOSTA und DVS Forschung, 12.-13.12.2017
-
(2017): Modernization Of An Electric-Weld Plant For Performing Combined Roll Forming And Heat-Treatment Processes, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 28
-
(2017): Qualifizierung des Unterwasserbolzenschweißens für M16/M24, In: Unterwassertechnik. Vorträge der gleichnamigen 6. Fachtagung in Hamburg, 14.-15.11.2017. DVS-Berichte Band 338, DVS Media GmbH, Düsseldorf, 2017, S. 25-31
ISBN: 978-3-96144-012-2 -
(2017): Influence of high-current-density impulses on the plasticity of single crystal nickel-based super alloy CMSX-4, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
-
(2017): Methodical procedure for investigating the influence of electric impulses on the deformation behavior of the single crystal nickel-based alloy CMSX-4 and dynamics of grain boundaries in aluminum bicrystals, In: Bannykh, O. A. (Hrsg.): VII international conference „Deformation and destruction of materials and nanomaterials“. Moskau. 7.-10.11.2017. IMET RAN, Moskau, 2017, S. 57-58
-
(2017): Mechanical Properties and Fatigue Strength of Extruded Cobalt-Containing Magnetic Magnesium Alloys, In: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 537-542
DOI: 10.1007/978-3-319-52392-7_74 -
(2017): Biocompatible Magnesium Alloy ZNdK100 - Adaptation of Extrusion Parameters to Tailor the Mechanical Properties to Different Implant Applications, In: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 323-327
DOI: 10.1007/978-3-319-52392-7_46 -
(2017): Joining TWIP-Steel Simulation Models, In: Procedia Structural Integrity, International Conference on Structural Integrity, ICSI 2017, 04.-07.09.2017, S. 516–523
DOI: 10.1016/j.prostr.2017.07.154 -
(2017): Water-Air Spray Cooling At Heat Treatment Of Cylindrical Samples, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 13
-
(2017): Fem Analysis Of Multilayer And Polygonal Pipes Designed For Subsea Umbilical Pipelines, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 10
-
(2017): FEM analysis of multilayer pipes designed for subsea umbilicals, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 159-171
-
(2017): Analysis of Dislocation Structures in Ferritic and Dual Phase Steels Regarding Continuous and Discontinuous Loading Paths. , In: The Minerals, Metals & Materials Society TMS (Hrsg.): TMS 2017. 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer, Cham, Switzerland, 2017, S. 203-210
DOI: 10.1007/978-3-319-51493-2_20 -
(2017): Properties Of An Intelligent Hot-Working Tool Steel With Alloy Adapted Nitriding Layers, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 49
-
(2017): Influence of Sticking on the Roll Topography at Twin-Roll Casting of Aluminum Alloys., In: Ratvik, A. P. (Hrsg.): Light metals 2017, The Minerals, Metals & Materials Society (TMS). San Diego. 26.02. - 02.03.17. Springer, Cham, Switzerland, 2017, S. 827-831
DOI: 10.1007/978-3-319-51541-0_100 -
(2017): Vorhersage von Schädigung in der Blechmassivumformung, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 220
-
(2017): Development of the generic ENCON container concept based on the aspects of the three ENTRIA options, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 166
-
(2017): Technical concepts for maintenance and repair of HLW-storage containers in the framework of long-term-interim storage, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 156
-
(2017): Monitoring in the deep geological disposal - Technical and social requirements for implementing monitoring of HLW containers, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 56
-
(2017): Long term monitoring of the technical barrier in deep geological disposal, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 168
-
(2017): Handling techniques for HLW retrieval considering the influence of generic container concepts, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 74
-
(2017): MIG-basierte, robotergestützte Additive Fertigung von Aluminiumbauteilen, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 311-319
-
(2017): Automatable splicing method for steel cord conveyor belts - Finding a suitable preparation process, In: AST 2017 – Scientific Symposium on Automated Systems and Technologies. St. Petersburg, Russland. 14.06.-15.06.2017, S. 17-24
-
(2017): Heat Treatment of Steel-Aluminum Hybrid Components, In: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 53-60
DOI: 10.7449/2017/MST_2017_53_60 -
(2017): Heat Treatment of Steel-Aluminium Tailored Forming-Components, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
-
(2017): Wärmebehandlung für belastungsangepasste Werkstoffeigenschaften von Tailored Forming-Komponenten, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 193
-
(2017): Manufacturing of tailored tubes with a process integrated heat treatment, In: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 190003
DOI: 10.1063/1.5008216 -
(2017): Heat-Treatment Of Coated Steel Sheets Before And After A Cold Roll Bonding Process, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
-
(2017): Properties Of Clinched Stainless Steel Sheets As A Result Of Thermal Loading, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
-
(2017): Development of Sponge Structure and Casting Conditions for Absorbable Magnesium Bone Implants, In: TMS 2017 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer International Publishing; Springer, Cham, 2017, S. 307-317
DOI: 10.1007/978-3-319-51493-2_29 -
(2017): New bainite sensor technology allows for a detailed view on material transformation, Proceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 133-140
-
(2017): Plasmaschneiden – der nächste Schritt, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 250-256
-
(2017): Simulation of the change in Mechanical Properties of Degradable Bone Implants, In: Proceedings of the 7th GACM Colloquium on Computational Mechanics for Young Scientists from Academia and Industry. Stuttgart. 11.10.- 13.10.2017
-
(2017): Robustes Laserstrahlschneiden unter Wasser, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 32-38
-
(2017): Technical inheritance: Information basis for the identification and development of product generations, In: Maier, A. et al. (Hrsg.): Proceedings of the 21st International Conference on Engineering Design (ICED17). Vol 6: Design Information and Knowledge. 21.08.-25.08.2017, Vancouver, Canada, S. 91-100
-
(2017): Modeling of nickel-based superalloys in a crystal plasticity framework, In: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, 2017, S. 121
-
(2017): Regeneration of High Pressure Turbine Blades. Development of a Hybrid Brazing and Aluminizing Process by means of Thermal Spraying, The 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 72-76
DOI: 10.1016/j.procir.2016.09.041 -
(2017): Heat treatment of the thermally sprayed coating system NiCrSi/NiCoCrAlY/Al for repair brazing high pressure turbine blades, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 462-466
-
(2017): Fügezonenbeeinflussung beim Laserstrahlschweißen von Stahl-Aluminium- Mischverbindungen zur Verbesserung der Umformeigenschaften, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 194
-
(2017): Beeinflussung des Schmelzbades von Mischverbindungen im Laserstrahl-schweißprozess durch Ultraschall., In: Fortschrittsberichte der Materialforschung und Werkstofftechnik, Tagungsband 2. Niedersächsisches Symposium Materialtechnik. Shaker, Herzogenrath, 2017, S. 259-268
-
(2017): Influence of beam position and ultrasonic amplitude on the micro-structure of laser welded dissimilar steel-steel joints, In: 36th International Congress on Applications of Lasers & Electro-Optics - ICALEO® 2017. Atlanta, 22.10.-26.10.2017
-
(2017): Changes of the metal temperature at the axial water-air cooling of cylindrical samples, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 32-38
-
(2017): Change of metal temperature at heat treatment with water-air spray cooling, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 27-31
-
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses, Deutscher Gießereitag 2017, Posterbeitrag, Düsseldorf, 17. - 18.05.2017
-
(2017): Tribological Investigations on Tailored Formed Axial Bearing Washers, In: 6th World Tribology Congress. Beijing, China. 17.09.-22.09.2017
-
(2017): Inline application of bainite sensor technology for characterizing phase transformation during cooling, Proceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 141-150
-
(2017): Data acquisition for stress analysis by Digital Image Correlation of nickel-based superalloys under tensile load at high temperatures, In: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, S. 38
-
(2017): Investigation Of The Sign-Variable Low-Cyclic Bending Deformation Influence On Sheet Properties Of Materials With A Hexagonal Crystal Lattice, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 47
-
(2017): Enhanced corrosion resistance of magnesium alloys by transplantation of thermally sprayed coatings, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 665–668
-
(2017): Transpiring thermally sprayed alumina layers with integrated fluid flow tubes, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 47-50
-
(2017): Advanced characterization techniques for turbine blade wear and damage, The 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 83-88
DOI: 10.1016/j.procir.2016.09.005 -
(2017): Development of a Cu-Sn based brazing system with a low brazing and a high remelting , 19th Chemnitz Seminar on Materials Engineering, IOP Conf. Ser.: Mater. Sci. Eng. 181, 2017, 12005
DOI: 10.1088/1757-899X/181/1/012005 -
(2017): Herausforderungen bei der numerischen Simulation des nassen Unterwasserschweißens, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 47-53
-
(2017): Beitrag zur Finite-Elemente-Modellierung des nassen Unterwasserschweißens, In: Schafstall, H.; Wohlmuth, M. (Hrsg.): 18. RoundTable Simulating Manufacturing. Tagungsband 30. Mai - 1. Juni 2017, Marburg. Simufact Engineering GmbH, Hamburg, 2017, S. 225-239
-
(2017): Einfluss der lokalen Mikrostruktur auf die Umformbarkeit stranggepresster Werkstoffverbunde, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 192
-
(2017): Co-extrusion of semi-finished aluminium-steel compounds, In: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 140002
DOI: 10.1063/1.5008158 -
(2017): Intercritical Annealing – New Heat Treatment Strategies for Tailoring the Stress-Strain Behavior of 22MnB5, In: Oldenburg, M.; Prakash, B.; Steinhoff, K. (Hrsg.): Hot Sheet Metal Forming of High-Performance Steel CHS2. 6th International Conference, 4-7 June 2017, Atlanta, GA., USA. Verlag Wissenschaftliche Scripten, Auerbach, 2017, S. 433-440
-
(2017): In-situ examination of Cr-Ni steel surfaces heat treated under N2 by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 13th DELTA User Meeting & Annual Report 2017. Dortmund. 29.11.2017, S. 27-28
-
(2016): Fügen von Casingsegmenten mit dem MIAB-Schweißverfahren für die Anwendung am Bohrturm, In: DGMK/ÖGEW-Frühjahrstagung des Fachbereiches Aufsuchung und Gewinnung am 21. und 22. April 2016 in Celle. Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle e.V, Hamburg, 2016, S. 139-148
-
(2016): Inherent Load Measurement and Component Identification by multi-dimensional Coded Data in the Component's Subsurface Region, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 537-543
DOI: 10.1016/j.protcy.2016.08.067 -
(2016): Joining TWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologies, In: Gemeinsame Forschung in der mechanischen Fügetechnik. Tagungsunterlagen mit CD des 6. Fügetechnischen Gemeinschaftskolloquiums am 7. und 8. Dezember 2016 in München. Europäische Forschungsgesellschaft für Blechverarbeitung e.V, Hannover, 2016
-
(2016): Commissioning of a high temperature heater cell for in-situ ReflEXAFS studies of steel surfaces under variable reductive gas atmospheres, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 11-13
-
(2016): Applications of high frequency eddy current technology for material characterization of thin coatings, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 37-43
-
(2016): In-Situ Monitoring of the Microstructure Evolution, In: ATZK - Association for the Heat Treatment of Metals (Hrsg.): Proceedings of the European Conference on Heat Treatment 2016 and 3rd International Conference on Heat Treatment and Surface Engineering in Automotive Applications. 10.05. - 13.05.2016, Prague, Czech Republic
-
(2016): In-Situ Monitoring of the Microstructure Evolution Using Eddy Current Technology, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Material Characterization of Thin Coatings Using High Frequency Eddy Current Technology, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Mechanisms of surface deoxidation of stainless steels in vacuum brazing processes, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 181-185
-
(2016): Microstructure and Magnetic Properties of Cobalt and Zinc Containing Magnesium Alloys, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 35-42
DOI: 10.1016/j.protcy.2016.08.006 -
(2016): The Concept of Technical Inheritance in Operation: Analysis of the Information Flow in the Life Cycle of Smart Products, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 79-88
DOI: 10.1016/j.protcy.2016.08.012 -
(2016): Degradation of MgF2-Coated and Uncoated MgNd2 Specimens in Contact with Nasal Mucosa, In: 145. TMS Annual Meeting & Exhebition, Magnesium technology 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 331-335
-
(2016): Fluxfree brazing of copper based alloys and steels at temperatures between 650 °C and 850 °C in monosilane-doped nitrogen, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 186-191
-
(2016): Applications of high frequency induction thermography in themegahertz range for material characterization of turbine components, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 31-36
-
(2016): Non-Destructive Damage Detection and Material Characterization of Turbine Components Using Megahertz Range Induction Thermography in Pulsed Mode, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Evolution of void shape anisotropy in deformed bcc steels, In: 145. TMS Annual Meeting & Exhebition, Proceedings of the Epd Congress 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 173-179
-
(2016): Development of intelligent hot forging tools with increased wear resistance by cyclic edge-zone hardening, In: Proceedings of the 10th TOOL Conference 2016. Bratislava, Slowakei. 04.10. - 07.10.2016, S. 316-325
-
(2016): MagnetArc Schweißen - Moderne Fügetechnik zum Verschweißen dickwandiger Rohre in der Bohrindustrie, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 37-42
-
(2016): Gefüge und mechanische Eigenschaften impfbehandelter Schweißnähte an Titan, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 49-53
ISBN: 978-3-945023-74-7 -
(2016): Anwendungspotentiale der atmosphärischen Elektronenstrahltechnik als universelles Fertigungsverfahren für die Blechbearbeitung, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 399-403
-
(2016): Automated Underwater Arc Welding, In: Overmayer, L.; Shkodyrev, V. (Hrsg.): AST - Symposium on Automated Systems and Technologies. Hannover, 12.10.-13.10.2016. PZH Verlag, Garbsen, 2016, S. 21-26
ISBN: 978-3-95900-102-1 -
(2016): Transplantation of Micro- and Nanostructured Coatings by Means of Thermal Spraying and PVD, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 3-11
-
(2016): Introducing Selective Laser Melting to Manufacture Machine Elements, In: Marjanović, D. et al. (Hrsg.): Proceedings of the DESIGN 2016 14th International Design Conference. Dubrovnik, Croatia. 16.05.-19.05.2016, S. 831-842
-
(2016): Development of copper and nickel based brazing solders with a low brazing and a high remelting temperature, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 272-277
-
(2016): Herstellung von innenbeschichteten Druckgussbauteilen durch das Schichttransplantationsverfahren, 16. Internationaler Deutscher Druckgusstag, Nürnberg, 12.01. - 14.01.2016
-
(2016): Construction of an experimental set-up for brazing stainless steel samples in low vacuum atmosphere consisting monosilane-doped argon, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 311-315
-
(2016): Cold pressure welding by incremental rolling: Deformation zone analysis, In: Chinesta, F.; Cueto, E.; Abisset-Chavanne, E. (Hrsg.): Proceedings of the 19th International ESAFORM Conference on Material Forming: ESAFORM 2016. Nantes, France. 27-29 April 2016. AIP Publishing LLC, Melville, New York, S. 100013
-
(2016): Development of a combined brazing-nitriding process for the production of bipolar plates made of chromium coated metal sheets, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 174-180
-
(2016): Manufacturing of multiphase steel with adapted material properties, In: Special Workshop Multiscale Modeling of Heterogeneous Structures. 21.-23. Sept. 2016, Dubrovnik, Kroatien
-
(2016): Adapted multi-phase microstructures by intercritical annealing and press hardening, In: Furuhara, T.; Nishida, M.; Miura S. (Hrsg.): The Ninth Pacific Rim International Conference on Advanced Materials and Processing (PRICM9). Kyoto, Japan. 01.-05. Aug. 2016. Wiley-VCH, 2016, S. 295-298
-
(2016): Short-time nitridation of electroplated chromium coatings in SiH4-doped N2- atmosphere analysed by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 53-54
-
(2016): Selectively Oxidised Tool Steel Surfaces for Sheet Metal Forming, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 179-185
ISBN: 978-3-95900-072-7 -
(2015): Spectral measurement of element solubility in water up to 300 MPa, WJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
-
(2015): Characterisation of native stomach tissue of swine by uniaxial tensile testing, Biomed Tech 2015, DGBMT, 60 (s1), 108-109
DOI: 10.1515/bmt-2015-5004 -
(2015): Hot forming and subsequent cooling outside the press for adjusted tailored properties of 22MnB5 steel sheets, In: Steinhoff, K.; Oldenburg, M.; Prakash, B. (Hg.): Hot Sheet Metal Forming of High Performance Steel. 5th International Conference Proceedings CHS2. Verl. Wiss. Scripten, Auerbach; S. 35-44.
ISBN: 978-3-95735-023-7 -
(2015): Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling process, In: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 319–328.
-
(2015): Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatment, In: Associazone Italiana di Metallurgia (AIM) (Hg.): Proceedings of the European Conference on Heat Treatment 2015 & 22nd IFHTSE Congress, 20.-22.05.2015, Venice, Italy
ISBN: 978-88-98990-03-0 -
(2015): Non-destructive Testing of Longitudinal and Charge Weld Seams in Extruded Aluminum and Magnesium Profiles, Materials Today: Proceedings. Aluminium Two Thousand World Congress and International Conference on Extrusion and Benchmark ICEB 2015, 2015, S. 4866-4873
DOI: 10.1016/j.matpr.2015.10.037 -
(2015): Präparation plastisch umgeformter Stahlproben durch Ionenstrahlbearbeitung für die Untersuchung von duktiler Schädigung, In: Petzow, W. (Hg.): Fortschritte in der Metallographie. Berichte der 49. Metallographie-Tagung Dresden, 16. bis 18. September 2015; S. 153–158
ISBN: 978-3-88355-410-5 -
(2015): Comparsion of the mechanisms of void formation by plastic deformation in single- and dual-phase bcc-steels, Proceedings of the TMS 2015 Annual Meeting 2015, Characterization of minerals, metals, and materials, Orlando, Florida, 15.-19.03.2015. Hoboken, New Jersey: John Wiley & Sons, Inc, S. 75–81
DOI: 10.1002/9781119093404.ch9
ISBN: 978-1-119-08246-0 -
(2015): A process chain using a non-vacuum electron beam as a universal tool for material processing, Proceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
-
(2015): Trennen von Spundwänden mittels CAMG-Technik, In: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 10-15
ISBN: 978-3-945023-43-3 -
(2015): Aus der Forschung in die Praxis – Entwicklung einer neuen Stabelektrode zum nassen Unterwasserschweißen, In: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 4-9
ISBN: 978-3-945023-43-3 -
(2015): Determination of heat transfer coefficients for complex spray cooling arrangements, In: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 247–256
-
(2015): Inkrementelles Umformen dünnwandiger Funktionsbauteile unter Einsatz prozessangepasster Halbzeuge durch Verfahren der Blechmassivumformung, Tekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 149-170
ISBN: 978-3-8440-3434-9 -
(2015): Entwicklung einer korrosions- und verschleißbeständigen Eisenbasisschicht, In: Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Tagungsband 1. Niedersächsisches Symposium Materialtechnik, 12. bis 13. Februar 2015. Shaker, Herzogenrath, 2015, S. 101-112
-
(2015): Gelötete Metall-Keramik-Verbunde in Werkzeugen, In: DVS-Berichte Bd. 315, Tagungsband des DVS Congress und Expo in Nürnberg. DVS-Media, Düsseldorf; S. 559-562
-
(2015): Schnell und sicher Bauteile aus Zirkalloy trennen / Cutting Zircaloy components quickly and safely, In: Tagungsband KONTEC 2015 - 12. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle“, Dresden, 25.-27. März 2015, S. 598-616
-
(2015): Smart System Integration: Moulding of Magnetic Field Sensors into AlSi9Cu3(Fe)-Alloys, In: SMTA, Pan Pacific Symposium Conference Proceedings, 2015.
-
(2015): Microstructure and Properties of Cobalt- and Zinc-Containing Magnetic Magnesium Alloys Processed by High-Pressure Die Casting, In: Manuel, M. V. et al. (Hg.): Magnesium Technology 2015. Proceedings of a symposium sponsored by Magnesium Committee of the Light Metals Division of The Minerals, Metals & Materials Society (TMS), 144th Annual Meeting & Exhibition, 15.-19.03.2015, Orlando, Florida. John Wiley & Sons, Inc., Hoboken, New Jersey, 2015; S. 451-454
-
(2015): Transplantation of Thermal Sprayed Coatings, ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 753-755
ISBN: 978-1-62708-093-4 -
(2015): Stress-induced transformation on Ni-Mn-In alloy and the concomitant change of resistivity, 10th European Symposium on Martensitic Transformations (ESOMAT 2015), Poster presentation, 14. - 17. September 2015, Antwerpen.
-
(2015): Lichtbogenschweißen von Titanlegierungen – Einfluss von Impfmitteln auf das Schweißgefüge von TiAl6V4, Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Fortschrittsberichte der Materialforschung und Werkstofftechnik; Tagungsband zum 1. Niedersächsischen Symposium Materialtechnik. 12. bis 13. Februar 2015. Herzogenrath: Shaker, S. 176–185
ISBN: 978-3-8440-3403-5 -
(2015): Formhärten und Spraykühlung – Potenziale und Anwendungsmöglichkeiten, In: Merklein, M. (Hrsg.): 10. Erlanger Workshop Warmblechumformung 2015. Meisenbach GmbH-Verlag, Bamberg, 2015, S. 59-78
-
(2015): Robot-based non-vacuum electron beam technology with a plasma cathode EB emitter, Proceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
-
(2015): Development of a two-stage hybrid Technology for repairing Turbine Blades, In: ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 37-40
-
(2015): Future regeneration processes for high pressure turbine blades, Deutscher Luft- und Raumfahrtkongress, Rostock, 22.09.-24.09.2015 Weitere Informationen
-
(2015): Sensorkontrollierte Bainitumwandlung aus der Schmiedewärme bei modernen Hochleistungsbauteilen im Leichtbau, Werkstoffwoche 2015, Dresden, 14. - 17.09.2015
-
(2015): Hochleistungsbauteile für den Leichtbau mit sensorkontrollierter Bainitumwandlung aus der Schmiedewärme, In: Borsutzki, M. (Hrsg.): Fortschritte in der Werkstoffprüfung für Forschung und Praxis. Verl. Stahleisen, Düsseldorf, 2015, S. 221-228
-
(2015): Characterisation of selective oxidised steel surfaces by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 11th DELTA User Meeting & Annual Report 2015, 2015; S. 70-71
-
(2015): Particle Disintegration in the Abrasive Water Injection Jet, WJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
-
(2015): Möglichkeiten der simulativen Vorhersage von Temperaturentwicklung und Bauteilversagen infolge plastischer Deformation bei DP600 Bauteilen, Tekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 113–128
-
(2015): Homogenization of Coating Properties in Three-Cathode Atmospheric Plasma Spraying by Use of Advanced Diagnostics and Numerical Simulation - Investigations of Suspension Plasma Spraying (SPS), In: ASM International (Hrsg.): Proceedings from the International Thermal Spray Conference 2015; S. 452-459
-
(2014): New valve technology for AWSJ cutting, Proceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 99-106
-
(2014): Characterization of native and decellularised aortic tissue by using uniaxial tensile test, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.115
DOI: 10.1515/bmt-2014-4509 -
(2014): Acoustic process monitoring during transient precision forging of high strengh components, Ludger Overmeyer und Vyacheslav P. Shkodyrev (Hg.): AST - Symposium on Automated Systems and Technologies. Proceedings, Hannover, 15-16 October 2014. 1. Aufl. Garbsen: TEWISS (Berichte aus dem ITA, 2014, Bd. 4), S. 105–110
-
(2014): EcoForge - Prozessintegrierte Wärmebehandlung bainitischer Stähle , Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 245-264
ISBN: 978-3-00-045166-9 -
(2014): Material-inherent data storage using magnetic magnesium-cobalt alloys, Procedia Technology 5, 2nd International Conference of System-Integrated Intelligence: Challenges for Product and Production Engineering Bremen, 2.-04.07.2014, S. 188-197
DOI: 10.1016/j.protcy.2014.09.071 -
(2014): Changes on a platinum electrode surface during acoustic stimulation of a cochlear implant – in vitro approach, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S. 1144–1147
DOI: 10.1515/bmt-2014-5014 -
(2014): Biocompatibility of MgF2-coated MgNd2 alloys in contact with nasal mucosal tissue – in vivo approach, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.108
DOI: 10.1515/bmt-2014-5000 -
(2014): In vivo study of a biodegradable nasal stent (MgF2-coated MgNd2 alloy) in a minipig for up to six months, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1203
DOI: 10.1515/bmt-2014-5014 -
(2014): Drawing and Stranding of Magnesium Wires for use as a Resorbable Suture Material, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1186
DOI: 10.1515/bmt-2014-5014 -
(2014): Experimental investigations on forming limits for aluminium alloy sheet metal at various strain rates, In: H. Huh und A. E. Tekkaya (Hg.): High Speed Forming 2014. Proceedings of the 6th International Conference. Organizing committee of the 6th International Conference on High Speed Forming, May 26–29 2014, Korea Advanced Institute of Science and Technology, Department of Mechanical Engineering. Daejeon, Korea. pp. 11–20.
-
(2014): Magnetizable implants as tool for improved magnetic drug targeting, In: Tissue Engineering & Regenerative Medicine International Society (Hrsg.): Termis, European Chapter Meeting. Special issue, Journal of Tissue Engineering and Regenerative Medicine. Genova, Italy. 10.-13.06.2014, S. 59-60
DOI: 10.1002/term.1931 -
(2014): Development and Analysis of Microstructures for the Transplantation of Thermally Sprayed Coatings, Procedia CIRP Vol. 14, 6th CIRP International Conference on High Performance Cutting, HPC2014, S. 245 -250
DOI: 10.1016/j.procir.2014.03.054 -
(2014): A novel process for producing large scale Mg-sheets, Magnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 289-292
ISBN: 978-1-118-88816-2 -
(2014): Influence of the twin-roll casting parameters on the microsegregation in thin strips of the aluminium alloy EN AW-6082, Wiley, TMS, 2014, Light Metals 2014, P. 411-414 Weitere Informationen
-
(2014): Study of magnesium fluoride and self-assembled organosilane coatings of AZ31 and MgCa0.8 alloys, 6th Symposium on Biodegradable Metals, University Politecnico di Milano, Maratea, Italien, 24.-29. August 2014
-
(2014): Entwicklung und Test eines Prüfverfahrens zur Bewertung von Lötverbindungen bei kombinierter mechanisch-korrosiver Belastung, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 164-171
ISBN: 978-3-00-046877-3 -
(2014): Transparent PVD-coatings on zirconia for dental applications, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014
-
(2014): Decellularized aortic allograft stabilized by an absorbable magnesium scaffold for substitution of the descending aorta, Thorac cardiovasc Surg (The Thoracic and Cardiovascular Surgeon)
DOI: 10.1055/s-0034-1367288 -
(2014): Transfer of Micro-structures by Transplantation of Thermal Sprayed Coatings, ITSC 2014 Conference proceedings, lectures and posters, 21. - 23.5.2014, Barcelona, Spanien, S. 142–145
ISBN: 978-3-87155-574-9 -
(2014): Ex-situ EXAFS investigations of steel deoxidation processes, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 10th DELTA User Meeting & Annual Report 2014. Dortmund, 26.11.2014, S. 105-106
-
(2014): Blechmassivumformung - vom Halbzeug zum Funktionsbauteil, Behrens, B. A. (Hg.): 21. Umformtechnisches Kolloquium Hannover, Industrie und Wissenschaft – Gemeinsam die Zukunft gestalten, 2014; S. 265-280
-
(2014): Common application of Ni-based fillermetals and hotgascorrosion protection coatings by means of thermal spraying with subsequent heat treatment for near net shape turbineblade repairing, In: Bouzakis, K.-D. et al. (Hrsg.): Proceedings / 11th International Conference THE "A" Coatings in Manufacturing Engineering, 1 - 3 October 2014, Thessaloniki, Greece. Ed. Ziti, Thessaloniki, 2014, S. 179-184
ISBN: 978-960-98780-8-1 -
(2014): Spray Cooling of Early Extracted Hot Stamped Parts, TMS 2014, 143. Annual Meeting Supplemental Proceedings, John Wiley & Sons, Inc., Hoboken, NJ, 16.–20.02.2014, in San Diego, California USA Weitere Informationen
DOI: 10.1002/9781118889879.ch116
ISBN: 9781118889879 -
(2014): Sensorkontrollierte Umwandlung aus der Schmiedewärme zur Prozesssteuerung und Bauteiloptimierung , Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 338
ISBN: 978-3-00-045166-9 -
(2014): Coating Systems for Biodegradable Magnesium Applications, Magnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 371-374
ISBN: 978-1-118-88816-2 -
(2014): Heat Treatment of Aluminum-Titanium-Compounds Made by Co-Extrusion and Friction Welding, Aluminium Alloys 2014 - ICAA14, Materials Science Forum, 794-796, S. 839–844
DOI: 10.4028/www.scientific.net/MSF.794-796.839 -
(2014): Finite element simulations for development of cardiovascular implants to support biological grafts, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.984
DOI: 10.1515/bmt-2014-4422 -
(2014): In vitro degradation and biomechanical testing of magnesium alloys, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.16
DOI: 10.1515/bmt-2014-5000 -
(2014): Roboterassistierte Umstellungsosteotomie mittels Wasserabrasivstahltechnik, Deutsche Gesellschaft für Computer‐ und Roboter Assistierte Chirurgie, Session XV
-
(2014): Robot Guided Water Jet Cutting to Assist Osteotomies of Human Bones, Video-Proceedings - IEEE, International Conference on Robotics and Automation, Hong Kong, May/June 2014, Video
-
(2014): Aufbau einer RF-PVD Anlage zur Abscheidung sauerstoffaffiner Materialien für die Herstellung wärmegenerierender Systeme, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 247–254
ISBN: 978-3-00-046877-3 -
(2014): Method for the material-specific repair preparation of carbon fiber reinforced plastic structures, Proceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 45-56.
-
(2013): Process Time Reduction of Hot Stamping by Means of Early Extraction from the Press, In: Mats Oldenburg und Kurt Steinhoff (Hg.): Proceedings / 4th International Conference Hot Sheet Metal Forming of High Performance Steel. June 9 - 12, 2013, Luleå, Sweden. Auerbach: Verl. Wiss. Scripten (CHS 2 series, 4), S. 259-266 (8).
-
(2013): Untersuchung und Qualifizierung thermisch gespritzter Korrosionsschutzschichten für dickwandige Behälterbauteile, Internationales Symposium Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle , In: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Dresden. 13.-15.03.2013, S. 555-562
-
(2013): Influence of different storage durations on the properties of degradable magnesium based implants, European Cells and Materials Vol. 26. Suppl. 5, 2013 (page 17) Weitere Informationen
-
(2013): Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology, 9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013
-
(2013): Abbildung des Werkstoffverhaltens von ferritischem Stahl in numerischen Modellen zur Darstellung von Blechmassivumformprozessen bei zyklischen Belastungspfaden, In: M. Merklein, B.- A. Behrens und A. E. Tekkaya (Hg.): 2. Workshop Blechmassivumformung. Umformtechnische Herstellung von komplexen Funktionsbauteilen mit Nebenformelementen aus Feinblechen - Blechmassivumformung -. Erlangen, 13.11.2013. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 69–84.
-
(2013): High Frequency Eddy-Current and Induction Thermography Inspection Techniques for Turbine Components, In: 18th International Workshop on Electromagnetic Non-destructive Evaluation (ENDE). Bratislava, SK, 25.-28.06.2013.
ISBN: 978-80-554-0713-5 -
(2013): Nutzung von Beschichtungen aus Zinklegierungen zur Steigerung der Wärmeleitfähigkeit beim Verbundguss von Kupfer und Aluminium im Druckgussprozess, In: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 9
-
(2013): Herausforderung beim Reparaturschweißen an Spundwandbauwerken im nassen und halbnassen Bereich, In: Wirtschaftsvereinigung Stahl (Hrsg.): Fachseminar „Stahlspundwände – Neues für Planung und Anwendung“. Hannover. 12. Dezember 2013