Forschung
Publikationen

Publikationen des Institutes für Werkstoffkunde

Bücher

  • Lau, K.; Konya, R.; Hassel, T.; Bach, Fr.-W. (2012) Forschung für die Praxis P 714. Qualifizierung des Nonvakuum-Elektronenstrahlschweißens zum Fügen höherfester Stahlfeinbleche im AutomobilbauDüsseldorf: Verlag und Vertriebsgesellschaft mbH
    ISBN: 978-3-942541-20-6
  • Bach, Fr.-W. (Hg.) (2010) "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme". Vortragsband zum Kolloquium des Graduiertenkolleg 1378/1.LWT, TU Dortmund. Unter Mitarbeit von W. Tillmann, T. Plorin und B. Rüther. Garbsen: PZH Produktionstechnisches Zentrum. Online verfügbar unter http://www.gbv.de/dms/tib-ub-hannover/626868181.pdf. Weitere Informationen
  • Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.; Lenarz, T.; Schwab, B.; Kramer, S.; Kietzmann, M. (2010) Herstellungsverfahren für einen Mukosastent, 06.05.2010.

Beiträge in Büchern

  • Barton, S.; Mroz, G.; Reimche, W.; Maier, H. J. (2017) Storing the load history of a component in the subsurface regionIn: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 67-84
    ISBN: 978-0-12-811939-6
  • Barton, S.; Mroz, G.; Reimche, W.; Maier, H. J. (2017) Data storage within the subsurface of a component by local heat treatmentIn: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 85-99
  • Schilling, T.; Bauer, M.; LaLonde, L.; Maier, H. J.; Haverich, A.; Hassel, T. (2017) Cardiovascular Applications of Magnesium AlloysIn: Aliofkhazraei, M. (Hrsg.): Magnesium Alloys. InTech, Rijeka, Croatia, 2017, S. 191-217
    DOI: 10.5772/66182
  • Knödler, P.; Bathe, T.; Möhwald, K.; Maier, H. J.; Biermann, D. (2016) Verfahren und Methoden zur Transplantation thermisch gespritzter Schichten für DruckgussteileIn: Biermann, D. (Hrsg.): Spanende Fertigung. Prozesse, Innovationen, Werkstoffe. Vulkan, Essen, 2016, S. 88-93
    ISBN: 978-3-8027-2989-8
  • Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Hassel, T.; Bach, F.-W.; Maier, H. J.; Lamon, J.; Haverich, A.; Wriggers, P. (2015) Development of Magnesium Alloy Scaffolds to Support Biological Myocardial Grafts: A Finite Element InvestigationLenarz, T.; Wriggers, P. (Hg.): Biomedical Technology, Publishing Lecture Notes in Applied and Computational Mechanics 74, Springer International Publishing, Switzerland, S. 81-100
    DOI: 10.1007/978-3-319-10981-7_6
    ISBN: 978-3-319-10980-0
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Hübsch, C.; Maier, H. J. (2014) Microstructured thermally sprayed surfacesB. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92
  • Böhm, V.; Kästner, M.; Gillhaus, Rüdiger; Haskamp, K.; Reimche, W.; Bach, F.-W.; Reithmeier, E. (2014) Mess- und PrüftechnikBach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 311-430
  • Frackowiak, W.; Bruchwald, O.; Reimche, W.; Bach, F.-W.; Maier, H. J. (2014) High Frequency Eddy-Current and Induction Thermography Inspection TechniquesIn: Capova, K. (Hrsg.): Electromagnetic nondestructive evaluation (XVII), ISBN 978-1-61499-407-7, S. 226-233
    DOI: 10.3233/978-1-61499-407-7-226
    ISBN: 978-1-61499-407-7
  • Klassen, A.; Bistron, M.; Dellinger, P.; Schaup, J.; Deißer, T. A.; Behrens, L.; Köhler, J.; Bouguecha, A.; Möhwald, K.; Denkena B.; Behrens, B.-A. (2014) WerkzeugtechnologieBach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 53-125
    ISBN: 978-3-642-34663-7
  • Wolf, L.; Diekamp, M.; Gretzki, T.; Nürnberger, F.; Bach, F.-W.; Rodman, D.; Moritz, J.; Schrödter, J.; Hübner, S.; Behrens, B. -A (2014) Hot Stamping and subsequent spray cooling: A new manufacturing approachProf. O. N. Golovko, Plastic Deformation of Metals, 2014, Akzent PP, Dnipropetrovsk, S. 36-55
    ISBN: 978-617-7109-18-0
  • Yu, Z.; Gretzki, T.; Nürnberger, F.; Kästner, M.; Haskamp, K.; Bach, F.-W.; Schaper, M.; Hassel, T. (2014) WärmebehandlungBach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 127–220
  • Angrisani, N.; Seitz, J.-M.; Meyer-Lindenberg, A.; Reifenrath, J. (2012) Rare Earth Metals as Alloying Components in Magnesium Implants for Orthopaedic ApplicationsIn: W.A Monteiro (Hg.): New Features on Magnesium Alloys: InTech, S. Chapter 4.
  • Erne, M.; Kolar, D. (2012) Thermal Spraying of Oxide Ceramic and Ceramic Metallic CoatingsIn: F. Shi (Hg.): Ceramic Coatings - Applications in Engineering. Rijeka (Kroatien): InTech - Open Access Publisher.
  • Hübsch, C.; Hassel, Th.; Bach, Fr.-W.; Borchers, L.; Kohorst, P.; Stiesch, M. (2011) ZrO2-Keramiken mit oberflächennahen Diffusionsschichten zur Anwendung in der dentalen ProthetikE. Steinhauser und H.-F. Zeilhofer (Hg.): Biomaterialien (1-4, 12), S. 132.
  • Hassel, Th.; Lizunkova, Y.; Wolyniec, A.; Bach, Fr.-W. (2010) Entwicklung und Herstellung von selbstschützenden Doppelmantel-Fülldrahtelektroden zum kontinuierlichen UnterwasserschweißenDVS (Hg.): DVS - Jahrbuch Schweißtechnik 2011: DVS-Verl., Verl. für Schweißen und Verwandte Verfahren, S. 183–191.
  • Haverich, A.; Bach, Fr.-W.; Hassel, T.; Schilling, T.; Cebotari, S.; Tudorache, I.; Hinte, N.; Biskup, C.; Hilfiker, A. (2010) Stabilisierende Magnesiumstrukturen zur Unterstützung von kardiovaskulärem Gewebeersatz im HochdrucksystemZukunftsfähige bioresorbierbare und permanente Implantate aus metallischen und keramischen Werkstoffen, Sonderforschungsbereich SFB 599, Druckerei der Medizinischen Hochschule Hannover, November 2010
    ISBN: 978-3-00-032924-1
  • Bach, Fr.-W.; Hassel, Th. (2005) Herstellung und Deformationsanalyse zur Qualifizierung einer Schutzschicht aus Magnesiumfluorid zur gesteuerten Degration von Implantatlegierungen auf MagnesiumbasisR. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
  • Möhwald, K.; Holländer, U.; Laarmann, A. (2005) Einsatz von Beschichtungsverfahren in der LöttechnikFr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003) Neue Entwicklungstendenzen zum Löten von AluminiumwerkstoffenDeutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143
  • Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Holländer, U. (2000) Oberflächenbehandlung und thermochemische Stabilität von MagnesiumlegierungenMagnesium-Taschenbuch, S. 308-311,
    ISBN: ISBN-10: 3870172649

Vortrag

  • Barton, S. (2018) Bainit-Sensortechnik zur Überwachung und Regelung von GefügeausbildungenDGZfP Arbeitskreis Niedersachsen, 28.06.2018
  • Hassel, T. (2018) Werkstofftechnische Herausforderung - nasses Unterwasserschweißen15. SWB Tagung 2018 – Stahlwasser- und Wasserbau. Wismar, 06.02. - 07.02.2018
  • Barton, S; Reimche, W. (2017) Charakterisierung von Schichtsystemen und Grundwerkstoffen mit problemorientierten WirbelstromtechnikenDGZfP Arbeitskreis Niedersachsen, Hannover, 29.06.2017
  • Hassel, T.; Köhler, A. (2017) Disassembly Technologies for Dismantling Major Nuclear Components48. Jahrestagung Kerntechnik, Berlin, 16.05.2017
  • Hordych, I., Wolf, L., Rodman, D., Nürnberger, F. (2017) Anpassung des Spannungs-Dehnungsverhaltens von niedriglegiertem Vergütungsstahl mittels interkritischen GlühensWerkstoffwoche 2017, Dresden, 28.09.2017
  • Wolf, L. O. (2017) Interkritisches Glühen - Wärmebehandlungsstrategie zur Einstellung des Spannungs-Dehnungsverhaltens von niedrig legierten StählenZentrum für Festkörperchemie und Neue Materialien, ZFM Festkörpernachmittag, Hannover, 07.07.2017
  • Barton, S (2016) Zerstörungsfreies Auslesen von in der Bauteilrandzone gespeicherten Daten und der Belastungshistorie eines BauteilsDGZfP Arbeitskreis Niedersachsen, 25.02.2016
  • Bauer, M. (2016) Forschung und Entwicklungen in der Wasserstrahltechnik - Von der Biomedizintechnik bis zum Rückbau Kerntechnischer AnlagenDeutscher Schneidkongress, Schneidforum Consulting GmbH & Co.KG, Dortmund, 24.-25.02.2016
  • Besserer, H.-B. (2016) Ermüdungsverhalten blechmassivumgeformter BauteileWerkstoff- und Leichtbau-Forum, Hannover Messe, 26.04.2016
  • Golovko, O. (2016) Werkzeugstähle mit abgesenkter Ac1b-TemperaturWerkstoff- und Leichtbau-Forum, Hannover Messe, 26.04.2016
  • Hassel, T.; Köhler, A. (2016) Vorstellung des Arbeitsfortschrittes der Arbeitspakete des IW: Wechselwirkungen zwischen Endlager, Lagerungssystem und Reststoffen zur Beurteilung von Langzeitstabilität und Rückholbarkeit; Interventionstechniken zur sicheren Rückholbarkeit 5. Jahrestreffen des Projektes ENTRIA, Berlin, 16.11.2016
  • Hassel, T.; Köhler, A. (2016) Die Rolle des Behälterkonzeptes bei der Erarbeitung von Bewertungsgrundlagen für die Optionenanalyse im ENTRIA VerbundFachtagung Technische Aspekte von Optionen zur Entsorgung hochradioaktiver Reststoffe, Braunschweig, 02.11.2016
  • Hassel, T.; Köhler, A. (2016) The importance of retrievability in the context of long-term monitoringTechnical Monitoring and Long-term Governance, Karlsruhe, 19.10.2016
  • Knödler, P. (2016) Beschichtung auf den Kopf gestellt – Transplantation von thermisch gespritzten SchichtenMetav 2016 – Internationale Messe für Technologien der Metallbearbeitung, Verein Deutscher Werkzeugmaschinenfabriken e. V. (VDW), Düsseldorf, 23.02.2016
  • Aldag, D.; Varahram, A.; Lehr, J.; Maier, H.; Hassel, T. (2015) Automated and Fast Expandable Casing Connection Method Utilizing MIAB-Welding TechnologyExpandable Technology Forum (ETF). Hamburg, 03.06.2015
  • Hassel, T.; Langen, D. (2015) Investigation of Multi Level Plasma Cutting as an efficient tool for welding edge preparationIn-House Exhibition – IHT Automation’s 25th Anniversary, IHT Automation, Baden-Baden, 26.06.2015
  • Hassel, T.; Langen, D.; Krink, V. (2015) Untersuchungen zum Mehrfasenplasmaschneiden als wirtschaftliches Werkzeug zur SchweißkantenvorbereitungDVS Fachtagung / Theorie und Praxis moderner Schneid- und Schweißtechnologien, DVS Landesverband Berlin-Brandenburg, Finsterwalde 23.-24.04.2015
  • Maier, H. J. (2015) Magnetische Magnesiumlegierungen: Vom Werkstoff bis zum stranggepressten sensorischen ProfilWerkstoffwoche 2015, Dresden, 14. - 17.09.2015
  • Otten, M. (2015) Prozessintegrierte Innenbeschichtung von Druckgussbauteilen durch die Schichttransplantation15. Werkstoff-Forum, Hannover Messe, 13.04.2015
  • Barton, S.; Reimche, W. (2014) Zerstörungsfreie Charakterisierung von Werkstoffzustand und Fehlerinitiierung in autofrettierten Bauteilen47. Sitzung des Arbeitskreises Wasserstrahltechnologie, Südharz, 06.10.2014
  • Bobzin, K.; Öte, M.; Linke, T. F.; Schein, J.; Zimmermann, S.; Maier, H. J.; Möhwald, K.; Lummer, C. (2014) Investigation of three-cathode atmospheric plasma spraying by use of advanced diagnostics and numerical simulationOral Presentation ITSC: International Thermal Spray Conference, May 21st-23rd, 2014, Barcelona, Spain
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2014) Bainitsensortechnik ermöglicht Einblick in die Werkstoffumwandlung und PhasenausbildungDeutsche Gesellschaft für Zerstörungsfreie Prüfung, 390. Sitzung des Arbeitskreises Niedersachen, Garbsen, 30.01.2014
  • Dellinger, P. (2014) PVD-Schichttransplantation - ein neues Verfahren zum Abformen mikrostrukturierter OberflächenZentrum für Festkörperchemie und Neue Materialien (ZFM), ZFM-Festkörpernachmittag, Garbsen, 11.07.2014
  • Dellinger, P. (2014) PVD-Dünnschichttechnik - Oberflächen am Institut für Werkstoffkunde (IW) / Ein Blick über den TellerrandDünnschicht Seminar der Universität Duisburg-Essen der Fakultät für Physik; Duisburg; 05.06.2014
  • Frackowiak, W.; Bruchwald, O.; Reimche, W.; Maier, H. J. (2014) Schicht-und Bauteilfehlerprüfung mit HF-Wirbelstromprüftechnik und HF-Induktionsthermografie390. Sitzung des Arbeitskreises Niedersachen, Deutsche Gesellschaft für Zerstörungsfreie Prüfung, Garbsen, 30.01.2014
  • Fritsching, U.; Bucquet, T.; Hinrichs, B.; Fischer, M.; Bleck, W.; Huskic, A.; Kazhai, M.; Hadifi, T.; Bouguecha, A.; Behrens, B.-A.; Labanova, N.; Hajyheydari, E.; Felde, A.; Liewald, M.; Gulpak, M.; Egorov, F.; Wagner, A.; Brinksmeier, E.; Reimche, W.; Bruchwald, O.; Frackowiak, W. (2014) EcoForge - Ressource-Efficient Process Chains for High-Perfomance Steel Components21. International Forging Congress, Berlin, 29. Juni - 4. Juli 2014,
  • Klose, C. (2014) Entwicklung magnetischer Magnesiumlegierungen mit sensorischen EigenschaftenZentrum für Festkörperchemie und Neue Materialien (ZFM), ZFM-Kolloquium, Hannover, 23. Juni 2014
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H.-J.; Bach, F.-W. (2014) Hochtemperatur Bainit-Sensortechnik zur inline Charakterisierung der Werkstoffumwandlung und Einstellung der BauteileigenschaftenAiF-Leittechnologien für Morgen EcoForge. Ressourceneffiziente Prozessketten für Hochleistungsbauteile. Hamburger NDT Tage 2014. DGZfP-Ausbildungszentrum Hamburg/Helling. Hamburg, 12.11.2014
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H.J. (2014) Hochleistungsbauteile für den Leichtbau mit sensorkontrollierter Bainitumwandlung aus der SchmiedewärmeMassiver Leichtbau im Automobil 2014, 18.-19.11.2014, Stuttgart
  • Reimche, W.; Bruchwald, O.; Zwoch, S (2014) Wirbelstrombasierte Unterwasser-Bauteilprüfung390. Sitzung des Arbeitskreises Niedersachen, Deutsche Gesellschaft für Zerstörungsfreie Prüfung, Garbsen, 30.01.2014
  • Bauer, M.; Angrisani, G. L.; Schilling, T.; Kaufeld, T.; Hinz, C.; Haverich, A.; Bach, Fr.-W.; Maier, H. J.; Hassel, T. (2013) Evaluation of different Mg alloys for the in-vitro and in-vivo degradation testing of stabilizing tubular aortic scaffoldsJahrestagung der Deutschen Gesellschaft für Biomaterialien 2013. Deutsche Gesellschaft für Biomaterialien e. V. Deutsche Gesellschaft für Biomaterialien e. V., Erlangen-Nürnberg, 26.09.2013.
  • Bauer, M.; Biskup, C.; Schilling, T.; Haverich, A.; Bach, Fr.-W.; Maier, H. J.; Hassel, T. (2013) Influence of shot peening on surface roughness and in-vitro load cycles of magnesium alloysBMT Kongress 2013. VDE MedTech. Deutsche Gesellschaft für Biomedizinische Technik (DGBMT). Graz, 19.09.2013.
  • Dellinger, P. (2013) Innovative Lotapplikationen für das HochtemperaturlötenVortrag beim DVS, Bezirksverband Ruhrgebiet-Mitte, Dortmund, 16.10.2013
  • Faßmann, D. (2013) Abbildung des Werkstoffverhaltens von ferritischem Stahl in numerischen Modellen zur Darstellung von Blechmassivumformprozessen bei zyklischen Belastungspfaden2. Workshop Blechmassivumformung. Sonderforschungsbereich / Transregio 73. Erlangen, 13.11.2013.
  • Faßmann, D. (2013) Duktile Schädigung in der Blechmassivumformung - Festigkeitseinschränkende Poren- und Rissbildung im Fertigungsprozess13. Werkstoffforum. Hannover Messe 2013,Deutsche Messe AG / IW, Hannover, 09.04.2013
  • Hassel, T. (2013) Die Verwendung atmosphärischer Elektronenstrahltechnologien als thermisches Schneidwerkzeug13. Werkstoff-Forum, Hannover Messe 2013. Deutsche Messe AG / IW. Hannover, 11.04.2013
  • Klose, C. (2013) Magnesium Alloys with Sensory PropertiesWerkstoff-Forum auf der Hannover Messe. Hannover Messe. Hannover, 12.04.13.
  • Klose, C.; Demminger, C.; Zwoch, S.; Reimche, W.; Bach, F.-W; Maier, H. J. (2013) Magnesium race car components with load-sensitive propertiesEuro LightMAT 2013. Magnesium, Aluminium, Titanium - Science and Technology. DGM. Bremen, 03.09.2013.
  • Krauß, M.; Frackowiak, W.; Pösch, A.; Kästner, M.; Reithmeier, E.; Maier, H. J. (2013) Assessment of used turbine blades on and beneath the surface for product regenerationCLEO 2013, 16.5.2013 München
  • Kussike, S. M. (2013) Hydrophobierung von Stabelektroden zum nassen Lichtbogenhand-schweißen unter Wasser – Verbranntes Thema oder wo liegen die Möglichkeiten?DVS Congress 2013. Große Schweißtechnische Tagung 2013. Deutscher Verband für Schweißen und verwandte Verfahren e. V., Düsseldorf. Essen, 16.09.2013.
  • Meschut, G.; Hahn, O.; Matzke, M.; Olfermann, T.; Reimche, W.; Birr, C.; Mroz, G.; Bach, F.-W.; Maier, H. J.; Drossel, W.-G.; Neugebauer, R.; Ahnert, M.; Broschwitz, E.; Kraus, C. (2013) Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen3. Fügetechnisches Gemeinschaftskolloquium
  • Reimche, Wilfried; Bruchwald, Oliver; Zwoch, Stefan; Bach, Friedrich-Wilhelm; Kolbusch, Rudolf (2013) Wirbelstrombasierte Unterwasser-Rissprüfung hochbeanspruchter Sohlverankerungslaschen in Wehranlagen4. Tagung Unterwassertechnik 2013
  • Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Bach, Fr.-W.; Maier, H. J.; Haverich, A.; Wriggers, P.; Hassel, T. (2013) Development of magnesium alloy scaffolds to support biological myocardial grafts - A finite element investigationInternational Conference on Biomedical Technology. European Community on Computational Methods in Applied Sciences (ECCOMAS). DFG SFB599. Hannover, 20.11.2013.
  • Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Hassel, T.; Haverich, A.; Wriggers, P. (2013) Finite element simulation of myocardial stabilizing structures and development of new designsBMT Kongress 2013. VDE MedTech. Deutsche Gesellschaft für Biomedizinische Technik (DGBMT). Graz, 19.09.2013.
  • Bauer, M.; Hassel, T.; Biskup, Ch.; Hartung, D.; Schilling, T.; Weidling, M.; Wriggers, P.; Bach, Fr.-W.; Haverich, A. (2012) Geometric adaption of resorbable myocardial stabilizing structures based on the magnesium alloys LA63 and ZEK100 for the support of myocardial grafts on the left ventricle46. DGBMT Jahrestagung, BMT 2012. VDE MedTech. Jena, 17.09.2012.
  • Bierbaum, M.; Varahram, A.; Hassel, T. (2012) Computerised analysis and optimisation of the MIAB-Welding process with the ANALYSATOR HANNOVERJoint Intermediate Meeting of IIW Comm.IV, XII and SG212. International Institute of Welding, IIW. Bundesanstalt für Materialprüfung, B. A.M. Berlin, 19.04.2012.
  • Birr, C. (2012) Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen2. Fügetechnisches Gemeinschaftskolloquium 2012. FOSTA-EFB-DVS-LWF. Paderborn, 04.12.2012.
  • Brandes, G.; Hinz, C.; Schilling, T.; Kaufeld, T.; Mogaldea, A.; Tudorache, I.; Cebotari, S.; Biskup, C.; Hassel, T.; Bauer, M.; Hilfiger, A.; Bach, Fr.-W.; Haverich, A. (2012) Histological analysis of decellularized aortic allografts stabilized by a surrounding magnesium clips following long-term implantation in sheepJahrestagung der Deutschen Gesellschaft für Biomaterialien (DGBMT) 2012. Deutsche Gesellschaft für Biomaterialien e. V., 01.11.2012.
  • Faßmann, D. (2012) In situ EBSD-Messungen bei Zugversuchen im RasterelektronenmikroskopDGM / DVM- Arbeitskreistreffen Mikrostrukturcharakterisierung im REM; Hannover, 04. & 05.06.2012, Hannover
  • Hinz, C.; Schilling, T.; Kaufeld, T.; Meyer, A.; Mogaldea, A.; Tudorache, I.; Cebotari, S.; Bach, Fr.-W.; Biskup, C.; Hassel, T.; Bauer, M.; Waldmann, K.-H.; Hilfiker, A.; Haverich, A. (2012) Degradable magnesium clips for the temporarily stabilization of biological decellularized aortic allografts78. Jahrestagung der Deutschen Gesellschaft für Kardiologie – Herz- und Kreislaufforschung e.V.; 11.-14.4.2012; Mannheim
  • Möller, F.; Swider, M. A.; Langohr, A.; Hassel, T.; Möhwald, K.; Bach, Fr.-W.; Vollertsen, F. (2012) Developments of brazing solder and processes for flux less joining of aluminum 65th Annual Assembly Commission XVII of the International Institute of Welding. International Institute Of Welding (IIW). IIW. Denver, Colorado, USA, 09.07.2012.
  • Nürnberger, F.; Grydin, O.; Milenin, A.; Yu, Z.; Schaper, M.; Pietrzyk, M. (2012) Hot Metal Forming and Quenching from Deformation Temperatures - Process Integrated Heat Treatment of Tempering SteelsMaterials Science & Technology 2012. ACerS, AIST ASM TMS NACE. Pittsburgh, Pennsylvania, USA, 07.10.2012.
  • Varahram, A. (2012) Casing connection method with improved Strength and Reliability for Monobore Wellbore ConstructionsCelle Drilling 2012. GeoEnergy Celle e.V. Celle, 17.09.2012
  • Dellinger, P. (2011) PVD-Schichttransplantation – hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-VeredelungDünnschicht Seminar der Universität Duisburg-Essen der Fakultät für Physik; 03.02.2011; Duisburg
  • Dellinger, P. (2011) Neuartige Entwicklungen zu Verschleißschutzschichten beim Um- und Urformen – von der Werkzeugbeschichtung zur Schichttransplantation auf das BauteilBeschichtung, Verschleißschutz und innovative Werkstoffe im Werkzeug- und Formenbau, Arbeitskreis: Werkzeug- und Formenbau, IPH
  • Faßmann, D. (2011) Untersuchung der duktilen Schädigungsentwicklung in ferritischem StahlZFM-Festkörpernachmittag 2011. Zentrum für Festkörperchemie und neue Materialien. Hannover, 15.07.2011
  • Hahn, O.; Bednorz, S.; Bach, Fr.-W.; Dellinger, P. (2011) Vollstanznietbeschichtungen für den Einsatz bei hochfesten StahlwerkstoffenGemeinsame Forschung in der Mechanischen Fügetechnik; 1. Fügetechnisches Gemeinschaftskolloquium; 6.-7.12.2011
  • Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011) Schichttransplantation - Prozessintegrierte Beschichtung von DruckgussteilenWerkstoff Forum - Intelligenter Leichtbau. Hannover Messe 2011
  • Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011) Transplantierte Funktionsschichten auf DruckgussteilenMaterials Café,. Hannover Messe 2011
  • Klöpfer, E.; Springub, B.; Masimov, M.; Gershteyn, G.; Nürnberger, F.; Bach, Fr.-W. (2011) Investigation of the HSD®-Steel with a modified concentration of the aluminum contentEuromat 2011. Montpellier, Frankreich, 12.-15. September. Online verfügbar unter http://euromat2011.fems.eu/wp-content/uploads/2011/09/2011-09-05_program_complete_4days.pdf.
  • Kussike, S.M. (2011) Entwicklung von Stabelektroden für das nasse Lichtbogenhandschweißen unter Wasser mittels Simulation von Tauchtiefen durch unbemannte DruckkammersystemeGemeinschaftsveranstaltung von GSI-Gesellschaft für Schweißtechnik, International mbH, Niederlassung SLV Hannover, Hannover, Germanischer Lloyd SE, Hamburg, und Deutscher Verband für Schweißen und verwandte Verfahren e. V., Düsseldorf
  • Varahram, A.; Srisupattarawanit, T.; Breidenstein, B.; Hassel, Th.; Schiefer, F.; Denkena, B.; Ostermeyer, G.-P.; Bach, Fr.-W. (2011) Design of Folded Tubulars for Expandable Casing ApplicationsCelle Drilling 2011, 13.09.2011, Celle
  • Birr, C. (2010) Surface zone modification by atmospheric plasma nitriding (APN) wirh the aid of the transmitted plasma-arc8th international conference - the coatings 2010. LFT. Erlangen, 15.04.2010
  • Freytag, P.; Kerber, K.; Otten, M.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010) Funktionsintegrierte Druckgussteile durch VerbundgussClausthaler Metallurgie-Kolloquium, 2010.
  • Hassel, T.; Jakob, H.; Bach, Fr.-W. (2010) Trockeneisstrahlverfahren - Möglichkeiten der Leistungssteigerung und Strahlprozessüberwachung "Stilllegungstechniken". KTG-AG. Würgassen, 16.11.2010.
  • Hassel, T.; Petersen, M.; Jakob, H.; Bach, Fr.-W. (2010) "INNO-CUT" - Innovative Lichtbogenverfahren für die Stilllegung und den Rückbau kerntechnischer Anlagen Hot-Wire-Plasmaschneiden und Lichtbogen-Sauerstoff-Impulsschneiden Stilllegungstechniken. BMBF. Greifswald, 01.06.2010.
  • Hoyer, P. (2010) Korrosionsuntersuchungen an Leichtmetallen Werkstoff-Forum "Intelligenter Leichtbau" Hannover Messe 2010. Hannover, 20.04.2010.
  • Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2010) Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen Workshop Korrosion und Korrosionsschutz von Magnesium. Lauenburg, 13.10.2010.
  • Kerber, K. (2010) Verbundguss von Aluminium- und MagnesiumlegierungenWerkstoff Forum - Intelligenter Leichtbau. Hannover Messe
  • Reimche, W.; Bach, Fr.-W. (2010) Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren. Dortmund, 11.11.2010.
  • Bach, Fr.-W.; Bormann, D.; Kerber, K. (2009) Mg-Verbundguss für intelligente BauteileMesse Euromold 2009. DGM Forum Werkstoffe. DEMAT GmbH. Frankfurt, 03.12.2009.
  • Behrens, S.; Jendras, M.; Bach, F.-W. (2009) Corrosion behaviour of magnesium and its alloys examined by means of ICP-OESDGM Tagung „Magnesium Alloys and their Applications“, Weimar, 26.-29.10.2009
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2009) Verschleißschutzoberflächen für Präzisions-UmformwerkzeugeOberflächentag (Hannover-Messe)
  • Engelhardt, M.; Bormann, D.; Haverkamp, H.; Plorin, T.; Klose, C.; Gershteyn, G.; Bach, Fr.-W. (2009) Werkstoffkundliche Analyse der Prozesskombination konventioneller und dynamischer UmformverfahrenWorkshop Impulsumformung, S. 1-19. Dortmund, 12.03.2009.
  • Kerber, K. (2009) Verbundguss von Aluminium- und Magnesiumlegierungen durch DruckgussAachener Absolventen- und Doktorandenseminar der Gießereitechnik, 2009
  • Mroz, G.; Reimche, W.; Bach, Fr.-W. (2009) Gentelligente Bauteilidentifikation und Integritätsbewertung9. Luft- und Raumfahrtseminar, 24. und 25. Nov. 2009
  • Reimche, W.; Bach, Fr.-W. (2009) Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren10.-12.11.2009.
  • Reimche, W.; Bernard, M.; Scheer, C.; Böhm, V.; Bombosch, S.; Bach, Fr.-W. (2009) Frühzeitige zerstörungsfreie Erkennung und Klassifizierung von Getriebeschäden: DGZfP Arbeitskreis ZWICKAU-CHEMNITZ, Westsächsische Hochschule Zwickau (FH) Technikum II, 27. Januar 2009DGZfP Arbeitskreis ZWICKAU-CHEMNITZ, Westsächsische Hochschule Zwickau (FH) Technikum II, 27. Januar 2009.
  • Rückert, R.; Krink, V.; Kremer, G.; Madeja, K. (2008) Das Hot-Wire-Plasmaschneiden - eine vielseitiges Verfahren mit indirektem Lichtbogen zum Schneiden nichtleitender und problematischer Werkstoffe und WerkstoffkombinationenDie Verbindungs-Spezialisten 2008, Große Schweißtechnische Tagung 17.-19.09.08 in Dresden; Düsseldorf: DVS Media (DVS-Berichte, 250; S. 197-198)
  • Bach, Fr.-W.; Kremer, G. (2007) Trenntechnologie - eine wissenschaftliche und wirtschaftliche Herausforderung85 Jahre Kjellberg Finsterwalde - Pionier des Plasmaschneidens seit 1959. Finsterwalde, 20.09.2007.
  • Kremer, G.; Hildebrandt, B.; Wolter, M.; Salopek, Z. (2007) Welding and cutting gases - influence on the values of pollutantsWELDING & MATERIALS, Technical, Economical and Ecological Aspects. Cavtat & Dubrovnik, Croatia, 05.07.2007
  • Reimche, W.; Bach, Fr.-W. (2007) Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren, DortmundDortmund, 13.-15. Nov. 2007.
  • Springer, R.; Gershteyn, G.; Schaper, M. (2007) Numerical simulation of microstructure evolution during martensitic phase transformation of quenchenable high strength steelsAPCOM’07 in conjunction with EPMESC XI. Kyoto, Japan, 3.-06.12.2007.
  • Bach, Fr.-W.; Biskup, C.; Kremer, G.; Kirsch, L.; Schmolke, S. (2006) P88 Möglichkeiten und Grenzen der Wasserstrahltechnik zur Bearbeitung von spongiösem HartgewebeInstitut für Werkstoffkunde, Universität Hannover; Medizinische Hochschule Hannover, Orthopädische Klinik; Orthopädisches Rehabilitationszentrum Annastift e.V., Orthopädische Klinik, 2006.
  • Bach, Fr.-W.; Holländer, U.; Kruzhanov, V.; Möhwald, K.; Nicolaus, M. (2006) Formation of columnar microstructure when brazing steels of different carbon content with copper filler metal - a thermodynamic modelHannover-Messe 2006, Werkstoffforum: CD, 2006.
  • Bormann, D.; Krause, C. (2006) Characterization of Implant Materials by Micro-CTWorkshop der FoGr 548 "Polysialinsäure Biomaterials - Synthesis Processing and Biological Evaluation", 29.03.2006
  • Bach, Fr.-W.; Brüggemann, P.; Schenk, A. (2005) Water Jet Cutting and Dry Ice Blasting as Tools in the Automotive Industry,2005
  • Bach, Fr.-W.; Nürnberger, F.; Schaper, M. (2004) Gefügemodellierung beim Abschreckhärten mittels Spraykühlung.Werkstoffwoche. {DKG, DGM und VDI}. München, 21.-23.09.2004. Weitere Informationen
  • Lass, J. F.; Müller, K.; Schmidt, I.; Grydin, O. (2004) Einfluss einer Vorkammer und der Prozessparameter beim Strangpressen von Magnesium anhand einer AZ31Werkstoffwoche. München, 21.09.2004.
  • Versemann, R. (2004) Wasserhydraulik im Einsatz für den kerntechnischen Rückbau Wasserhydraulik. Frankfurt/Main, 18.11.2004.
  • Bach, Fr.-W.; Kruzhanov, V.; Möhwald, K.; Zeitz, V. (2000) Joining of metal foams using foamable filler metalsProceedings of materials week 2000, 25-28 Sept. 2000, Munich, 2000.

Konferenz

  • Acar, S.; Gerstein, G.; Herbst, S.; Lorenz, U.; Malik, I. Y.; Behrens, B.-A. (2019) Characterization of a modified hot-working steel with increased wear resistanceIn: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P63
  • Acar, S.; Gerstein, G.; Nürnberger, F.; Cui, C.; Schulz, A.; Steinbacher, M.; Wunde, M.; Kurzynski, J. (2019) Deep Cryogenic Treatment of X153CrMoV12 Cold-work Tool SteelIn: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P31
  • Acar, S.; Golovko, O.; Swider, M. A.; Nürnberger, F.; Siegmund, M.; Puppa, J.; Chugreev, A.; Behrens, B.-A. (2019) Influence of Increased Manganese Content on the Precipitation Behaviour of AISI H10 in Thermomechanical Fatigue TestsIn: WGP (Hrsg.): WGP Kongress 2019. Hamburg. 29.09.-02.10.2019, S. 189-197
  • Behrens, B.-A.; Puppa, J.; Acar, S.; Gerstein, G.; Nürnberger, F.; Lorenz, U. (2019) Development of an intelligent hot-working steel to increase the tool wear resistanceIn: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P64
  • Alfred, I.; Nicolaus, M.; Hermsdorf, J.; Kaierle, S.; Möhwald, K.; Maier, H.-J.; Wesling, V. (2018) Advanced high pressure turbine blade repair technologiesIn: 10th CIRP Conference on Photonic Technologies (LANE 2018), Procedia CIRP 74, 2018, S. 214-217
    DOI: 10.1016/j.procir.2018.08.097
  • Barton, S.; Bruchwald, O.; Frackowiak, W.; Bongartz, B.; Reimche, W.; Zaremba, D. (2018) Entwicklung einer Bainit-Sensortechnik zur Charakterisierung gradierter Gefügeausbildungen in der Bauteil-Rand und KernzoneIn: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
  • Behrens, B.-A.; Chugreev, A.; Matthias, T.; Nothdurft, S.; Hermsdorf, J.; Kaierle, S.; Ohrdes, H.; Twiefel, J.; Wallaschek, J.; Mildebrath, M.; Hassel, T. (2018) Investigation of the composite strength of hybrid steel-steel semi-finished products manufactured by laser beam welding and friction weldingIn: 5th International Conference Recent Trends in Structural Materials, COMAT2018. Pilsen, Czech Rep. 14.11.-16.11.2018. IOP Conf. Ser.: Mater. Sci. Eng. 461, 2018, S. 12049
    DOI: 10.1088/1757-899X/461/1/012049
  • Behrens, B.-A.; Klose, C.; Chugreev, A.; Thürer, S. E.; Uhe, J. (2018) Numerical investigations on the lateral angular co-extrusion of aluminium and steelIn: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 30001
    DOI: 10.1063/1.5034844
  • Besserer, H.-B.; Rodman, D. (2018) Micro-Scale Residual Stress Measurement Using Focused Ion Beam Techniques and Digital Image CorrelationIn: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 32
  • Brätz, O.; Henkel, K.-M.; Klett, J.; Hassel, T. (2018) Anwendung der Induktion für schweißtechnische Erwärmung beim nassen Lichtbogenhandschweißen unter WasserIn: 2. Kolloquium Induktionserwärmung in der Schweißtechnischen Fertigung. Halle. 17.10.2018
  • Brätz, O.; Henkel, K.-M.; Schmidt, E.; Hassel, T. (2018) Halbnasses Lichtbogenbolzenschweißen großer Dimensionen mit Hubzündung im UnterwasserbereichIn: DVS Berichte Band 344. DVS Congress 2018. DVS Media GmbH, Düsseldorf, S. 420-427
  • Denkena, B.; Mücke, A.; Schumacher, T.; Langen, D.; Grove, T.; Bergmann, B.; Hassel, T. (2018) Ball end milling of titanium TIG weld material and the effect of SiC addition – process forces and shape deviations6th International Conference on Through-life Engineering Services, Bremen, 7.11.-8.11.2017. Procedia Manufacturing 19, 2018, 74-81
    DOI: 10.1016/j.promfg.2018.01.011
  • Denkena, B.; Mücke, A.; Schumacher, T.; Langen, D.; Hassel, T. (2018) Technology-based re-contouring of blade integrated disks after weld repairIn: Proceedings of the ASME Turbo Expo 2018. Oslo, Norway. 11.06.-15.06.2018
  • Eftifeeva A., Panchenko E., Chumlyakov Y., Gerstein G., Maier H. J. (2018) The effects of stress-induced martensite ageing on shape memory behavior in Co35Ni35Al30 single crystalsESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Firstov G., Kosorukova T., Timoshevskii A., Koval Yu., Odnosum V., Matviychuk Yu., Gerstein G., Maier H. J. (2018) Strategies for high entropy shape memory alloy design - from motivation to structure and propertiesESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Frackowiak, W., Barton, S., Bruchwald, O., Reimche, W., Zaremba, D. (2018) Entwicklung einer Hochfrequenz-Induktionsthermografie und -Wirbelstromtechnik zur Fehlerprüfung und Charakterisierung der Schichtsysteme von Triebwerksbeschaufelung im SchaufelkanalIn: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
  • Frackowiak, W.; Barton, S.; Reimche, W.; Bruchwald, O.; Zaremba, D.; Schlobohm, J.; Li, Y.; Kaestner, M.; Reithmeier, E. (2018) Near-Wing Multi-Sensor Diagnostics of Jet Engine ComponentsIn: American Society of Mechanical Engineers (ASME) (Hrsg.): ASME Turbo Expo 2018: Turbomachinery Technical Conference and Exposition. Oslo, Norway. 11.06.-15.06.2018, V006T05A026
    ISBN: 978-0-7918-5112-8
  • Gerstein, G.; Briukhanov, A.; Gutknecht, F.; Volchok, N.; Clausmeyer, T.; Nürnberger, F.; Tekkaya, A. E.; Maier, H. J. (2018) Evaluation of micro-damage by acoustic methodsIn: 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan, 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 527-534
    DOI: 10.1016/j.promfg.2018.07.273
  • Golovko, O. M.; Frolov, Y. V.; Andreiev, V. V.; Klose, C.; Nürnberger F. (2018) Manufacturing of seamless tubes of the alloy Al-5Mg-0,2Sc by direct extrusion and sink drawingIn: Materials Science and Engineering, MSE 2018. European Congress and Exhibition on Advanced Materials and Processes. Darmstadt. 26-28.09.2018
  • Gutknecht, F.; Gerstein, G.; Traphöner, H.; Clausmeyer, T.; Nürnberger, F. (2018) Experimental setup to characterize flow-induced anisotropy of sheet metalsIn: IOP Conf. Series: Materials Science and Engineering 418. International Deep Drawing Research Group 37th Annual Conference. Waterloo, Kanada. 03.06.-07.06.2018, S. 12085
    DOI: 10.1088/1757-899X/418/1/012085
  • Hassel, T.; Klimov, G.; Beniyash, A. (2018) Beam extraction using non vacuum electron beam by reduced acceleration voltageJournal of Physics: Conference Series 1109, 2018 Weitere Informationen
    DOI: 10.1088/1742-6596/1109/1/011001
  • Herbst, S.; Nürnberger, F. (2018) Chracterization of Heat Transfer in Complex Air-Water Spray Quenching Set-UpsIn: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 21
  • Hordych, I.; Bild, K.; Boiarkin, V.; Rodman, D.; Nürnberger, F. (2018) Phase transformations in a boron-alloyed steel at high heating ratesIn: Mori, K.-I.; Abe, Y.; Maeno, T. (Hrsg.): Proceedings of the 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan. 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 1062-1070
    DOI: 10.1016/j.promfg.2018.07.386
  • Hordych, I.; Rodman, D.; Nürnberger, F.; Schmidt, H. C.; Orive, A. G.; Homberg, W.; Grundmeier, G.; Maier, H. J. (2018) Influence of heat-pretreatments on the microstructural and mechanical properties of galfan-coated metal bondsIn: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 40007
    DOI: 10.1063/1.5034861
  • Klett, J.; Hassel, T. (2018) Schweißen unter Wasser als Fertigungs- und Reparaturverfahren, und was der Werkstoff dazu sagtIn: 22. Kolloquium Reparaturschweißen. Halle (Saale), 2018, S. 37-42
  • Klimov, G.; Maier, H-J.; Beniyash, A.; Hassel, T.; (2018) Fluxless Brazing of aluminum alloys using non vacuum electron beam by 60kV acceleration voltageJournal of Physics: Conference Series 1109, 2018 Weitere Informationen
    DOI: 10.1088/1742-6596/1109/1/011001
  • Krooß, P.; Lauhoff, C.; Paulsen, A.; Frenzel, J.; Somsen, C.; Langenkämper, D.; Reul, A.; Schmahl, W.; Karsten, E.; Maier, H.; Niendorf, T. (2018) Effect of the heating-cooling rate on the functional properties of Ti-Ta-Al HT-SMAsESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Krüger, A. K.; Julmi, S.; Klose, C.; Besdo, S.; Maier, H. J.; Wriggers, P. (2018) Simulation of bone ingrowth into bone substitutes on implant level length scaleIn: 89th Annual Meeting of the International Association of Applied Mathematics and Mechanics (GAMM). München. 19.3.- 23.3.2018, Proc. Appl. Math. Mech. 18, 2018 (1), e201800297
    DOI: 10.1002/pamm.201800297
  • Langenkämper, D.; Paulsen, A.; Somsen, C.; Frenzel, J.; Karsten, E.; Maier, H. J.; Eggeler, G. (2018) Synchrotron radiation and transmission electron microscopy investigations on the formation and dissolution temperatures of the w -phase in Ti-Ta high temperature shape memory alloysESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Nothdurft, S.; Ohrdes, H.; Twiefel, J.; Wallaschek, J.; Mildebrath, M.; Maier, H. J.; Hassel, T.; Overmeyer, L.; Kaierle, S. (2018) Influence of ultrasonic amplitude and position in the vibration distribution on the microstructure of a laser welded aluminum alloyIn: International Congress on Applications of Lasers & Electro-Optics, ICALEO 2018. Orlando, Fl. USA. 14.10.-18.10.2018
  • Panchenko E., Timofeeva E. E., Chumlyakov Y. I., Osipovich K. S., Larchenkova N. G., Pichkaleva M. V., Tokhmetova A. B., Gerstein G., Maier H. J. (2018) Stress-induced martensite ageing in single crystals of Ni-based Heusler alloy: processing, effect of orientation and functional propertiesESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Reich, M.; Schumacher, P.; Klett, J.; Hassel, T.; Khazan, P.; Keßler, O. (2018) Entwicklung eines numerischen Simulationsmodells für das nasse Unterwasserschweißen von höherfesten SpundwandstählenIn: Schafstall, H.; Wohlmuth, M. (Hrsg.): Tagungsband 19. RoundTable Simulating Manufacturing. Marburg, 16.05. -17.05.2018. Simufact Engineering GmbH, Hamburg, S. 122-132
  • Schmidt, H. C.; Homberg, W.; Orive, A. G.; Grundmeier, G.; Hordych, I.; Maier, H. J. (2018) Cold pressure welding of aluminium-steel blanks: Manufacturing process and electrochemical surface preparationIn: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 50007
    DOI: 10.1063/1.5034880
  • Schöler, S.; Yilkiran, D.; Wulff, D.; Özkaya, F.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2018) Selective oxidation of tool steel surfaces under a protective gas atmosphere using inductive heat treatmentIn: Vollertsen, F. et al. (Hrsg.): 5th International Conference on New Forming Technology, ICNFT 2018. Bremen, 18.09.-21.09.18. MATEC Web Conf. 190, 2018, S. 14003
    DOI: 10.1051/matecconf/201819014003
  • Siegmund, M.; Golovko, O.; Puppa, J.; Chugreev, A.; Nürnberger, F.; Behrens, B. A. (2018) Effect of Manganese on Nitriding and Softening Behaviour of Steel AISI H10 Under Cyclic Thermal LoadsIn: Schmitt, R.; Schuh, G. (Hrsg.): Advances in Production Research. WGP 2018. Aachen. 19.11.-20.11.2018, S. 423-432
    DOI: 10.1007/978-3-030-03451-1_42
  • Timofeeva, E.; Panchenko, E.Yu.; Larchenkova, N.G.; Chumlyakov, Yu.I.; Maier, H.J. (2018) Two-way shape memory effect in [001]-oriented Ni49Fe18Ga27Co6 single crystalsESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
  • Barroi, A.; Mildebrath, M.; Hassel, T.; Hermsdorf, J.; Kaierle, S.; Maier, H. J.; Overmeyer, L. (2017) Erzeugung hybrider Umformhalbzeuge durch Auftragschweißen und Evaluierung der Fügezone vor und nach dem UmformenIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 195
  • Bauer, M.; Brand, S.; Schrader, J.; Krettek, C.; Maier, H. J.; Hassel, T. (2017) Local stress investigation of periprosthetic fractures by total hip replacement - a finite element analysisBMTMedPhys 2017. Poster session 11: Modelling and simulation I. Dresden, 10.09. - 13.09.2017, S. 152
    DOI: 10.1515/bmt-2017-5032
  • Bauer, M.; Grünzel, O.; Maier, H. J.; Hassel, T. (2017) Full automatization of waterjet cuttingWJTA-IMCA Conference & Expo 2017. New Orleans. 24.-27.10.2017
  • Behrens, B. A.; Maier, H. J.; Hübner, S.; Bonk, C.; Almohallami, A.; Lummer, C.; Schein, P.; Scheland, H.; Micke, M. (2017) Wear Behavior of MoS2 Lubricant Layers During Sheet Metal FormingIn: Proceedings of the 17th International Conference on Sheet Metal SHEMET17, Procedia Engineering 183, 357-362
  • Behrens, B.-A.; Bouguecha, A.; Moritz, J.; Bonk, C.; Stonis, M.; Klose, C.; Blohm, T.; Chugreeva, A.; Duran, D.; Matthias, T.; Golovko, O.; Thürer, S. E.; Uhe, J. (2017) Aktuelle Forschungsschwerpunkte in der MassivumformungIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017. TEWISS, Garbsen, 2017, S. 15-32
  • Behrens, B.-A.; Hübner, S.; Jalanesh, M.; Sezek, O.; Yarcu, S.; Gümüsoluk T., Spiekemeier, A.; Rodman, D.; Golovko, O.; Gerstein, G.:  (2017) Clinchen für Anwendungen mit zyklisch thermischer und mechanischer BelastungIn: Gemeinsame Forschung in der Mechanischen Fügetechnik. Tagungsunterlagen des 7. Fügetechnischen Gemeinschaftskolloquiums. Dresden. 12-13 Dezember, 2017, S. 91-96
  • Besserer, H.-B.; Rodman, D. (2017) Fatigue Behavior of Sheet-Bulk Metal Formed ComponentsIn: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 859–864
    DOI: 10.7449/2017/MST_2017_859_864
  • Besserer, H.-B.; Rodman, D.; Nürnberger, F. (2017) Ermüdungsverhalten blechmassivumgeformter BauteileIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 221
  • Boeddeker, T.; Chergui, A.; Ivanjiko, M.; Gili, F.; Behrens, S.; Runkel, D.; Mašek, M. (2017) JoiningTWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologies7. Fügetechnisches Gemeinschaftskolloquium, EFB, FOSTA und DVS Forschung, 12.-13.12.2017
  • Boiarkin, V. V.; Nürnberger, F.; Ashkelyanets, A. V.; Golovko, O.; Hordych, I.; Rodman, D.; Remez, O. A. (2017) Modernization Of An Electric-Weld Plant For Performing Combined Roll Forming And Heat-Treatment ProcessesIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 28
  • Brätz, O.; Henkel, K.-M.; Klett, J.; Hassel, T. (2017) Qualifizierung des Unterwasserbolzenschweißens für M16/M24In: Unterwassertechnik. Vorträge der gleichnamigen 6. Fachtagung in Hamburg, 14.-15.11.2017. DVS-Berichte Band 338, DVS Media GmbH, Düsseldorf, 2017, S. 25-31
    ISBN: 978-3-96144-012-2
  • Demler, E., Gerstein, G., Dalinger A., Epishin, A., Nürnberger, F., Maier, H. J. (2017) Influence of high-current-density impulses on the plasticity of single crystal nickel-based super alloy CMSX-4In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
  • Demler, E.; Gerstein, G.; Dalinger, A.; Nürnberger, F.; Molodov, D. A.; Epishin, A. (2017) Methodical procedure for investigating the influence of electric impulses on the deformation behavior of the single crystal nickel-based alloy CMSX-4 and dynamics of grain boundaries in aluminum bicrystalsIn: Bannykh, O. A. (Hrsg.): VII international conference „Deformation and destruction of materials and nanomaterials“. Moskau. 7.-10.11.2017. IMET RAN, Moskau, 2017, S. 57-58
  • Demminger, C.; Klose, C. (2017) Mechanical Properties and Fatigue Strength of Extruded Cobalt-Containing Magnetic Magnesium AlloysIn: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 537-542
    DOI: 10.1007/978-3-319-52392-7_74
  • Eifler, R.; Schäfke, F.; Maier, H. J.; Klose, C. (2017) Biocompatible Magnesium Alloy ZNdK100 - Adaptation of Extrusion Parameters to Tailor the Mechanical Properties to Different Implant ApplicationsIn: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 323-327
    DOI: 10.1007/978-3-319-52392-7_46
  • Folgar, R. H.; Böddeker, T.; Chergui, A.; Ivanjko, M.; Gili, F.; Behrens, S. (2017) Joining TWIP-Steel Simulation ModelsIn: Procedia Structural Integrity, International Conference on Structural Integrity, ICSI 2017, 04.-07.09.2017, S. 516–523
    DOI: 10.1016/j.prostr.2017.07.154
  • Frolov Ya., Nürnberger F., Wolf L., Golovko O. (2017) Water-Air Spray Cooling At Heat Treatment Of Cylindrical SamplesIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 13
  • Frolov, Ya. V.; Schaper, M.; Andreev, A. K.; Golovko, O. M.; Grydin, O. Yu.; Samsonenko, A. A.; Stolbchenko M. Y. (2017) Fem Analysis Of Multilayer And Polygonal Pipes Designed For Subsea Umbilical PipelinesIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 10
  • Frolov, Ya., Stolbchenko, M., Andreiev, A., Golovko, O., Grydin, O., Shaper, M., Samsonenko, A. (2017) FEM analysis of multilayer pipes designed for subsea umbilicalsIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 159-171
  • Gerstein, G.; Clausmeyer, T.; Gutknecht, F.; Tekkaya, A. E.; Nürnberger, F. (2017) Analysis of Dislocation Structures in Ferritic and Dual Phase Steels Regarding Continuous and Discontinuous Loading Paths. In: The Minerals, Metals & Materials Society TMS (Hrsg.): TMS 2017. 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer, Cham, Switzerland, 2017, S. 203-210
    DOI: 10.1007/978-3-319-51493-2_20
  • Golovko, O.; Puppa, J.; Paschke, H.; Nürnberger, F.; Rodman, D.; Maier, H. J.; Behrens, B.-A. (2017) Properties Of An Intelligent Hot-Working Tool Steel With Alloy Adapted Nitriding LayersIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 49
  • Grydin, O.; Nürnberger, F.; Schaper, M. (2017) Influence of Sticking on the Roll Topography at Twin-Roll Casting of Aluminum Alloys.In: Ratvik, A. P. (Hrsg.): Light metals 2017, The Minerals, Metals & Materials Society (TMS). San Diego. 26.02. - 02.03.17. Springer, Cham, Switzerland, 2017, S. 827-831
    DOI: 10.1007/978-3-319-51541-0_100
  • Gutknecht, F.; Isik, K.; Clausmeyer, T.; Tekkaya, A. E.; Gerstein, G.; Nürnberger, F. (2017) Vorhersage von Schädigung in der BlechmassivumformungIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 220
  • Hassel, T.; Bauer, M.; Köhler, A. (2017) Development of the generic ENCON container concept based on the aspects of the three ENTRIA optionsFinal ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 166
  • Hassel, T.; Bauer, M.; Köhler, A. (2017) Technical concepts for maintenance and repair of HLW-storage containers in the framework of long-term-interim storageFinal ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 156
  • Hassel, T.; Hocke, P.; Köhler, A.; Bauer, M. (2017) Monitoring in the deep geological disposal - Technical and social requirements for implementing monitoring of HLW containersFinal ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 56
  • Hassel, T.; Köhler, A.; Bauer, M. (2017) Long term monitoring of the technical barrier in deep geological disposalFinal ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 168
  • Hassel, T.; Köhler, A.; Bauer, M.; Poenitz, E.; Walther, C. (2017) Handling techniques for HLW retrieval considering the influence of generic container conceptsFinal ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 74
  • Heitzmann, P.; Zaremba, D.; Dittmar, H.; Hassel, T.; Overmeyer, L. (2017) Automatable splicing method for steel cord conveyor belts - Finding a suitable preparation processIn: AST 2017 – Scientific Symposium on Automated Systems and Technologies. St. Petersburg, Russland. 14.06.-15.06.2017, S. 17-24
  • Herbst, S.; Nürnberger, F. (2017) Heat Treatment of Steel-Aluminum Hybrid ComponentsIn: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 53-60
    DOI: 10.7449/2017/MST_2017_53_60
  • Herbst, S.; Nürnberger, F. (2017) Heat Treatment of Steel-Aluminium Tailored Forming-ComponentsIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
  • Herbst, S.; Nürnberger, F. (2017) Wärmebehandlung für belastungsangepasste Werkstoffeigenschaften von Tailored Forming-KomponentenIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 193
  • Hordych, I.; Boiarkin, V.; Rodman, D.; Nürnberger, F. (2017) Manufacturing of tailored tubes with a process integrated heat treatmentIn: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 190003
    DOI: 10.1063/1.5008216
  • Hordych, I.; Hoppe, C.; Nürnberger, F.; Grundmeier, G.; Schmidt, H. C.; Homberg, W.; Rodman, D.; Rodman, M. (2017) Heat-Treatment Of Coated Steel Sheets Before And After A Cold Roll Bonding ProcessIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
  • Jalanesh, M.; Golovko, O.; Gerstein, G.; Hübsch, C.; Hübner, S.; Yarcu, S.; Sezek, O.; Behrens, B.-A.; Rodman, D.; Maier, H. J. (2017) Properties Of Clinched Stainless Steel Sheets As A Result Of Thermal LoadingIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
  • Julmi S., Klose C., Krüger A.-K., Wriggers P., Maier H.J. (2017) Development of Sponge Structure and Casting Conditions for Absorbable Magnesium Bone ImplantsIn: TMS 2017 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer International Publishing; Springer, Cham, 2017, S. 307-317
    DOI: 10.1007/978-3-319-51493-2_29
  • Klümper-Westkamp, H.; Vetterlein, J.; Zoch, H.-W.; Reimche, W.; Bruchwald, O.; Maier, H. J. (2017) New bainite sensor technology allows for a detailed view on material transformationProceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 133-140
  • Krüger, A. K.; Julmi, S.; Klose, C.; Besdo, S.; Wriggers, P. (2017) Simulation of the change in Mechanical Properties of Degradable Bone ImplantsIn: Proceedings of the 7th GACM Colloquium on Computational Mechanics for Young Scientists from Academia and Industry. Stuttgart. 11.10.- 13.10.2017
  • Mozgova, I.; Barton, S.; Demminger, C.; Miebach, T.; Taptimthong, P.; Lachmayer, R.; Nyhuis, P.; Reimche, W.; Wurz, M. C. (2017) Technical inheritance: Information basis for the identification and development of product generationsIn: Maier, A. et al. (Hrsg.): Proceedings of the 21st International Conference on Engineering Design (ICED17). Vol 6: Design Information and Knowledge. 21.08.-25.08.2017, Vancouver, Canada, S. 91-100
  • Munk, L.; Reschka, S.; Löhnert, S.; Wriggers, P. (2017) Modeling of nickel-based superalloys in a crystal plasticity frameworkIn: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, 2017, S. 121
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017) Regeneration of High Pressure Turbine Blades. Development of a Hybrid Brazing and Aluminizing Process by means of Thermal SprayingThe 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 72-76
    DOI: 10.1016/j.procir.2016.09.041
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017) Heat treatment of the thermally sprayed coating system NiCrSi/NiCoCrAlY/Al for repair brazing high pressure turbine bladesIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 462-466
  • Nothdurft, S.; Springer, A.; Kaierle, S.; Mildebrath, M.; Hassel, T.; Maier, H. J.; Ohrdes, H.; Wallaschek, J.; Overmayer, L. (2017) Fügezonenbeeinflussung beim Laserstrahlschweißen von Stahl-Aluminium- Mischverbindungen zur Verbesserung der UmformeigenschaftenIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 194
  • Nothdurft, S.; Springer, A.; Kaierle, S.; Mildebrath, M.; Hassel, T.; Ohrdes, H.; Wallaschek, J. (2017) Beeinflussung des Schmelzbades von Mischverbindungen im Laserstrahl-schweißprozess durch Ultraschall.In: Fortschrittsberichte der Materialforschung und Werkstofftechnik, Tagungsband 2. Niedersächsisches Symposium Materialtechnik. Shaker, Herzogenrath, 2017, S. 259-268
  • Nothdurft, S.; Springer, A.; Kaierle, S.; Mildebrath, M.; Maier, H. J.; Hassel, T.; Ohrdes, H.; Twiefel, J.; Wallaschek, J.; Overmeyer, L. (2017) Influence of beam position and ultrasonic amplitude on the micro-structure of laser welded dissimilar steel-steel jointsIn: 36th International Congress on Applications of Lasers & Electro-Optics - ICALEO® 2017. Atlanta, 22.10.-26.10.2017
  • Nürnberger, F.; Gretzki, T.; Wolf, L.; Frolov, Y.; Golovko, O. (2017) Changes of the metal temperature at the axial water-air cooling of cylindrical samplesIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 32-38
  • Nürnberger, F.; Gretzki, T.; Wolf, L.; Frolov, Y.; Golovko, O. (2017) Change of metal temperature at heat treatment with water-air spray coolingIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 27-31
  • Otten, M. (2017) Untersuchung der Serientauglichkeit des SchichttransplantationsprozessesDeutscher Gießereitag 2017, Posterbeitrag, Düsseldorf, 17. - 18.05.2017
  • Pape, F.; Coors, T.; Barroi, A.; Hermsdorf, J.; Mildebrath, M.; Hassel, T.; Kaierle, S.; Matthias, T.; Bonk, C.; Chugreeva, A.; Bonhage, M.; Bouguecha, A.; Behrens, B.-A.; Overmeyer L.; Poll, G. (2017) Tribological Investigations on Tailored Formed Axial Bearing WashersIn: 6th World Tribology Congress. Beijing, China. 17.09.-22.09.2017
  • Reimche, W.; Bruchwald, O.; Barton, S.; Maier, H. J.; Klümper-Westkamp, H.; Zoch, H.-W. (2017) Inline application of bainite sensor technology for characterizing phase transformation during coolingProceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 141-150
  • Reschka, S.; Munk, L.; Rodman, D.; Nürnberger, F. (2017) Data acquisition for stress analysis by Digital Image Correlation of nickel-based superalloys under tensile load at high temperaturesIn: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, S. 38
  • Rodman, D.; Demler, E.; Rodman, M.; Gerstein, G.; Briukhanov, A. A.; Grydin, O.; Klose, C.; Nürnberger, F. (2017) Investigation Of The Sign-Variable Low-Cyclic Bending Deformation Influence On Sheet Properties Of Materials With A Hexagonal Crystal LatticeIn: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 47
  • Rodriguez Diaz, M.; Knödler, P.; Otten, M.; Möhwald, K.; Freiburg, D.; Kersting, P.; Biermann, D. (2017) Enhanced corrosion resistance of magnesium alloys by transplantation of thermally sprayed coatingsIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 665–668
  • Rodriguez Diaz, M.; Möhwald, K.; Loftfield, N.; Kästner, M.; Reithmeier, E.; Knigge, S.; Glasmacher, B.; Maier, H. J. (2017) Transpiring thermally sprayed alumina layers with integrated fluid flow tubesIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 47-50
  • Schlobohm, J.; Bruchwald, O.; Frąckowiak, W.; Li, Y.; Kästner, M.; Pösch, A.; Reimche, W.; Maier, H. J.; Reithmeier, E. (2017) Advanced characterization techniques for turbine blade wear and damageThe 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 83-88
    DOI: 10.1016/j.procir.2016.09.005
  • Schmieding, M.; Holländer, U.; Möhwald, K. (2017) Development of a Cu-Sn based brazing system with a low brazing and a high remelting 19th Chemnitz Seminar on Materials Engineering, IOP Conf. Ser.: Mater. Sci. Eng. 181, 2017, 12005
    DOI: 10.1088/1757-899X/181/1/012005
  • Schumacher, P.; Klett, J.; Reich, M.; Hassel, T.; Keßler, O. H. (2017) Herausforderungen bei der numerischen Simulation des nassen UnterwasserschweißensIn: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 47-53
  • Schumacher, P.; Reich, M.; Keßler, O. H.; Klett, J.; Hassel, T. (2017) Beitrag zur Finite-Elemente-Modellierung des nassen UnterwasserschweißensIn: Schafstall, H.; Wohlmuth, M. (Hrsg.): 18. RoundTable Simulating Manufacturing. Tagungsband 30. Mai - 1. Juni 2017, Marburg. Simufact Engineering GmbH, Hamburg, 2017, S. 225-239
  • Thürer, S. E.; Golovko, O.; Bonk, C.; Behrens, B.-A.; Bouguecha, A.; Klose, C.; Uhe, J. (2017) Einfluss der lokalen Mikrostruktur auf die Umformbarkeit stranggepresster WerkstoffverbundeIn: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 192
  • Thürer, S. E.; Uhe, J.; Golovko, O.; Bonk, C.; Bouguecha, A.; Klose, C.; Behrens, B.-A.; Maier, H. J. (2017) Co-extrusion of semi-finished aluminium-steel compoundsIn: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 140002
    DOI: 10.1063/1.5008158
  • Wolf, L. O.; Rodman, D.; Nürnberger, F.; Cordebois, J.-P.; Maier, H. J. (2017) Intercritical Annealing – New Heat Treatment Strategies for Tailoring the Stress-Strain Behavior of 22MnB5In: Oldenburg, M.; Prakash, B.; Steinhoff, K. (Hrsg.): Hot Sheet Metal Forming of High-Performance Steel CHS2. 6th International Conference, 4-7 June 2017, Atlanta, GA., USA. Verlag Wissenschaftliche Scripten, Auerbach, 2017, S. 433-440
  • Wulff, D.; Bornmann, B.; Wagner, R.; Holländer, U.; Lützenkirchen-Hecht, D.; Möhwald, K.; Frahm, R.; Maier, H. J. (2017) In-situ examination of Cr-Ni steel surfaces heat treated under N2 by GIXRDIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 13th DELTA User Meeting & Annual Report 2017. Dortmund. 29.11.2017, S. 27-28
  • Aldag, D.; Varahram, A.; Lehr, J.; Maier, H.; Hassel, T. (2016) Fügen von Casingsegmenten mit dem MIAB-Schweißverfahren für die Anwendung am BohrturmIn: DGMK/ÖGEW-Frühjahrstagung des Fachbereiches Aufsuchung und Gewinnung am 21. und 22. April 2016 in Celle. Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle e.V, Hamburg, 2016, S. 139-148
  • Barton, S.; Mroz, G.; Reimche, W.; Maier, H. J. (2016) Inherent Load Measurement and Component Identification by multi-dimensional Coded Data in the Component's Subsurface RegionIn: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 537-543
    DOI: 10.1016/j.protcy.2016.08.067
  • Boeddeker, T.; Gili, F.; Folgar, H.; Ivanjiko, M.; Chergui, A.; Behrens, S.; Runkel, D. (2016) Joining TWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologiesIn: Gemeinsame Forschung in der mechanischen Fügetechnik. Tagungsunterlagen mit CD des 6. Fügetechnischen Gemeinschaftskolloquiums am 7. und 8. Dezember 2016 in München. Europäische Forschungsgesellschaft für Blechverarbeitung e.V, Hannover, 2016
  • Bornmann, B.; Wulff, D.; Wagner, R.; Lützenkirchen-Hecht, D.; Möhwald, K.; Frahm R. (2016) Commissioning of a high temperature heater cell for in-situ ReflEXAFS studies of steel surfaces under variable reductive gas atmospheresIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 11-13
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2016) Applications of high frequency eddy current technology for material characterization of thin coatingsIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 37-43
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2016) In-Situ Monitoring of the Microstructure EvolutionIn: ATZK - Association for the Heat Treatment of Metals (Hrsg.): Proceedings of the European Conference on Heat Treatment 2016 and 3rd International Conference on Heat Treatment and Surface Engineering in Automotive Applications. 10.05. - 13.05.2016, Prague, Czech Republic
  • Bruchwald, O.; Frackowiak, W.; Zwoch, S.; Reimche, W.; Maier, H. J. (2016) In-Situ Monitoring of the Microstructure Evolution Using Eddy Current TechnologyProceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
    ISBN: 978-3-940283-78-8
  • Bruchwald, O.; Nicolaus, M.; Frackowiak, W.; Möhwald, K.; Reimche, W.; Maier, H. J. (2016) Material Characterization of Thin Coatings Using High Frequency Eddy Current TechnologyProceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
    ISBN: 978-3-940283-78-8
  • C. Kunz, M. Marschewski, W. Maus-Friedrichs, S. Schöler, U. Holländer, K. Möhwald (2016) Mechanisms of surface deoxidation of stainless steels in vacuum brazing processesIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 181-185
  • Demminger, C.; Klose, C.; Maier, H. J. (2016) Microstructure and Magnetic Properties of Cobalt and Zinc Containing Magnesium AlloysIn: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 35-42
    DOI: 10.1016/j.protcy.2016.08.006
  • Demminger, C.; Mozgova, I.; Quirico, M.; Uhlich, F.; Denkena, B.; Lachmayer, R.; Nyhuis, P. (2016) The Concept of Technical Inheritance in Operation: Analysis of the Information Flow in the Life Cycle of Smart ProductsIn: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 79-88
    DOI: 10.1016/j.protcy.2016.08.012
  • Eifler, R.; Durisin, M.; Klose, C.; Lenarz, T.; Maier, H. J. (2016) Degradation of MgF2-Coated and Uncoated MgNd2 Specimens in Contact with Nasal MucosaIn: 145. TMS Annual Meeting & Exhebition, Magnesium technology 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 331-335
  • F. Weber, U. Holländer, J. Schaup, K. Möhwald, H. J. Maier (2016) Fluxfree brazing of copper based alloys and steels at temperatures between 650 °C and 850 °C in monosilane-doped nitrogenIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 186-191
  • Frackowiak, W.; Bruchwald, O.; Reimche, W.; Maier, H. J. (2016) Applications of high frequency induction thermography in themegahertz range for material characterization of turbine componentsIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 31-36
  • Frackowiak, W.; Bruchwald, O.; Zwoch, S.; Reimche, W.; Maier, H. J. (2016) Non-Destructive Damage Detection and Material Characterization of Turbine Components Using Megahertz Range Induction Thermography in Pulsed ModeProceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
    ISBN: 978-3-940283-78-8
  • Gerstein, G.; Nürnberger, F.; Maier, H. J. (2016) Evolution of void shape anisotropy in deformed bcc steelsIn: 145. TMS Annual Meeting & Exhebition, Proceedings of the Epd Congress 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 173-179
  • Golovko, O.; Puppa, J.; Nürnberger, F.; Rodman, D.; Maier, H. J.; Behrens, B.-A. (2016) Development of intelligent hot forging tools with increased wear resistance by cyclic edge-zone hardeningIn: Proceedings of the 10th TOOL Conference 2016. Bratislava, Slowakei. 04.10. - 07.10.2016, S. 316-325
  • Hassel, T.; Aldag, D.; Varahram, A. (2016) MagnetArc Schweißen - Moderne Fügetechnik zum Verschweißen dickwandiger Rohre in der BohrindustrieIn: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 37-42
  • Hassel, T.; Langen, D.; Maier, H. J. (2016) Gefüge und mechanische Eigenschaften impfbehandelter Schweißnähte an TitanIn: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 49-53
    ISBN: 978-3-945023-74-7
  • Hassel, T.; Murray, N.; Beniyash, A.; Klimov, G. (2016) Anwendungspotentiale der atmosphärischen Elektronenstrahltechnik als universelles Fertigungsverfahren für die BlechbearbeitungIn: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 399-403
  • Hecht-Linowitzki, V., Klett, J., Hassel, T. (2016) Automated Underwater Arc WeldingIn: Overmayer, L.; Shkodyrev, V. (Hrsg.): AST - Symposium on Automated Systems and Technologies. Hannover, 12.10.-13.10.2016. PZH Verlag, Garbsen, 2016, S. 21-26
    ISBN: 978-3-95900-102-1
  • Knödler, P.; Otten, M.; Freiburg, D.; Möhwald, K.; Maier, H. J.; Biermann, D. (2016) Transplantation of Micro- and Nanostructured Coatings by Means of Thermal Spraying and PVDIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 3-11
  • Lachmayer, R.; Zghair, Y. A.; Klose, C.; Nürnberger, F. (2016) Introducing Selective Laser Melting to Manufacture Machine ElementsIn: Marjanović, D. et al. (Hrsg.): Proceedings of the DESIGN 2016 14th International Design Conference. Dubrovnik, Croatia. 16.05.-19.05.2016, S. 831-842
  • M. Schmieding, U. Holländer, K. Möhwald, H. J. Maier (2016) Development of copper and nickel based brazing solders with a low brazing and a high remelting temperatureIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 272-277
  • Otten, M. (2016) Herstellung von innenbeschichteten Druckgussbauteilen durch das Schichttransplantationsverfahren16. Internationaler Deutscher Druckgusstag, Nürnberg, 12.01. - 14.01.2016
  • S. Schöler, E. Marin Zimmermann, K. Möhwald, C. Kunz, W. Maus-Friedrichs (2016) Construction of an experimental set-up for brazing stainless steel samples in low vacuum atmosphere consisting monosilane-doped argonIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 311-315
  • Schmidt, H. C.; Homberg, W.; Hoppe, C.; Grundmeier, G.; Hordych, I.; Maier, H. J. (2016) Cold pressure welding by incremental rolling: Deformation zone analysisIn: Chinesta, F.; Cueto, E.; Abisset-Chavanne, E. (Hrsg.): Proceedings of the 19th International ESAFORM Conference on Material Forming: ESAFORM 2016. Nantes, France. 27-29 April 2016. AIP Publishing LLC, Melville, New York, S. 100013
  • U. Holländer, F. Weber, D. Wulff, K. Möhwald, H.J. Maier, M. Müller, I. Scharf, T. Lampke (2016) Development of a combined brazing-nitriding process for the production of bipolar plates made of chromium coated metal sheetsIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 174-180
  • Wolf, L.; Nürnberger, F.; Rodman, D.; Boiarkin, V.; Maier, H. J. (2016) Manufacturing of multiphase steel with adapted material propertiesIn: Special Workshop Multiscale Modeling of Heterogeneous Structures. 21.-23. Sept. 2016, Dubrovnik, Kroatien
  • Wolf, L.; Rodman, D.; Maier, H. J.; Nürnberger, F. (2016) Adapted multi-phase microstructures by intercritical annealing and press hardeningIn: Furuhara, T.; Nishida, M.; Miura S. (Hrsg.): The Ninth Pacific Rim International Conference on Advanced Materials and Processing (PRICM9). Kyoto, Japan. 01.-05. Aug. 2016. Wiley-VCH, 2016, S. 295-298
  • Wulff, D.; Holländer, U.; Lützenkirchen-Hecht, D.; Langohr, A.; Möhwald, K.; Maier, H. J. (2016) Short-time nitridation of electroplated chromium coatings in SiH4-doped N2- atmosphere analysed by GIXRDIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 53-54
  • Yilkiran, D.; Wulff, D.; Almohallami, A.; Holländer, U.; Hübner, S.; Möhwald, K.; Behrens, B.-A., Maier, H. J. (2016) Selectively Oxidised Tool Steel Surfaces for Sheet Metal FormingIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 179-185
    ISBN: 978-3-95900-072-7
  • Bauer, M.; Grünzel, O.; Zaremba, D.; Maier, H. J.; Hassel, T.; (2015) Spectral measurement of element solubility in water up to 300 MPaWJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
  • Bauer, M.; Müller-Deile, H.; Schilling, T.; Kaufeld, K. T.; Weidling, M.; Wriggers, P.; Haverich, A.; Maier, H. J.; Hassel, T. (2015) Characterisation of native stomach tissue of swine by uniaxial tensile testing Biomed Tech 2015, DGBMT, 60 (s1), 108-109
    DOI: 10.1515/bmt-2015-5004
  • Behrens, B.-A.; Maier, H. J.; Nürnberger, F.; Schrödter, J.; Moritz, J.; Wolf, L.; Gaebel C. M. (2015) Hot forming and subsequent cooling outside the press for adjusted tailored properties of 22MnB5 steel sheetsIn: Steinhoff, K.; Oldenburg, M.; Prakash, B. (Hg.): Hot Sheet Metal Forming of High Performance Steel. 5th International Conference Proceedings CHS2. Verl. Wiss. Scripten, Auerbach; S. 35-44.
    ISBN: 978-3-95735-023-7
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2015) Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling processIn: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 319–328.
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2015) Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatmentIn: Associazone Italiana di Metallurgia (AIM) (Hg.): Proceedings of the European Conference on Heat Treatment 2015 & 22nd IFHTSE Congress, 20.-22.05.2015, Venice, Italy
    ISBN: 978-88-98990-03-0
  • Engelhardt, M.; Behne, D.; Grittner, N.; Neumann, A.; Reimche, W.; Klose, C. (2015) Non-destructive Testing of Longitudinal and Charge Weld Seams in Extruded Aluminum and Magnesium ProfilesMaterials Today: Proceedings. Aluminium Two Thousand World Congress and International Conference on Extrusion and Benchmark ICEB 2015, 2015, S. 4866-4873
    DOI: 10.1016/j.matpr.2015.10.037
  • Gerstein, G.; Besserer, H.-B.; Jablonik, L.; Dalinger, A.; Nürnberger, F.; Höpner, A. (2015) Präparation plastisch umgeformter Stahlproben durch Ionenstrahlbearbeitung für die Untersuchung von duktiler SchädigungIn: Petzow, W. (Hg.): Fortschritte in der Metallographie. Berichte der 49. Metallographie-Tagung Dresden, 16. bis 18. September 2015; S. 153–158
    ISBN: 978-3-88355-410-5
  • Gerstein, G.; Besserer, H.-B.; Nürnberger, F.; Maier, H. J. (2015) Comparsion of the mechanisms of void formation by plastic deformation in single- and dual-phase bcc-steelsProceedings of the TMS 2015 Annual Meeting 2015, Characterization of minerals, metals, and materials, Orlando, Florida, 15.-19.03.2015. Hoboken, New Jersey: John Wiley & Sons, Inc, S. 75–81
    DOI: 10.1002/9781119093404.ch9
    ISBN: 978-1-119-08246-0
  • Hassel, T., Murray, N., Beniyash, A. (2015) A process chain using a non-vacuum electron beam as a universal tool for material processingProceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
  • Hecht-Linowitzki, V.; Kussike, S. M.; Hassel, T. (2015) Trennen von Spundwänden mittels CAMG-TechnikIn: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 10-15
    ISBN: 978-3-945023-43-3
  • Hecht-Linowitzki, V.; Wenzel, A.; Hassel, T. (2015) Aus der Forschung in die Praxis – Entwicklung einer neuen Stabelektrode zum nassen UnterwasserschweißenIn: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 4-9
    ISBN: 978-3-945023-43-3
  • Herbst, S.; Steinke, K. -F; Maier, H. J.; Milenin, A.; Nürnberger, F. (2015) Determination of heat transfer coefficients for complex spray cooling arrangementsIn: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 247–256
  • Hildenbrand, P.; Sieczkarek, P.; Matthias, S.; Löffler, M.; Besserer, H.-B.; Merklein, M.; Tekkaya, A. E.; Reithmeier, E.; Maier, H. J. (2015) Inkrementelles Umformen dünnwandiger Funktionsbauteile unter Einsatz prozessangepasster Halbzeuge durch Verfahren der BlechmassivumformungTekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 149-170
    ISBN: 978-3-8440-3434-9
  • Holländer, U.; Frank, J.; Möhwald, K.; Maier, H. J. (2015) Entwicklung einer korrosions- und verschleißbeständigen EisenbasisschichtIn: Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Tagungsband 1. Niedersächsisches Symposium Materialtechnik, 12. bis 13. Februar 2015. Shaker, Herzogenrath, 2015, S. 101-112
  • Holländer, U.; Möhwald, K. (2015) Gelötete Metall-Keramik-Verbunde in WerkzeugenIn: DVS-Berichte Bd. 315, Tagungsband des DVS Congress und Expo in Nürnberg. DVS-Media, Düsseldorf; S. 559-562
  • Jakob, H.; Hassel, T.; Biena, H.; Brüggemann, P.; Brähler, G. (2015) Schnell und sicher Bauteile aus Zirkalloy trennen / Cutting Zircaloy components quickly and safelyIn: Tagungsband KONTEC 2015 - 12. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle“, Dresden, 25.-27. März 2015, S. 598-616
  • Klaas, D.; Wienecke, A.; Wurz, M. C.; Rissing, L.; Freytag, P.; Maier, H. J. (2015) Smart System Integration: Moulding of Magnetic Field Sensors into AlSi9Cu3(Fe)-AlloysIn: SMTA, Pan Pacific Symposium Conference Proceedings, 2015.
  • Klose, C.; Demminger, C.; Maier, H. J. (2015) Microstructure and Properties of Cobalt- and Zinc-Containing Magnetic Magnesium Alloys Processed by High-Pressure Die CastingIn: Manuel, M. V. et al. (Hg.): Magnesium Technology 2015. Proceedings of a symposium sponsored by Magnesium Committee of the Light Metals Division of The Minerals, Metals & Materials Society (TMS), 144th Annual Meeting & Exhibition, 15.-19.03.2015, Orlando, Florida. John Wiley & Sons, Inc., Hoboken, New Jersey, 2015; S. 451-454
  • Knödler, P.; Otten, M.; Möhwald, K.; Maier, H. J.; Freiburg, D.; Peuker, A.; Biermann, D. (2015) Transplantation of Thermal Sprayed CoatingsASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 753-755
    ISBN: 978-1-62708-093-4
  • Kokorin, V.V., Konoplyuk, S.M., Dalinger, A., Thürer, S., Gerstein, G., Mashirov, A., Stetskiv, Y.P., Maier, H.J. (2015) Stress-induced transformation on Ni-Mn-In alloy and the concomitant change of resistivity10th European Symposium on Martensitic Transformations (ESOMAT 2015), Poster presentation, 14. - 17. September 2015, Antwerpen.
  • Langen, D.; Swider, M. A.; Hassel, T. (2015) Lichtbogenschweißen von Titanlegierungen – Einfluss von Impfmitteln auf das Schweißgefüge von TiAl6V4Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Fortschrittsberichte der Materialforschung und Werkstofftechnik; Tagungsband zum 1. Niedersächsischen Symposium Materialtechnik. 12. bis 13. Februar 2015. Herzogenrath: Shaker, S. 176–185
    ISBN: 978-3-8440-3403-5
  • Maier, H. J.; Behrens, B. A.; Wolf, L.; Moritz, J.; Neumann, A.; Diekamp, M.; Gretzki, T.; Rodman, D.; Schrödter, J.; Spiekermeier, S.; Hübner, S.; Nürnberger, F. (2015) Formhärten und Spraykühlung – Potenziale und AnwendungsmöglichkeitenIn: Merklein, M. (Hrsg.): 10. Erlanger Workshop Warmblechumformung 2015. Meisenbach GmbH-Verlag, Bamberg, 2015, S. 59-78
  • Murray, N., Beniyash, A., Kornilov, S., Rempe, N., Hassel, T. (2015) Robot-based non-vacuum electron beam technology with a plasma cathode EB emitterProceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2015) Development of a two-stage hybrid Technology for repairing Turbine BladesIn: ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 37-40
  • Nicolaus, M.; Rottwinkel, B.; Möhwald, K.; Nölke, C.; Kaierle, S.; Maier, H. J.; Wesling, V. (2015) Future regeneration processes for high pressure turbine bladesDeutscher Luft- und Raumfahrtkongress, Rostock, 22.09.-24.09.2015 Weitere Informationen
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2015) Sensorkontrollierte Bainitumwandlung aus der Schmiedewärme bei modernen Hochleistungsbauteilen im LeichtbauWerkstoffwoche 2015, Dresden, 14. - 17.09.2015
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2015) Hochleistungsbauteile für den Leichtbau mit sensorkontrollierter Bainitumwandlung aus der SchmiedewärmeIn: Borsutzki, M. (Hrsg.): Fortschritte in der Werkstoffprüfung für Forschung und Praxis. Verl. Stahleisen, Düsseldorf, 2015, S. 221-228
  • Wulff, D.; Holländer, U.; Lützenkirchen-Hecht, D.; Wagner, R.; Yilkiran, D.; Behrens, B.-A.; Maier, H. J. (2015) Characterisation of selective oxidised steel surfaces by GIXRDIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 11th DELTA User Meeting & Annual Report 2015, 2015; S. 70-71
  • Zaremba, D.; Heese, P.; Bauer, M.; Maier, H. J.; Hassel, T. (2015) Particle Disintegration in the Abrasive Water Injection JetWJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
  • Zeller, S.; Beese, S.; Gerstein, G.; Isik, K.; Löhnert, S.; Nürnberger, F.; Wriggers, P.; Maier, H. J.; Tekkaya, A. E. (2015) Möglichkeiten der simulativen Vorhersage von Temperaturentwicklung und Bauteilversagen infolge plastischer Deformation bei DP600 BauteilenTekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 113–128
  • Zimmermann, S.; Schmettlach, S.; Weber, S.; Marques, J.; Forster, G.; Landes, K.; Schein, J.; Lummer, C.; Knödler, P.; Kresnik, S.; Prehm, J.; Möhwald, K.; Maier, H. J. (2015) Homogenization of Coating Properties in Three-Cathode Atmospheric Plasma Spraying by Use of Advanced Diagnostics and Numerical Simulation - Investigations of Suspension Plasma Spraying (SPS)In: ASM International (Hrsg.): Proceedings from the International Thermal Spray Conference 2015; S. 452-459
  • Bauer, M.; Eiben, F.; Bach, Fr.-W.; Maier, H. J.; Hassel, T. (2014) New valve technology for AWSJ cuttingProceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 99-106
  • Bauer, M.; Hassel, T.; Grünzel, O.; Hinz, C.; Schilling, T.; Kaufeld, K. T.; Bach, Fr.-W.; Maier, H. J.; Haverich, A. (2014) Characterization of native and decellularised aortic tissue by using uniaxial tensile test48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.115
    DOI: 10.1515/bmt-2014-4509
  • Böhm, V.; Maier, H. J.; Bach, F.-W.; Reimche, W.; Behrens, B.-A.; Odening, D. (2014) Acoustic process monitoring during transient precision forging of high strengh componentsLudger Overmeyer und Vyacheslav P. Shkodyrev (Hg.): AST - Symposium on Automated Systems and Technologies. Proceedings, Hannover, 15-16 October 2014. 1. Aufl. Garbsen: TEWISS (Berichte aus dem ITA, 2014, Bd. 4), S. 105–110
  • Bucquet, T.; Gulpak, M.; Egorov, F.; Garbrecht, M.; Hoja, T.; Hoffmann, F.; Fritsching, U.; Brinksmeier, E; Zoch, H.-W.; Fischer, M.; Dickert, H. H.; Bleck, W; Labanova, N.; Hajyheydari, E.; Felde, A.; Liewald, M.; Huskic, A.; Kazhai, M.; Hadifi, T.; Bouguecha, A.; Behrens, B.-A; Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2014) EcoForge - Prozessintegrierte Wärmebehandlung bainitischer Stähle Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 245-264
    ISBN: 978-3-00-045166-9
  • Demminger, C.; Klose, C.; Taptimthon, P.; Maier, H. J. (2014) Material-inherent data storage using magnetic magnesium-cobalt alloysProcedia Technology 5, 2nd International Conference of System-Integrated Intelligence: Challenges for Product and Production Engineering Bremen, 2.-04.07.2014, S. 188-197
    DOI: 10.1016/j.protcy.2014.09.071
  • Durisin, M.; Lenarz, T.; Kanaan, N.; Bach, F.-W.; Angrisani, G. L.; Maier, H. J. (2014) Changes on a platinum electrode surface during acoustic stimulation of a cochlear implant – in vitro approach48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S. 1144–1147
    DOI: 10.1515/bmt-2014-5014
  • Durisin, M.; Weber, C. M.; Angrisani, N.; Seitz, J. M.; Eifler, R.; Maier, H. J.; Lenarz, T. (2014) Biocompatibility of MgF2-coated MgNd2 alloys in contact with nasal mucosal tissue – in vivo approach48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.108
    DOI: 10.1515/bmt-2014-5000
  • Durisin, M.; Weber, C. M.; Reifenrath, J.; Kietzmann, M.; Seitz, J. M.; Eifler, R.; Maier, H. J.; Lenarz, T. (2014) In vivo study of a biodegradable nasal stent (MgF2-coated MgNd2 alloy) in a minipig for up to six months48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1203
    DOI: 10.1515/bmt-2014-5014
  • Eifler, R.; Seitz, J. M.; Klose, C.; Bach, F.-W. (2014) Drawing and Stranding of Magnesium Wires for use as a Resorbable Suture Material48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1186
    DOI: 10.1515/bmt-2014-5014
  • Engelhardt, M.; Klose, C. (2014) Experimental investigations on forming limits for aluminium alloy sheet metal at various strain ratesIn: H. Huh und A. E. Tekkaya (Hg.): High Speed Forming 2014. Proceedings of the 6th International Conference. Organizing committee of the 6th International Conference on High Speed Forming, May 26–29 2014, Korea Advanced Institute of Science and Technology, Department of Mechanical Engineering. Daejeon, Korea. pp. 11–20.
  • Foth, F; Reifenrath, J; Behrens, P; Schumacher, S; Christel, A; Angrisani, GL; Kietzmann, M; Angrisani, N (2014) Magnetizable implants as tool for improved magnetic drug targetingIn: Tissue Engineering & Regenerative Medicine International Society (Hrsg.): Termis, European Chapter Meeting. Special issue, Journal of Tissue Engineering and Regenerative Medicine. Genova, Italy. 10.-13.06.2014, S. 59-60
    DOI: 10.1002/term.1931
  • Freiburg, D.; Biermann, D.; Peuker, A.; Kersting, P.; Maier, H. J.; Möhwald, K.; Knödler, P.; Otten, M. (2014) Development and Analysis of Microstructures for the Transplantation of Thermally Sprayed CoatingsProcedia CIRP Vol. 14, 6th CIRP International Conference on High Performance Cutting, HPC2014, S. 245 -250
    DOI: 10.1016/j.procir.2014.03.054
  • Grittner, N.; Engelhardt, M.; Neumann, A.; Klose, C.; Hübner, S.; Behrens, B.-A.; Maier, H. J. (2014) A novel process for producing large scale Mg-sheetsMagnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 289-292
    ISBN: 978-1-118-88816-2
  • Grydin, O.; Stolbchenko, M.; Nürnberger, F.; Schaper, M. (2014) Influence of the twin-roll casting parameters on the microsegregation in thin strips of the aluminium alloy EN AW-6082Wiley, TMS, 2014, Light Metals 2014, P. 411-414 Weitere Informationen
  • Hassel, T.; Bauer, M.; Hoyer, P.; Patil, A. J.; Beniash, E.; Bach, F.-W.; Maier, H. J. (2014) Study of magnesium fluoride and self-assembled organosilane coatings of AZ31 and MgCa0.8 alloys6th Symposium on Biodegradable Metals, University Politecnico di Milano, Maratea, Italien, 24.-29. August 2014
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2014) Entwicklung und Test eines Prüfverfahrens zur Bewertung von Lötverbindungen bei kombinierter mechanisch-korrosiver BelastungTagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 164-171
    ISBN: 978-3-00-046877-3
  • Hübsch, C.; Borcher, L.; Hassel, T.; Stiesch, M. (2014) Transparent PVD-coatings on zirconia for dental applications48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014
  • Kaufeld, K. T.; Schilling, T.; Hinz, C.; Brandes, G.; Cebotari, S.; Tudorache, I.; Mogaldea, A.; Bach, F.-W.; Hassel, T.; Biskup, C.; Bauer, M.; Hilfiker, A.; Haverich, A. (2014) Decellularized aortic allograft stabilized by an absorbable magnesium scaffold for substitution of the descending aortaThorac cardiovasc Surg (The Thoracic and Cardiovascular Surgeon)
    DOI: 10.1055/s-0034-1367288
  • Knödler, P.; Peuker, A.; Freiburg, D.; Otten, M.; Möhwald, K.; Biermann, D. (2014) Transfer of Micro-structures by Transplantation of Thermal Sprayed CoatingsITSC 2014 Conference proceedings, lectures and posters, 21. - 23.5.2014, Barcelona, Spanien, S. 142–145
    ISBN: 978-3-87155-574-9
  • Lützenkirchen-Hecht, D.; Wulff, D.; Wagner, R.; Holländer, U. (2014) Ex-situ EXAFS investigations of steel deoxidation processesIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 10th DELTA User Meeting & Annual Report 2014. Dortmund, 26.11.2014, S. 105-106
  • Merklein, M.; Schneider, T.; Gröbel, D.; Nürnberger, F. (2014) Blechmassivumformung - vom Halbzeug zum FunktionsbauteilBehrens, B. A. (Hg.): 21. Umformtechnisches Kolloquium Hannover, Industrie und Wissenschaft – Gemeinsam die Zukunft gestalten, 2014; S. 265-280
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2014) Common application of Ni-based fillermetals and hotgascorrosion protection coatings by means of thermal spraying with subsequent heat treatment for near net shape turbineblade repairingIn: Bouzakis, K.-D. et al. (Hrsg.): Proceedings / 11th International Conference THE "A" Coatings in Manufacturing Engineering, 1 - 3 October 2014, Thessaloniki, Greece. Ed. Ziti, Thessaloniki, 2014, S. 179-184
    ISBN: 978-960-98780-8-1
  • Nürnberger, F.; Diekamp, M.; Moritz, J.; Wolf, L.; Hübner, S.; Behrens, B.-A. (2014) Spray Cooling of Early Extracted Hot Stamped PartsTMS 2014, 143. Annual Meeting Supplemental Proceedings, John Wiley & Sons, Inc., Hoboken, NJ, 16.–20.02.2014, in San Diego, California USA Weitere Informationen
    DOI: 10.1002/9781118889879.ch116
    ISBN: 9781118889879
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2014) Sensorkontrollierte Umwandlung aus der Schmiedewärme zur Prozesssteuerung und Bauteiloptimierung Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 338
    ISBN: 978-3-00-045166-9
  • Seitz, J-M.; Eifler, R.; Vaughan, M.; Seal, C.; Hyland, M.; Maier, H. J. (2014) Coating Systems for Biodegradable Magnesium ApplicationsMagnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 371-374
    ISBN: 978-1-118-88816-2
  • Striewe, B.; Hehl, A. v.; Grittner, N.; Schaper, M.; Nürnberger, F. (2014) Heat Treatment of Aluminum-Titanium-Compounds Made by Co-Extrusion and Friction WeldingAluminium Alloys 2014 - ICAA14, Materials Science Forum, 794-796, S. 839–844
    DOI: 10.4028/www.scientific.net/MSF.794-796.839
  • Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Hassel, T.; Bach, Fr.-W.; Maier, H. J.; Haverich, A.; Wriggers, P. (2014) Finite element simulations for development of cardiovascular implants to support biological grafts48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.984
    DOI: 10.1515/bmt-2014-4422
  • Weizbauer, A.; Krämer, M.; Modrejewski, C.; Behrens, S.; Eifler, R.; Hering, B.; Reifenrath, J.; Willbold, E.; Besdo, S.; Schilling, M.; Waizy, H.; Windhagen, H. (2014) In vitro degradation and biomechanical testing of magnesium alloys48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.16
    DOI: 10.1515/bmt-2014-5000
  • Westphal, R.; Zaremba, D.; Hassel, T.; Liodakis, E.; Suero, E.; Krettek, C.; Bach, F.-W.; Wahl, F. (2014) Roboterassistierte Umstellungsosteotomie mittels WasserabrasivstahltechnikDeutsche Gesellschaft für Computer‐ und Roboter Assistierte Chirurgie, Session XV
  • Wulff, D.; Langohr, A.; Dellinger, P.; Holländer, U.; Möhwald, K. (2014) Aufbau einer RF-PVD Anlage zur Abscheidung sauerstoffaffiner Materialien für die Herstellung wärmegenerierender SystemeTagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 247–254
    ISBN: 978-3-00-046877-3
  • Zaremba, D.; Wachsmuth, S.; Schneider, P.; Hufenbach, W.; Maier, H. J.; Hassel, T. (2014) Method for the material-specific repair preparation of carbon fiber reinforced plastic structuresProceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 45-56.
  • Behrens, B.- A.; Bach, Fr.-W.; Diekamp, M.; Hübner, S.; Nürnberger, F.; Schrödter, J.; Wolf, L.; Moritz, J. (2013) Process Time Reduction of Hot Stamping by Means of Early Extraction from the PressIn: Mats Oldenburg und Kurt Steinhoff (Hg.): Proceedings / 4th International Conference Hot Sheet Metal Forming of High Performance Steel. June 9 - 12, 2013, Luleå, Sweden. Auerbach: Verl. Wiss. Scripten (CHS 2 series, 4), S. 259-266 (8).
  • Behrens, S.; Hassel, T.; Bach, F.-W.; Steinwarz, W.; Dyllong, N.; Tragsdorf, I. M. (2013) Untersuchung und Qualifizierung thermisch gespritzter Korrosionsschutzschichten für dickwandige Behälterbauteile, Internationales Symposium Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle In: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Dresden. 13.-15.03.2013, S. 555-562
  • Bracht, K.; Angrisani, N.; Seitz, J.-M.; Eifler, R.; Weizbauer, A.; Reifenrath, J. (2013) Influence of different storage durations on the properties of degradable magnesium based implantsEuropean Cells and Materials Vol. 26. Suppl. 5, 2013 (page 17) Weitere Informationen
  • Dellinger, P.; Möhwald, K.; Maier, H. J.; Bach, Fr.-W. (2013) Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013
  • Faßmann, D.; Isik, K.; Zeller, S.; Beese, S.; Ben Khalifa, N.; Nürnberger, F.; Schaper, M.; Tekkaya, A. E.; Löhnert, S.; Wriggers, P. (2013) Abbildung des Werkstoffverhaltens von ferritischem Stahl in numerischen Modellen zur Darstellung von Blechmassivumformprozessen bei zyklischen BelastungspfadenIn: M. Merklein, B.- A. Behrens und A. E. Tekkaya (Hg.): 2. Workshop Blechmassivumformung. Umformtechnische Herstellung von komplexen Funktionsbauteilen mit Nebenformelementen aus Feinblechen - Blechmassivumformung -. Erlangen, 13.11.2013. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 69–84.
  • Frąckowiak, W.; Bruchwald, O.; Reimche, W.; Bach, F.-W.; Maier, H. J. (2013) High Frequency Eddy-Current and Induction Thermography Inspection Techniques for Turbine ComponentsIn: 18th International Workshop on Electromagnetic Non-destructive Evaluation (ENDE). Bratislava, SK, 25.-28.06.2013.
    ISBN: 978-80-554-0713-5
  • Freytag, P.; Kerber, K.; Maier, H. J. (2013) Nutzung von Beschichtungen aus Zinklegierungen zur Steigerung der Wärmeleitfähigkeit beim Verbundguss von Kupfer und Aluminium im DruckgussprozessIn: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 9
  • Hassel, T.; Hecht-Linowitzki, V. (2013) Herausforderung beim Reparaturschweißen an Spundwandbauwerken im nassen und halbnassen BereichIn: Wir­tschafts­vereinigung Stahl (Hrsg.): Fachseminar „Stahlspundwände – Neues für Planung und Anwendung“. Hannover. 12. Dezember 2013
  • Hassel, T.; Hecht-Linowitzki, V.; Kussike, S. M.; Rehfeldt, D.; Bach, Fr.-W. (2013) Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVERIn: 66th IIW Annual Assembly. Commission XII „Arc Welding Processes and Production Systems“. Unter Mitarbeit von International Institute of Welding
  • Holl, M.; Löhnert, S.; Wriggers, P.; Nicolaus, M.; (2013) Three-Dimensional Crack Propagation in Ductile Media Using The XFEMCFRAC 2013 Prag, Erschienen in: Computational Modeling of Fracture and Failure of Materials and Structures (Editoren: M. Jirasek, O. Allix, N. Moes, J. Oliver), ISBN: 978-80-01-05279-2; 2013; Seite 125
  • Holländer, U.; Bach, Fr.-W.; Möhwald, K.; Kirchberg, S.; Ziegmann, G. (2013) Injection molding, characterization and application of polymer bonded nickel based braze metal preforms for high temperature brazing processesProceedings of 10th International Conference on Brazing, High Temperature Brazing and Diffusion Brazing, Aachen, Juni 2013, S. 11-16
  • Jakob, H.; Köhler, A.; Bach, Fr.-W.; Hassel, T.; Kremer, G.; Kinscher, J.; Tewes, R.; Dierkes, U.; Heger, K.; Held, C. (2013) Zerlegen metallischer Strukturen im kerntechnischen Umfeld durch Verwendung von Schneidladungen / Cutting of metal structures with linear cutter charges in nuclear power plantsIn: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 513–545.
  • Jakob, H.; Petersen, M.; Köhler, A.; Bach, Fr.-W.; Hassel, T.; Brüggemann, P.; Bienia, H.; Brähler, G. (2013) Zirkoniumlegierungen universell und sicher Schneiden – ZIRKUSS Universal and safe cutting techniques for zirconium alloys - ZIRKUSSIn: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 612–626.
  • Kieke, M. D. K.; Weizbauer, A.; Duda, F.; Badar, M.; Budde, S.; Flörkemeier, T.; Diekmann, J.; Prenzler, N.; Rahim, M. I.; Müller, P. P.; Hauser, H.; Behrens, S.; Dellinger, P.; Möhwald, K.; Lenarz, T.; Windhagen, H.; Behrens, P. (2013) Evaluating a novel class of biomaterials: Magnesium-containing layered double hydroxidesBMT 2013, 3-Ländertagung D-A-CH, Graz, 19-21.09.2013
  • Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, F.-W. (2013) Injection molding and application of ring-shaped polymer-bonded braze metal preformsTagungsband: Design of/with composites, Composites Week @ Leuven, Leuven (Belgien), September 2013
  • Klose, C.; Demminger, C.; Maier, H. J. (2013) Sensorische Werkstoffe - Erfassen und Nutzen mechanischer Beanspruchungsdaten im Lebenszyklus gentelligenter BauteileIn: 8. Aachener Oberflächentechnik Kolloquium 2013. Herzogenrath (K. Bobzin (Hg.)), Shaker, 2013, S. 59–66
  • Klose, C.; Demminger, C.; Zwoch, S.; Reimche, W.; Bach, Fr.-W; Maier, H. J.; Kerber, K. (2013) Measurement of static and dynamic loads utilizing sensory magnesium componentsIn: Euro Intelligent Materials 2013 (E. Quandt und C. Selhuber-Unkel (Hg.)), DGM, 2013, S. 57
  • Knödler, P.; Peuker, A.; Erne, M.; Maier, H. J.; Möhwald, K.; Biermann, D.; Kerber, K.; Otten, M. (2013) Transfer of Micro-structures by Transplantation of Thermal Sprayed CoatingsIn: Proceedings of the 10th International Conference THE “A“ Coatings (K.-D. Bouzakis, K. Bobzin, B. Denkena und M. Merklein (Hg.)), Shaker, Aachen, 2013, S. 193–204
  • Kussike, S. M.; Hecht-Linowitzki, V.; Werner, J.; Peuker, M.; Bach, Fr.-W.; Hassel, T. (2013) Hydrophobierung von Stabelektroden zum nassen Lichtbogenhand-schweißen unter Wasser – Wo liegen die Möglichkeiten?In: DVS-Berichte Band 296, Große Schweißtechnische Tagung, Essen, 16. bis 21. September 2013, S. 56–62
    DOI: 978-3-87155-614-2
  • Langohr A.; Swider M.A; Möller F.; Wulf E.; Möhwald K.; Hassel T.; Maier H. J. (2013) Development of flux free filler metals and processes for brazing of aluminumIn: Brazing, high temperature brazing and diffusion bonding. LÖT 2013, lectures and posters of the 10th international conference taking place in Aachen on 18th to 20th June 2013. Als Ms. gedr. Düsseldorf: DVS Media (DVS-Berichte, 293), 2013, S. 205–211
  • Liewald, M.; Hajyheydari, E.; Felde, A.; Fritsching, U.; Hinrichs, B.; Bucquet, T.; Fischer, M.; Dickert, H.; Bleck, W.; Behrens, B.-A.;Bouguecha, A.; Hadifi, T.; Huskic, A.; Kazhai, M.; Egorov, F.; Brinksmeier, E.; Maier, H.J.; Reimche, W.; Bruchwald, O.; Frackowiak, W. (2013) EcoForge – Resource-efficient process chains for high-performance componentsLiewald (Hg.): Tagungsband Neuere Entwicklungen in der Massivumformung, Fellbach, 4. - 5.6.2013, S. 117–147
    ISBN: 978-3-88355-395-5
  • Otten, M.; Möhwald, K.; Kerber, K.; Erne, M.; Knödler, P.; Maier, H. J.; Biermann, D.; Zabel, A.; Peuker, A. (2013) Untersuchung der mikro- und makroskopischen Abbildungsgenauigkeit von im Schichttransplantationsprozess übertragenden OberflächenbeschichtungenIn: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 10
  • Petersen, M.; Jakob, H.; Köhler, A.; Bach, Fr.-W.; Hassel, T. (2013) Hot-Wire-Plasmaschneiden: Zerlegen von komplexen Bauteilen und Verbundwerkstoffen / Hot-Wire plasma arc cutting: Cutting of complex structures and composite materialsIn: Kontec Gesellschaft für technische Kommunikation (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle. Hamburg, S. 463–486
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Bach, F.-W.; Maier, H. J. (2013) Sensorkontrollierte Umwandlung von Hochleistungsbauteilen aus der SchmiedewärmeIn: Christ, H.-J. (Hrsg.): Tagung Werkstoffprüfung – Fortschritte in der Werkstoffprüfung für Forschung und Praxis, 28.11.-29.11. 2013, Neu-Ulm, S. 271-277
    ISBN: 978-3-514-00806-9
  • Svendsen, B.; Barthel, C.; Schaper, M.; Grydin, O.; Brosius, A.; Cwiekalla, T.; Tekkaya, A.E; Prahl, U.; Uthaisangsuk, V. (2013) Zeiteffiziente Prozesskettenmodellierung und-berechnung in der Blechumformung und -verarbeitungIn: R. Kawalla (Hg.): MEFORM 2013. Simulation von Umformprozessen. ACATRAIN e.V., Institut für Metallformung. Freiberg: TU Bergakademie Freiberg, S. 314–326.
  • Wolf, L.; Moritz, J.; Diekamp, M.; Schrödter, J.; Nürnberger, F.; Hübner, S.; Bach, Fr.-W.; Behrens, B.- A.; Sunderkötter, C.; Marusch H.-E. (2013) Partielles Vergüten mittels verkürztem Formhärteprozess und nachgeschalteter SpraykühlungIn: M. Merklein (Hg.): 8. Erlanger Workshop Warmblechumformung. Bamberg, Germany: Meisenbach GmbH-Verlag, S. 65–84.
  • Zaremba, D.; Westphal, R.; Suero, E.; Krettek, C.; Wahl, F.M; Bach, Fr.-W.; Hassel, T. (2013) Robot-Assisted Displacement Osteotomy by the Abrasive Waterjet – Concept and Technical RealizationIn: M. Hashish (Hg.): Proceedings of the 2013 WJTA-IMCA Conference and Expo. September 9-11, 2013, George R. Brown Convention Center, Houston, Texas. WaterJet Technology Association. Houston, USA, S. E3.
  • Bach, Fr.-W.; Möhwald, K.; Kerber, K.; Erne, M.; Knödler, P.; Otten, M. (2012) Herstellung von nachbearbeitungsarmen Innenbeschichtungen auf Druckgussteilen durch Transplantation thermischer SpritzschichtenIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 129–139.
  • Bach, Fr.-W.; Möhwald, K.; Kerber, K.; Erne, M.; Lüdeker, J.; Freytag, P.; Angrisani, G. L. (2012) Thermische Spritzschichten zur dynamischen Datenspeicherung auf technischen BauteilenIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 110–119.
  • Birr, C.; Reimche, W.; Maier, H.J; Bach, Fr.-W.; Olfermann, T.; Matzke, M.; Meschut, G.; Hahn, O.; Ahnert, M.; Broschwitz, E.; Kraus, C.; Neugebauer, R. (2012) Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von MischbaustrukturenIn: FOSTA-EFB-DVS (Hg.): Gemeinsame Forschung in der Mechanischen Fügetechnik. 2. Fügetechnisches Gemeinschaftskolloquium 2012, S. 59–71.
  • Dellinger, P.; Möhwald, K. (2012) Bauteilpanzerung und Oberflächenstrukturierung durch PVD-SchichttransplantationIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Chemnitz: Eigenverlag, S. 452–457.
  • Engelhardt, M.; Grittner, N.; Klose, C.; Bach, Fr.-W. (2012) Influence of Process Fluctuations on Weld Seam Properties in Aluminum Alloy ExtrusionIn: H. Weiland, A. D. Rollet und W. A. Cassada (Hg.): ICAA13: 13th International Conference 2012. Hoboken, NJ, USA: John Wiley & Sons, Inc., S. 1843–1850.
  • Engelhardt, M.; Haverkamp, H.; Klose, C.; Bach, Fr.-W. (2012) Development of a Pneumatic High-Speed Nakajima Testing DeviceIn: A. E. Tekkaya, G. Daehn und M. Kleiner (Hg.): High Speed Forming 2012. Proceedings of the 5th International Conference. Organizing committee of the 5th International Conference on High Speed Forming, April 24 – 26 2012, Technische Universität Dortmund, Faculty of Mechanical Engi-neering, Institute of Forming Technology and Lightweight Construction and De-partment of Materials Science and Engineering of the Ohio State University. Dortmund, S. 155–164.
  • Grydin, O.; Nürnberger, F.; Schaper, M.; Cwiekalla, T.; Brosius, A.; Tekkaya, A.E; Barthel, C.; Svendsen, B. (2012) Distortion analysis of air hardened deep drawn parts of the air-hardened steel LH800In: D.S MacKenzie (Hg.): Quenching Control and Distortion. Proceedings of the 6th International Quenching and Control of Distortion Confer-ence including the 4th International Distortion Engineering Conference. ASM International. Materials Park, Ohio 44073-0002: ASM International, S. 829–838.
  • Holländer, U.; Möhwald, K.; Bach, Fr.-W. (2012) Physikalisch-chemische Betrachtungen zur Oxidschichtauflösung beim Hartlöten von Stählen mit Cu- und AgCu-LotenIn: Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Unter Mitarbeit von B. Wielage. Chemnitz: Eigenverlag, S. 465–472.
  • Klose, C.; Mroz, G.; Kerber, K.; Reimche, W.; Bach, Fr.-W. (2012) Production and Comparison of Adapted Load-sensitive Magnesium AlloysIn: B. Denkena, J. Gausemeier und B. Scholz-Reiter (Hg.): SysInt - 1st Joint International Symposium on System-integrated Intelligence. New Challenges for Production Engineering 27.-29.06.2012. CIRP The International Academy for Production Engineering. Garbsen: PZH Verlag, S. 56–58.
    ISBN: 978-3-943104-59-2
  • Milenin, A.; Byrska-Wójcik, D. J.; Grydin, O.; Schaper, M. (2012) The physical and numerical modeling of intergranular fracture in the mg-ca alloys during cold plastic deformationIn: K. Mori, M. Pietrzyk, J. Kusiak, J. Majta, P. Hartley und J. Lin (Hg.): Steel Research International. Special Edition: 14th International Conference Metal Forming. Weinheim, Germany: WILEY-VCH Verlag GmbH & Co. KGaA, S. 863–866.
  • Murray, N.; Konya, R.; Beniyash, A.; Hassel, T.; Bach, Fr.-W. (2012) New advances in non-vacuum electron beam cuttingIn: Wilfried Behr (Hg.): International Electron Beam Welding Conference. Lectures of the 2nd IEBW Conference taking place in Aachen on March 26 - 30, 2012. Düsseldorf: DVS Media (DVS-Berichte, 285).
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2012) A New Hybrid Process for Repair Brazing and Coating of Turbine BladesIn: R.S Lima, A. Agarwal, M.M Hyland, Y.-C Lau, C. Li, A. McDonald und F.-L Toma (Hg.): International Thermal Spray Conference and Exposition (ITSC 2012). Conference Proceedings, 20.05. – 24.05.2012, Houston, TX, USA. ASM International. Novelty, OH, USA: ASM International, S. 110–113.
  • Petersen, M.; Jakob, H.; Bach, Fr.-W.; Hassel, T. (2012) Grundlagenuntersuchungen und Emissionsmessungen beim Hot-Wire-PlasmaschneidenIn: Deutscher Verband für Schweißen und Verwandte Verfahren (DVS) (Hg.): DVS-Berichte Band 286. Tagungsband des DVS-Congress 2012. Düsseldorf: DVS Media, S. 137–142.
  • Reimche, W.; Böhm, V.; Bach, Fr.-W.; Odening, D.; Behrens, B.- A. (2012) Zeitbereichsanalyse transienten Umformverhaltens zur Qualitätsbewertung beim Präzisionsschmieden von HochleistungsbauteilenIn: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
  • Reimche, W.; Bruchwald, O.; Zwoch, S.; Bach, Fr.-W. (2012) Prüfung hochbeanspruchter Sohlverankerungslaschen in Wehranlagen auf Rissanzeigen unter WasserIn: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
  • Reimche, W.; Frackowiak, W.; Bruchwald, O.; Böhm, V.; Bach, Fr.-W. (2012) Nachweis von lokalen Schädigungen an Hochleistungsbauteilen mit Hochfrequenz Wirbelstromtechniken und Induktions-ThermografieIn: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
  • Saalbach, Kai-Alexander; Freytag, Patrick; Kerber, Kai; Twiefel, Jens (2012) Ultrasonic Assisted Simultaneous Composite Casting – A feasibility study2012 IEEE International Ultrasonics Symposium, S. 775-777
    DOI: 10.1109/ULTSYM.2012.0193
    ISBN: 978-1-4673-4562-0
  • Schaper, M.; Golovko, O.; Nürnberger, F. (2012) Implementation of Heat Treatment into the Aluminum Extrusion ProcessMaterials Science & Technology 2012. ACerS, AIST ASM TMS NACE. Pittsburgh, Pennsylvania, USA, 07.10.2012
  • Schlesselmann, D.; Jestremski, M.; Rodman, D.; Nacke, B. (2012) Numerical simulation methods for complex induction hardening processes In: International Union for Electricity Applications (UIE) (Hg.): XVII Congress UIE Proceedings. Energy efficient, economically sound, ecologically respectful, educationally en-forced electrotechnologies, S. 98–103.
  • Seitz, J.-M.; Eifler, R.; Bach, Fr.-W. (2012) Magnesium Wire MaterialsIn: J. Grigoleit (Hg.): Wrought Magnesium Alloys - Resource-efficient Production and Applications. Proceedings: 63rd Freiberg Research Forum for Mining and Metallurgy. Freiberg: Eigenverlag, S. 28–31.
  • Varahram, A.; Lehr, J.; Swider, M. A.; Hassel, T.; Bach, Fr.-W. (2012) Casing connection method with improved Strength and Reliability for Monobore Wellbore ConstructionsIn: GeoEnergy Celle e.V Celle Drilling (Hg.): Celle Drilling 2012. International Conference for Advanced Drilling Technology
  • Bach, Fr.-W., Möhwald, K., Zhang, Yi, Freytag, P.; Erne, M.; Kerber, K.; Biermann, D.; Zabel, A., Peuker, A. (2011) Herstellung von Druckgussteilen mit mikrostrukturierten Funktionsschichten, durch die Transplantation von thermischen Spritzschichten In: Tagungsband zum Werkstofftechnischen Kolloquium (14. Werkstofftechnisches Kolloquium), S. 24–33
  • Bär, F.; Varahram, A.; Hassel, Th.; Overmeyer, L.; Bach, Fr.-W. (2011) Cost-efficient Monobore Well Construction for Geothermal EnergyProceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE
  • Behrens, B.-A.; Yilkiran, T.; Bach, Fr.-W.; Puchert, A. (2011) Erhöhung des verschleißwiderstandes von Werkzeugen der Warmmassivumformung durch Ausnutzung der zyklischen Randschichthärtung 20. Umformtechnisches Kolloquium Hannover. Hannover, 23.02.2011.
  • Behrens, S.; Hassel, T.; Bach, Fr.-W.; Steinwarz, W.; Dyllong, N.; Tragsdorf, I. M. (2011) Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK - Ein Überblick zum Abschluss des ProjektesIn: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 608-621
  • Besdo, S.; Biskup, C.; Klodmann, J.; Schmolke, S.; Andreae, A.; Waldmann, K.-H.; Bach, Fr.-W. (2011) Design of Interference Screws for the Cruiciate Ligament Reconstuction: A Finite Element Study4th International Conference on the Mechanics of Biomaterials and Tissues (ICOMBT)
  • Brandes, G.; Schilling, T.; Meyer, T.; Cebotari, S.; Tudorache, I.; Hinte, N.; Biskup, C.; Hassel, T.; Bach, Fr.-W.; Haverich, A. (2011) Tissue Engineering of magnesium stabilized, vascularized, autologus gastric tissue for cardiac muscle replacementESAO-Kongress Oktober 2011
  • Brosius, A.; Soyarslan, C.; Stiemer, M.; Isik, K.; Faßmann, D.; Sieczkarek, P. et al. (2011) Numerische und metallurgische Analyse der Werkstoffschädigung in der BlechmassivumformungM. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 33–50.
  • Clausmeyer, T.; Bargmann, S.; Gershteyn, G.; Schaper, M.; Svendsen, B. (2011) Finite-element Simulation of the Evolution of Plastic AnisotropySteel Research International: ICTP 2011 Special Issue, September 2011
  • Clausmeyer, T.; Gershteyn, G.; Bargmann, S.; Svendsen, B.; Schaper, M.; Khan, A. S. (Hrsg.) (2011) Modeling and characteriziation of the evolution of the dislocation structure during non-monotonic loading. Part 2: Modeling transient behaviorProceedings of 17. International Symposium on Plasticity and its current Applications 2011. Macro to Nano-scale, Inelastic Deformation and Failure of Materials & Multi-scale Modeling. 03.-08.01.2011, Puerto Vallarta, Mexico, S. 172–174.
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2011) PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-VeredelungWielage (Hg.) 2010 – Tagungsband 13. Werkstofftechnisches Kolloquium Chemnitz
  • Diebel, M.; Hauer, J.; Reimche, W.; Bach, Fr.-W. (2011) Quality Control of High Tension 3D-NVEB-Weld JointsProceedings of the International Symposion on Digital Industrial Radiology and Computed Tomography
  • Dunnen S. den; Kraaj G.; Biskup, C.; Kerkhoffs G.M.M.J.; Tuijthof G.J.M (2011) Effect of waterjetsdrilling in boneAnnual meeting of the Dutch Orthopaedic Society (NOV), Groningen, January 2011
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011) Tribological behaviour of suspension plasma sprayed coatings for hot extrusion toolsIn: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011) Three anodes compared to three cathodes: Evaluation of gun concepts for high performance plasma spraying operationIn: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011) Achieving new thermal spray coatings by usage of multielectrode plasma gunsIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 353–360.
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011) Suspension Plasma Spraying of oxide ceramic coatings on massive forming toolsIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 337–346.
  • Gershteyn, G.; Clausmeyer, T.; Bargmann, S.; Svendsen, B.; Schaper, M.; Khan, A. S. (Hrsg.) (2011) Modeling and characteriziation of the evolution of the dislocation structure during non-monotonic loading. Part 1: Electron-microscopic analysisProceedings of 17. International Symposium on Plasticity and its current Applications 2011. Macro to Nano-scale, Inelastic Deformation and Failure of Materials & Multi-scale Modeling. 03.-08.01.2011, Puerto Vallarta, Mexico, S. 163-165
  • Gershteyn, G.; Nürnberger, F.; Cianciosi, F.; Shevchenko, N.; Schaper, M.; Bach, Fr.-W. (2011) A Study of Structure Evolution in Pearlitic Steel Wire at Increasing Plastic DeformationSteel research int. 82 (2011) No. 12, p.p. 1368-1374
  • Grittner, N.; Haverkamp, H.; Stelling, O.; Striewe, B.; Bormann, D.; Schimanski, K.; Nikolaus, M.; von Hehl, A.; Bach, Fr.-W.; Wielage, B. (Hrsg.) (2011) Verbundstrangpressen von Titan-Aluminium VerbindungenTagungsband zum 18. Symposium Verbundwerkstoffe und Werkstoffverbunde Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 41. Chemnitz: Eigenverl., 2011.
    ISBN: 978-3-00-033801-4
  • Hassel, T.; Kussike, S.M.; Wolyniec, A.; Bierbaum, M.; Bach, Fr.-W. (2011) Entwicklung von Stabelektroden für das nasse Lichtbogenschweißverfahren unter Wasser mittels Simulation von Tauchtiefen durch unbemannte DruckkammersystemeDeutscher Verband für Schweißen und verwandte Verfahren e.V, Unterwassertechnik 2011, S. 21-27
  • Hassel, T.; Petersen, M.; Jakob, H.; Bach, Fr.-W. (2011) Hot-Wire-Plasmaschneiden mit exotherm abreagierendem Zusatzwerkstoff zur Erhöhung der SchneidleistungIn: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011
  • Hassel, T.; Wolyniec, A.; Kussike, S.M.; Bierbaum, M.; Rehfeldt, D.; Bach, Fr.-W. (2011) Systematische Untersuchung von Lichtbogenschweißprozessen unter WasserDeutscher Verband für Schweißen und verwandte Verfahren e.V., Unterwassertechnik 2011, S. 16-20
    ISBN: 978-3-87155-270-0
  • Hassel, Th.; Petersen, M.; Beniyash, A.; Bach, Fr.-W. (2011) Thermal treatment of contaminated concrete surfaces as a decommissioning method for Nuclear Power Plant BuildingsProceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011, S. 129–135.
  • Hoyer, P.; Hassel, Th.; Bach, Fr.-W. (2011) Korrosions- und Verschleißschutz von Magnesiumbauteiloberflächen mittels PPA von TitanschichtenDVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275), S. 280–283.
  • Hoyer, P.; Hassel, Th.; Birr, C.; Jendras, M.; Bach, Fr.-W.; Grunau, H. (2011) Korrosionsschutzgerechte Konstruktion und Handhabung langzeitstabiler Behälter für die Lagerung schwach- und mittelradioaktiver AbfälleIn: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 622–628
  • Jakob, H.; Hassel, Th.; Köhler, A.; Bach, Fr.-W. (2011) MMC based materials as an alternative cutting material for cutting densely filled and heavily reinforced concrete structuresProceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011.
  • Jakob, H.; Petersen, M.; Hassel, Th.; Bach, Fr.-W. (2011) Entwicklung eines LSI-Brenners: Wiederentdeckung des Lichtbogen-Sauerstoff-Impuls-SchneidensDVS-Berichte Band 275; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Ham-burg vom 27. bis 29. September 2011, S. 122-129
  • Kiliclar, Y.; Engelhardt, M.; von Senden genannt Haverkamp, H.; Schwarze, M.; Vladimirov, I.; Bormann, D.; Reese, S.; Bach, Fr.-W. (2011) Combined Quasi-Static-Dynamic Forming Processes - Material Modelling, Experimental Validation and Finite Element TechnologyIn: G. Hirt (Hg.): Special edition: 10th International Conference on Technology of Plasticity, ICTP 2011. [held in Aachen, Germany on September 25th - 30th, 2011]. Düsseldorf: Verl. Stahleisen GmbH (Steel research international Special edition), S. 865–870.
  • Kremer, G.; Runge, J.; Tewes, R.; Dierkes, U.; Hassel, T.; Jakob, H.; Bach, Fr.-W.; Heger, K.; Praxl, H. (2011) Schneidladung als Zerlegeverfahren beim Rückbau von kerntechnischen Anlagen und Qualifizierung im kerntechnischen UmfeldIn: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 22-42
  • Lehmann, E.; Schmaltz, S.; Faßmann, D.; Germain, S.; Weber, C.; Löhnert, S. et al. (2011) Identifikation eines Materialmodells für den DC04 basierend auf dernumerischen Modellierung der c und experimentellen DatenM. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 13–32.
  • Milenin, A.; Kustra, P.; Seitz, J.-M.; Bach, Fr.-W.; Bormann, D. (2011) Development and Validation of a Mathematical Model of Warm Drawing Process of Magnesium Alloys in Heated Dies2011 Conference proceedings of the Wire Association International Inc. InterWire2011. Atlanta, Georgia, USA.
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011) Repair Brazing of Turbine Blades using Thermal SprayingIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 347–352.
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011) Reparaturlöten von Turbinenschaufeln mittels Thermischen SpritzensSchriftenreihe Werkstoffe und werkstofftechnische Anwendungen, Bd. 43, pp. 231–236, Chemnitz, Eigenverlag, ISBN 978-3-00-035117-8
  • Plorin, T.; Bormann, D.; Haverkamp, H.; Klose, C.; Bach, Fr.-W. (2011) Herstellung ultraleichter Magnesium-VerbundprofileHeinz Palkowski (Hg.): Abschlusskolloquium des Sonderforschungsbereichs 675: Erzeugung hochfester metallischer Strukturen und Verbindungen durch gezieltes Einstellen lokaler Eigenschaften. TU Clausthal, Institut für Metallurgie. Clausthal-Zellerfeld. S. 129 - 134.
  • Reimche, W.; Zwoch, S.; Bruchwald, O.; Bach, Fr-W (2011) Hochtemperatur-Prüftechnik ermöglicht Einblick in die Werkstoffumwandlung und Phasenausbildung bei HochleistungsbauteilenIn: DGZfP-Jahrestagung 2011 Zerstörungsfreie Materialprüfung. 30. Mai - 1. Juni 2011, Bremen ; Berichtsband. Berlin: DGZfP (Berichtsband / Deutsche Gesellschaft für Zerstörungsfreie Prüfung e.V, 127), S. Di3C2.
  • Schaper, M.; Gershteyn, G.; Clausmeyer, T.; Shevchenko, N.; Bargmann, M.; Bach, Fr.-W. (2011) Correlation between morphology of dislocation structures and macroscopic loadingsProc. ICTP 2011, 2011
  • Schmolke, S.; Andreae, A.; Biskup, C. (2011) Vergleichende Überprüfung des Einwachsverhaltens von biologischen Implantaten aus boviner Knochenkompakta und Polylalktidschrauben für die orthopädische ChirugieDeutscher Kongress für die Orthopädie und Unfallchirugie, Berlin, 25.-28. Oktober
  • Stiesch, M.; Abraham, W.-R; Hauser, H.; Müller, P. P.; Borchers, L.; Kohorst, P.; Heuer, W.; Winkel, A.; Bach, Fr.-W.; Hübsch, C.; Pfaffenroth, C.; Dempwolf, W.; Menzel, H. (2011) Materialoptimierung und Funktionalisierung dentaler Implantat-AbutmentsIn: Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK) (Hg.): Spitzenforschung in der Zahnheilkunde. Innovationen und Auszeichnungen 2011. Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK). Lampertheim: ALPHA Informations-GmbH, S. 158–165.
  • Swider, M. A.; Varahram, A.; Hassel, Th.; Bach, Fr.-W. (2011) Schweißfalttechnik, Untersuchungen und Prozessentwicklung zur Herstellung faltbarer TragstrukturenDVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275).
  • Swider, M. A.; Waltz, F.; Hoyer, P.; Hassel, Th.; Erne, M.; Möhwald, K. (2011) Joining and coating by the combination of welding and plasma spraying to define metallurgical conditions and produce protective layers with powder and nanoscale materials.2nd International Symposium on Functional Surfaces in Aachen. Aachen, 13.09.2011.
  • Varahram, A.; Bär, F.; Hassel, Th.; Overmeyer, L.; Bach, Fr.-W. (2011) Design of Folded Tubulars for Expandable Casing ApplicationsProceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE
  • Zaremba, D.; Biskup, C.; Heber, T.; Weckend, N.; Hufenbach, W.; Adam, F.; Bach, Fr.-W.; Hassel, T. (2011) Experimental evaluation of jetting methods for the surface preparation of fiber-reinforced plastics11th International Conference on Management of Innovative Technologies and 2nd International Conference on Sustainable Life in Manufacturing, Fiesa, Slovenia, 25–27 September 2011.
  • Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Gu, Z.-H. (Hrsg.) (2010) Mechanical Surface Treatment to Obtain Optically Cooperative Surfaces vis-à-vis Fringe ProjectionReflection, scattering, and diffraction from surfaces II Proceedings of SPIE Vol. 7792, S. 77920V-77920V-9. Bellingham, Wash.: SPIE, 2010.
    ISBN: 9780819482884
  • Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Wielage, B.; Wielage, B. (Hrsg.) (2010) Berührungslose Geometrieprüfung endbearbeiteter Bauteile mit optisch nicht kooperativen OberflächenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 313-317. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Bormann, D.; Meyer-Lindenberg, A.; Wriggers, P.; Seitz, J.-M.; Biermann, D. (Hrsg.) ; Tekkaya, A. E. (Hrsg.) ; Tillmann, W. (Hrsg.) (2010) Production of Magnesium Implants with Adapted PropertiesProduct Property Prediction, S. 93-99. Dortmund, 2010.
  • Bach, Fr.-W.; Hassel, T.; Biskup, C.; Hinte, N.; Schenk, A. (2010) In-process generation of water ice particles for cutting and cleaning purposes20th International Conference on Water Jetting, Graz, Austria, 20.-22. Oktober 2010, S. 275-283
    ISBN: 978-1-85598-121-8
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Neumann, M. (2010) Beitrag zum Auftraglöten und -schweißen von Panzerungen mit hoher VerschleißreserveHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 55-63. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Hartz-Behrend, K.; Prehm, J. (2010) Qualitative Vorausberechnungen der Benetzungsvorgänge beim Löten mittels Methoden der klassischen Molekulardynamik (MD)Hart- und Hochtemperaturlöten und Diffusionsschweißen. LÖT 2010 ; Vorträge und Posterbeiträge des 9. internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2010 & Brazing, high temperature brazing and diffusion bonding. Löt; Deutscher Verband für Schweißen und Verwandte Verfahren. Düsseldorf: DVS Media (DVS-Berichte, 263), S. 248–254.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010) Niedrig schmelzende Aluminiumhartlote aus dem System AlSiZnHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 117-121. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2010) Hartlöten von Edelstahl im Schutzgasdurchlaufofen mit modifizierten Ni-HartlotenHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 266-271. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2010) Fügen von Aluminium-Stahl-Hybridwerkstoffen mit zinkhaltigen Loten unter Einsatz reaktiver Gaszusätze im SchutzgasofenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 318-324. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M. (2010) Neue Lösungswege für das Reparaturlöten und -beschichten von Turbinenschaufeln: Machining Innovations Conference Tagungsband 23. und 24. November 2010 HannoverNeue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 435-447. Garbsen: PZH Produktionstechn. Zentrum, 2010.
    ISBN: 978-3-941416-78-9
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C. (2010) Entwicklung einer Fertigungstechnik für Metall-KapillardruckgießprozesseMaschinen-, Werkzeug- und Prozessentwicklung für neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, S. 3-8. Erlangen-Tennenlohe: Lehrstuhl für Kunststofftechnik Univ. Erlangen-Nürnberg, 2010.
    ISBN: 978-3-931864-49-1
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C.; Wielage, B. (Hrsg.) (2010) Metall-Kapillardruckgießen - Gießen im MikrometermaßstabTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 307-312. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Xin, L.; Schein, J.; Forster, G.; Hartz-Behrend, K.; Zimmermann, S.; Marques, J.-L.; Kirner, S.; Bobzin, K.; Bagcivan, N.; Petkovic, I. (2010) Homogenization of Coating Properties in Atmospheric Plasma Spraying - Current Results of a DFG (German Research Foundation)-Funded Research GroupThermal spray: global solutions for future application DVS-Berichte Vol. 264. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-590-9
  • Bach, Fr.-W.; Möhwald, K.; Zhang, I.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2010) Prozesskettenverkürzte Fertigung von Leichtmetall-Druckgussverbundbauteilen durch Transplantation thermisch gespritzter SchichtenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 110-120. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Schaper, M.; Yu, Z.; Nürnberger, F.; Gretzki, T.; Rodman, D.; Springer, R. (2010) Computation of the Isothermal Transformation Diagrams of 42CrMo4 Steel from Dilatometer Measurements with Continuous Cooling{Conf. Proc.}. Shanghai, China, 31.03.-02.06. 2010.
  • Behrens, B.-A.; Olle, P.; Gershteyn, G.; Voges-Schwieger, K.; (2010) Experimental and Numerical Investigations on Microstructural Evolution during a Hot Stamping ProcessTools and technologies for the processing of ultra high strength steels, S. 81-90. Graz: Verl. der Techn. Univ. Graz, 2010.
    DOI: 10.3217/978-3-85125-108-1-010
    ISBN: 978-3-85125-108-1
  • Biskup, C.; Hassel, T.; Klose, C.; Bach, Fr.-W. (2010) AWIJ Cutting of cortical bone screws20th International Conference on Water Jetting. Graz, Austria 20th – 22nd October 2010, S. 201-212
    ISBN: 978-1-85598-121-8
  • Bormann, D.; Bach, Fr.-W.; Klose, C.; Rodman, M.; Reimche, W.; Mroz, G.; Behrens, B.-A.; Weilandt, K.; Jocker, J. (2010) Werkstoffe mit sensorischen Eigenschaften für optimierte WartungsintervalleNeue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 478-486. Garbsen: PZH Produktionstechn. Zentrum, 2010.
    ISBN: 978-3-941416-78-9
  • Bormann, D.; Haverkamp, H.; Engelhardt, M.; Mroz, G.; Reimche, W.; Plorin, T.; Grittner, N.; Bach, Fr.-W.; {et al.} (2010) Arbeiten des Institutes für Werkstoffkunde auf dem Gebiet der MMCD. Sitzung des DGM-Fachausschusses "Metallische Verbundwerkstoffe". Karlsruhe, 10.11.2010.
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K.; Wielage, B. (Hrsg.) (2010) PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-VeredelungTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 86-91. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Engelhardt, M.; Haverkamp, H.; Kiliclar, Y.; Schwarze, M.; Vladimirov, I.; Bormann, D.; Bach, Fr.-W.; Reese, S.; Daehn, G. (Hrsg.) ; Zhang, Y. (Hrsg.) ; Babusci, K. (Hrsg.) ; Weddeling, C. (Hrsg.) ; Marre, M. (Hrsg.) ; Tekkaya, A. E. (Hrsg.) (2010) Characterization and Simulation of High-Speed-Deformation-ProcessesICHSF 2010, S. 229-238. Columbus, Ohio, USA, März 2010.
  • Gershteyn, G.; Jablonik, L.; Nürnberger, F.; Schaper, M.; Kneissl, A. (Hrsg.) (2010) Einfluss von Umformung und Abkühlung auf die Mikrostruktur des presshärtbaren Stahles 22MnB5Fortschritte in der Metallographie Sonderbände der praktischen Metallographie Vol. 42, S. 69-74. Frankfurt: MAT-INFO Werkstoff-Informationsges., 2010.
    ISBN: 9783883553825
  • Hassel, T.; Petersen, M.; Bach, Fr.-W. (2010) Sonderlösungen zum thermischen Trennen im Bereich des Rückbaus kerntechnischer Anlagen 4. Symposium "Stilllegung und Rückbau kerntechnischer Anlagen". Hannover, 02.11.2010.
  • Haverkamp, H.; Bach, Fr.-W. (Hrsg.) (2010) Untersuchung der Gesetzmäßigkeiten der Kontaktwechselwirkungen beim Zusammenfügen von metallischen Materialien mittels Walzen"Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme", S. 2-8. Garbsen: PZH Produktionstechnisches Zentrum, 2010.
    ISBN: 978-3-941416-59-8
  • Hinte, N.; Biskup, C.; Hassel, T.; Schilling, T.; Meyer, T.; Cebotari, S.; Tudorache, I.; Haverich, A.; Bach, Fr.-W. (2010) In-vitro Testung von Stützstrukturen zur Stabilisation von xenogenen Aortenprothesen im kardiovaskulären HochdruckberechJahrestagung der deutschen Gesellschaft für Biomaterialien (DGBM), Heilbad Heiligenstadt, November 2010
  • Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2010) Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen GfKorr-Tagung. Dresden, 28.04.2010.
  • Kerber, K.; Bach, Fr.-W. (2010) Eigenschaften der Werkstoffverbunde durch Druckguss hergestellter Verbundgussteile aus Aluminium und MagnesiumIn: Tagungsband zum Symposium Verbundwerkstoffe und Werkstoffverbunde (18. Symposium Verbundwerkstoffe und Werkstoffverbunde), S. 422–432
  • Milenin, A.; Piotr, K.; Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.; The Wire Association International, I. (Hrsg.) (2010) Production of thin wires of magnesium alloys for surgical applications2010 Conference Proceedings of The Wire Association, Inc, S. 61-70, 2010.
  • Mozgova, I.; Brückner, H.-P.; Bach, Fr.-W; Blume, H.; Hassel, T.; Kussike, S.-M.; Bierbaum, M.; Büggenam, P.; Piszczek, M. (2010) Development of a Therapeutic Device Supporting Real-Time Dynamic Verical Force Unload55. IWK - Internationales Wissenschaftliches Kolloquium, 2010, S. 468-479
    ISBN: 978-3-938843-53-6
  • Plorin, T. (2010) Herstellung und Charakterisierung lokal ausgeschäumter Rollprofile7. Fachtagung Walzprofiliern & 3. Zwischenkolloquium SFB 666. Darmstadt, 2010.
  • Reimche, W.; Bach, Fr.-W. (2010) Zerstörungsfreie Charakterisierung von Schicht- und Bauteilzuständen 4. Internes Repair Kolloquium. München, 28.-29.01.2010.
  • Reimche, W.; Bach, Fr.-W.; Denkena, B. (Hrsg.) (2010) Gentelligente Bauteilidentifikation und IntegritätsbewertungGenetik und Intelligenz, S. 11. Garbsen: PZH Produktionstechn. Zentrum, 2010.
    ISBN: 9783941416482
  • Reimche, W.; Klümper-Westkamp, H.; Vetterlein, J.; Zwoch, S.; Bach, Fr.-W. (2010) Sensorkontrolliertes Bainitisieren zur Prozesssteuerung und Qualitätssicherung in der Wärmebehandlung 83. Tagung des Wissenschaftlichen Rates der AiF. Berlin-Adlershof, 09.11.2010.
  • Schaper, M.; Gershteyn, G.; Grydin, O.; Fassmann, D.; Yu, Z.; Nürnberger, F. (2010) Modellierung des Werkstoffverhaltens beim Warmumformen höchstfester Stähle auf der Basis mikrostruktureller VorgängeMerklein (Hg.) – Warmumformung von höchstfesten Vergütungsstählen: Tagungsband zum 5. Erlanger Workshop Warmblechumformung, S. 141-160. Bamberg: Meisenbach GmbH-Verlag, 2010.
    ISBN: 978-3-87525-311-5
  • Schilling, T.; Brandes, G.; Cebotari, S.; Tudorache, I.; Hilfiker, A.; Meyer, T.; Biskup, C.; Hinte, N.; Hassel, T.; Bach, Fr.-W.; Haverich, A. (2010) Biokompabilität von Magnesiumgittern zur Unterstützung von regenerativen Therapien in der kardiovaskulären Chirugie44. Jahrestag der DGBMT, BMT 2010, Rostock Supplement zur Biomedizinische Technik / Biomedical Engineering, De Gruyter Verlag ISSN 0939-4990
  • Schilling, T.; Cebotari, S.; Tudorache, I.; Hilfiker, A.; Meyer, T.; Biskup, C.; Bormann, D.; Bach, Fr.-W.; Haverich, A. (2010) Stabilizing autologus intestine vascularized cardiac patch material by magnesium alloys39th Annual Meeting German Society for Thoracic and Cardiovascular Surgey 2010, 14.-17. February 2010
  • Schnick, M.; Füssel, U.; Hertel, M.; Schuster; Krink, V.; Petersen, M.; Hassel, T.; Bach, Fr.-W.; Ko{o}cak, M. (Hrsg.) (2010) Plasma keyhole welding of mild steel plates for ship yard productionsIstanbul IIW 2010, S. 479-483. Istanbul: GEV, 2010.
    ISBN: 978-6-05-614191-1
  • Tiemann, S.; Bach, Fr.-W. (Hrsg.) (2010) Flussmittelfreies Ofenlöten von Aluminium-Stahl-Hybridstrukturen in reaktiven Prozessgasen"Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme", S. 10-17. Garbsen: PZH Produktionstechnisches Zentrum, 2010.
    ISBN: 978-3-941416-59-8
  • Turichin, G.; Valdaytseva, E.; Bach, Fr.-W.; Beniyash, A.; Korablev, V. V. (Hrsg.) (2010) Dynamic processes at high speed laser and electron beam treatment of materialsResults of joint research activity of scientists from Saint-Petersburg State Polytechnical University and Leibniz University of Hannover., S. 91-101. Saint-Petersburg: Polytechn. Univ. Publ. House, 2010.
    ISBN: 978-5-7422-2652-9
  • Varahram, A.; Srisupattarawanit, T.; Hassel, T.; Schiefer, F.; Bach, Fr.-W.; Ostermeyer, G.-P. (2010) Konstruktion gefaltete und aufweitbare Rohre zur Bohrlochauskleidung3. Nano und Material Symposium Niedersachsen. gebo Forschungsverbund Geothermie und Hochleistungsbohrtechnik. Celle, 07.10.2010.
  • Yu, Z.; Nürnberger, F.; Gretzki, T.; Schaper, M.; Bach, Fr.-W.; CADFEM (Hrsg.) (2010) Simulation der Eigenspannungsentwicklung beim Abschrecken von Ritzelwellen aus 42CrMo4 mittels SpraykühlungANSYS Conference & 28th CADFEM Users' Meeting 2010, 2010.
  • Angrisani, G. L.; Klose, C.; Bormann, D.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009) Influence of Alloy Composition and Heat Treatment on Damping Characteristics of Magnesium Alloys8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 270–281
    ISBN: 3-527-32732-0
  • Bach, Fr.-W.; Behrens, B.-A.; Gretzki, T.; Hassel, T.; Odening, D.; Neugebauer, R. (Hrsg.) (2009) Integrierte Wärmebehandlung komplexer Präzisionsschmiedebauteile mittels einer prozess- und geometrieangepassten Zwei-Phasen-SpraykühlungProceedings Berichte aus dem IWU Vol. 52, S. 283-301. Auerbach: Verl. Wiss. Scripten, 2009.
    ISBN: 978-3-937524-93-1
  • Bach, Fr.-W.; Beniyash, A.; Konya, R.; Szelagowski, A.; Hassel, T. (2009) Non-vacuum electron beam diagnostics9-th International Conference on Electron Beam Technologies, 1-4 June, Varna, Bulgaria; ISSN 0861-4717, S.52-58, Band 44, 5-6/2009
  • Bach, Fr.-W.; Beniyash, A.; Konya, R.; Szelagowski, A.; Hassel, T. (2009) Non-vaccum electron beam diagnosticsProceedings of 9th International Conference on Electron Beam Technologies, 1-4 June 2009, Varna, Bulgaria, p.52-58, ISSN 0861-4717
  • Bach, Fr.-W.; Hassel, T.; Schenk A.; Biskup, C. (2009) Materialbearbeitung mit Hochdruckwasserstrahlen - Anwendungsgebiete und EntwicklungstrendsVortragsband zum Fachkolloquium „Innovative Technologien für die Bearbeitung metallischer und nichtmetallischer Werkstoffe“. Technische Universität Dresden, Dresden, 25. September 2009.
    ISBN: 978-3-86780-133-1
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2009) Herstellung von beschichteten Druckgussbauteilen durch prozessintegrierte Applikation thermisch gespritzter Schichten in GussformenTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 36, S. 79-86. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009) Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 397-402. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009) PVD-Schichtabformung im µm-BereichTagungsband des zweiten Workshops für Optische Technologien, 17.11.2008, S. 167-169. Garbsen: Verlag PZH Produktionstechnisches Zentrum GmbH, 2009.
    ISBN: 978-3-941416-17-8
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D. (2009) Suspensionsplasmaspritzen thermisch aktivierbarer triboaktiver SchichtverbundeTagungsband zum 17. Symposium Verbundwerkstoffe und Werkstoffverbunde, 01.-03.04.2009, Bayreuth, S. 627-634. Bayreuth, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D.; Uhlenwinkel, V. (Hrsg.) (2009) Achieving Thin Functional Coatings by Mixing of Nanosized Feedstock Powders in the Suspension Plasma Spraying ProcessProceedings of the 4´th International conference on Spray Deposit in and Melt Atomization, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009) Basic Principles to Obtain Oxide Ceramic Coating Systems with Reduced Sliding Wear by Suspension Plasma SprayingThermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 200-206, 2009.
    ISBN: -13978-1-61503-004-0
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2009) Werkstoffkundliche und Prozesstechnische Aspekte zum Hartlöten im SchutzgasdurchlaufofenTagungsband des 4. Aachener Oberflächenkolloquium Schriftenreihe Oberflächentechnik, S. 29-44. Aachen: Shakerverlag, 2009.
    ISBN: 1864-0796
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2009) Schutzgasofenlöten von Aluminium und Stahl in reaktiven ProzessgasenTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 418-423. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Hoyer, P.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T. (2009) Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die MikroumformtechnikGrößeneinflüsse bei Fertigungsverfahren, Beiträge zum Abschlusskolloquium des SPP 1138, Bonn 11.-12.02.2009, S. 79-95. Bremen: BIAS Verlag, 2009.
    ISBN: 978-3-933762-29-0
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Wielage, B. (Hrsg.) (2009) Löten von hochlegierten Stählen, Nickel- und Titanlegierungen unter Ausbildung stängelkristallitverstärkter LötnähteTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 403-409. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Hartz, K.; Schein, J.; Forster, G.; Zimmermann, S.; Marques, J.-L.; Bobzin, K.; Bagcivan, N.; Parkot, D.; Petkovic, I.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009) Homogenization of Coating Properties in Atmospheric Plasma Spraying - New Results of a DFG (German Research Foundation)-Funded Research GroupThermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 762-767, 2009.
    ISBN: -13978-1-61503-004-0
  • Bach, Fr.-W.; Petersen, M.; Zwoch, S.; Reimche, W.; Hassel, T. (2009) Hochleistungsplasmaschweißen im Schiffbau: 10. Fachtagung "Schweißen im Schiffbau und Ingenieurbau"Schweißen im Schiffbau und Ingenierbau. 10. Sondertagung 22. und 23. April 2009 in Hamburg, S. 105–113
  • Bach, Fr.-W.; Plorin, T.; Tillmann, W. (Hg.) (2009) Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme.Kolloquium Graduiertenkolleg 1378/1. Leibniz Universität Hannover; Technische Universität Dortmund; PZH Produktionstechnisches Zentrum. Garbsen: PZH Produktionstechnisches Zentrum GmbH; PZH Produktionstechn. Zentrum.
  • Bach, Fr.-W.; Rodman, M.; Hepke, M.; Bormann, D.; Kainer, K. U. (Hrsg.) (2009) Investigation of the Mechanical Properties of Magnesium Alloy AZ31 Sheets due to a Straightening Process8th International Conference on Magnesium Alloys and their Applications, S. 830-835. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Behrens, B.-A.; Bach, Fr.-W.; Puchert, A.; Pfahl, A.; Rudskoj, A. I. (Hrsg.) (2009) Increasing the Wear Resistance of Hot Working Tool Steel by Lowering the Eutectoid TemperatureSovremennye metalliceskie materialy i technologii, S. 46-56. Sankt-Peterburg: Izdat. Politechn. Univ., 2009.
    ISBN: 978-5-7422-2308-5
  • Besdo, S.; Biskup, C.; Klodmann, J.; Jacob, H. G.; Glasmacher, B.; Bach, Fr.-W. (2009) Simulation of the fixation of a cruciate ligament reconstruction with interference srewsProceedings of the XXXVI European Society for Artificial Organs (ESAO) Congress, 2.-5. September 2009, Compiègne, France
  • Biskup, C.; Hepke, M.; Grittner, N.; Hassel, T.; Bormann, D.; Hoyer, P.; Schilling, T.; Hilfiker, A.; Cebotari, S.; Tudorache, I.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2009) Testing of Stabilizing Structures Made of Magensium Alloys for the Cardiovascular Surgery8th International Conference on Magnesium Alloys and their Applications, S. 1149-1155., Weimar, Germany, 26.-29. October 2009
    ISBN: 978-3-527-32732-4
  • Biskup, C.; Hepke, M.; Grittner, N.; Plorin, T.; Hassel, T.; Bormann, D.; Schilling, T.; Hilfiker, A.; Cebotari, S.; Tudorache, I.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2009) AWIJ of cutting structures made of magnesium alloys for the cardiovascular surgeyAmerican WJTA Conference and Expo 2009, Houston, USA, 18.-20. August 2009, paper 1A
  • Borchers, L.; Kellner, T.; Hübsch, C.; Jendras, M.; Bach, Fr.-W.; Kohorst, P.; Stiesch, M. (2009) Strength of zirconia after mechanical, thermal, and hydrothermal loadingIn: International Association for Dental Research (Hg.): 87th General Session of the International Association for Dental Research and Ex-hibition. International Association for Dental Research. Alexandria, VA, USA: International Association for Dental Research, S. 532.
  • Bormann, D.; Rodman, M.; Klose, C.; Kerber, K.; Reimche, W.; Wurz, M. C.; Bach, Fr.-W. (2009) Soft and Hardmagnetic Magnesium Materials as Components of Structural ElementsKainer, K. U. (Hrsg.): Magnesium; 8th International Conference on Magnesium Alloys and their Applications, S. 27-32. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Danilovich, D.; Luzhkova, A.; Ordanyan, S.; Jendras, M.; Bach, Fr.-W.; Hübsch, C. (2009) Joint synthesis of components in the system TiC-TiB2In: Deutsche Gesellschaft für Kristallographie (Hg.): 17. Jahrestagung der Deutschen Gesellschaft für Kristallographie. München: Oldenbourg Verlag, S. 116–117
  • Engelhardt, M.; Broer, C.; Bosse, M.; Heidenblut, T.; Bormann, D.; Bach, Fr.-W. (2009) Investigations on Extruded Seams in Magnesium Alloy Hollow SectionsK. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 608–614.
  • Grittner, N.; Hepke, M.; Plorin, T.; Biskup, C.; Bosse M.; Bormann, D.; Breidenstein, B.; Behrens, B.-A.; Bach, Fr.-W. (2009) Extrusion of Split Strips for Roll Forming8th International Conference on Magnesium Alloys and their Applications, S. 503-508. Weimar, Germany 26.-29. October
    ISBN: 978-3-527-32732-4
  • Grydin, O.; Batyrshina, E.; Bach, Fr.-W.; CADFEM (Hrsg.) (2009) Mathematische Modellierung des Gießens von dünnen Blechen nach dem Zwei-Rollen-VerfahrenANSYS Conference & 27th CADFEM Users' Meeting, 2009.
  • Grydin, O.; Schaper, M.; Bach, Fr.-W.; Howard, S. M. (Hrsg.) (2009) Analysis of microstructure evolution during cold deformation of air-hardening steel LH800EPD congress 2009, S. 91-98. Warrendale, Pa.: TMS, 2009.
    ISBN: 978-0-87339-732-2
  • Hassel, T.; Wolyniec, A.; Kussike, S. M.; Bach, Fr.-W. (2009) Entwicklung von Stabelektroden für das nasse Unterwasserschweißen - Untersuchung über den Einfluss der UmhüllungDVS-Deutscher Verband f. Schweißen u. verwandte Verfahren e. V, D. V.S. (Hg.) (2009): Unterwassertechnik. Tagung in Hamburg 03.-04.03.2010: DVS Media.
  • Hassel, Th.; Swider, M. A.; Waltz, F.; Möhwald, K.; Bach, Fr.-W.; Behrens, P. (2009) Protection of Magnesium Welds by the Combination of TIG Welding with a Simultaneous Suspension Plasma Spraying Process for the Application of Nanoscaled Magnesium Fluoride Layers to Prevent CorrosionK. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH.
  • Haverkamp, H.; Bach, Fr.-W. (Hrsg.) ; Plorin, T. (Hrsg.) ; Tillmann, W. (Hrsg.) (2009) Walzplattierte LeichtmetallverbundeHerstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme, S. 1-6. Garbsen: PZH Produktionstechnisches Zentrum GmbH and PZH Produktionstechn. Zentrum, 03.05.2009.
    ISBN: 978-3-941416-14-7
  • Hepke, M.; Bormann, D.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009) Upward Direct Chill Casting of Magnesium Alloys8th International Conference on Magnesium Alloys and their Applications, S. 424-430. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2009) Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen GfKorr-Tagung. Ottobrunn, 22.04.2009.
  • Hoyer, P.; Bormann, D.; Bosse, M.; Bach, Fr.-W.; Jendras, M.; Denkena, B.; Lucas, A.; Biermann, D.; Pantke, K.; Kainer, K. U. (Hrsg.) (2009) Influence of form, surface and subsurface areas on the corrosion behaviour and the mechanical properties of magnesium alloys8th International Conference on Magnesium Alloys and their Applications, S. 1288-1294. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Hoyer, P.; Möhwald, K.; Bach, Fr.-W.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T.; Vollertsen, F. (Hrsg.) (2009) Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die MikroumformtechnikGrößeneinflüsse bei Fertigungsprozessen, S. 79-95, 2009.
    ISBN: 978-3-933762-29-0
  • Hübsch, C.; Bach, Fr.-W.; Jendras, M.; Borchers, L.; Stiesch, S. (2009) Observation of hydrothermal induced phase transformation of ZrO2 ceramics for dental applications11th International and Interdisciplinary Symposium Biomaterials and Biomechanics, 05-07.März 2009, Essen, S. 127-128
  • Hübsch, C.; Buhl, J.-C.; Bach, Fr.-W.; Jendras, M. (2009) Quantiative X-ray analysis of hydrothermal induced phase transformation of ZrO2 ceramics17. Jahrestagung der Deutschen Gesellschaft für Kristallographie,, Hannover. Deutsche Gesellschaft für Kristallographie. Hannover, 09.03.2009.
  • Jendras, M.; Bach, Fr.-W.; Springer, R.; Gershteyn, G.; Hübsch, C.; Bührig-Polaczek, A. (Hrsg.) (2009) Beobachtung der hydrothermalen Alterung von ZrO2 Keramiken mittels mikroskopischer und röntgenographischer VerfahrenFortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 219-225. Frankfurt: Werkstoff-Informationsges., 2009.
    ISBN: 978-3-88355-376-4
  • Kerber, K.; Bormann, D.; Möhwald, K.; Holländer, U.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009) Compound Casting of Aluminium and Magnesium-Alloy by High Pressure Die Casting8th International Conference on Magnesium Alloys and their Applications, S. 390-397. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Klose, C.; Angrisani, G. L.; Bormann, D.; Bach, Fr.-W. (2009) Vibration Treatment for Microstructural Grain Refinement of Magnesium Alloys using the Low Pressure Die Casting Process8th International Conference on Magnesium Alloys and their Applications, S. 275-281. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Krause, C.; Springer, R.; Biasutti, F.; Gershteyn, G.; Bach, Fr.-W.; {Arbeitsgemeinschaft Wärmebeh(Hrsg.) ;lung und Werkstofftechnik e.V.} (Hrsg.) (2009) Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach SDPR - Hochhochgeschwindigkeits-Austenitisieren mit anschließendem AbschreckenWerkstofftechnik, Fertigungs- und Verfahrenstechnik. 65. Kolloquium für Wärmebehandlung. Rhein-Main-Hallen Wiesbaden, 2009.
  • Kujat, B.; Bormann, D.; Günther; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009) Grain Refinement of AZ91 with Hexagonal Boron Nitride8th International Conference on Magnesium Alloys and their Applications, S. 302-307. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Murray, N.; Beniyash, A.; Konya, R.; Bach, Fr.-W.; Hassel, Th. (2009) EBWC-006 Non Vacuum EB CuttingAWS - American Welding Society (Hg.): 2009 CD IEBW Proceedings.
  • Nowak, M.; Grydin, O.; Nürnberger, F.; Schaper, M.; CADFEM (Hrsg.) (2009) Modellierung einer prozessintegrierten Spraykühlung beim Strangpressen von aushärtbaren AluminiumlegierungenANSYS Conference & 27th CADFEM Users' Meeting. 18.-20.11.2009 Congress Center Leipzig
  • Plorin, T.; Bormann, D.; Bach, Fr.-W. (2009) Manufacture and characterization of magnesium foams for ultra-lightweight applicationsProceedings Materials Science and Technology (MS&T), S. 2366-2374. Red Hook, NY: Curran, Oktober 2009.
  • Plorin, T.; Bormann, D.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2009) Ausgeschäumte Profile: Magnesiumschäume für den Einsatz in VerbundprofilenPotenziale metallischer Werkstoffe lokal nutzen, S. 153-159. Clausthal Zellerfeld: Oberharzer Druckerei Fischer & Thielbar GmbH, 2009.
  • Reimche, W.; Diebel, M.; Mroz, G.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2009) Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen7. Industriekolloquium "Potenziale metallischer Werkstoffe lokal nutzen", S. 93-107. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2009.
    ISBN: 3923605242
  • Reimche, W.; Diebel, M.; Mroz, G.; Frackowiak, W.; Bach, Fr.-W.; Borsutzki, M. (Hrsg.) (2009) Einstellung beanspruchungsgerechter Werkstoffeigenschaften durch Verfestigung und strukturierte WärmebehandlungFortschritte der Kennwertermittlung für Forschung und Praxis, S. 391-398. Düsseldorf: Stahleisen, 2009.
    ISBN: 9783514007697
  • Reimche, W.; Mroz, G.; Bruchwald, O.; Bach, Fr.-W.; (2009) Bauteilinhärente Belastungssensoren und Informationsspeicherung in der RandzoneIn: Michael Borsutzki (Hg.): Fortschritte der Kennwertermittlung für Forschung und Praxis. Bad Neuenahr. Tagung Werkstoffprüfung. Düsseldorf: Stahleisen, S. 383–390.
    ISBN: 9783514007697
  • Reimche, W.; Zwoch, S.; Bach, Fr.-W.; Klümper-Westkamp, H.; Zoch, H.-W.; Borsutzki, M. (Hrsg.) (2009) Sensortechnik zur diskreten Erfassung von Umwandlungsvorgängen beim BainitisierenFortschritte der Kennwertermittlung für Forschung und Praxis, S. 299-308. Düsseldorf: Stahleisen, 2009.
    ISBN: 9783514007697
  • Reimche, W.; Zwoch, S.; Diebel, M.; Bach, Fr.-W. (2009) Entwicklung einer Wirbelstromtechnik zur Nullspaltfindung und Prozessführung von Hochleistungs-Strahl-SchweißverfahrenDGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 881-891. Münster, 2009.
  • Reimche, W.; Zwoch, S.; Klotz, J.; Bach, Fr.-W. (2009) Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von BolzenschweißverbindungenDGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 984-995. Münster, 2009.
  • Scheuer, R.; Mertiniy, P.; Bormann, D. (2009) Analysis of surface strains and leakage behaviour in composite pipes and vessels using digital image correlation techniqueProceedings of the ASME 2009 Pressure Vessels & Piping Division Conference Vol. PVP2009-77522, S. 449-455. New York: ASME, July 2009.
  • Seitz, J.-M.; Bormann, D.; Stahl, J.; Schumacher, S.; Kietzmann, M.; Kramer, S.; Schwab, B.; Lenarz, T.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009) The Potential for Magnesium Alloys Containing ~Neodymium in Medical Engineering8th International Conference on Magnesium Alloys and their Applications, S. 1189-1194. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Springer, R.; Gershteyn, G.; Hoffmann, S.; Bach, Fr.-W.; Bleck, W.; Bührig-Polaczek, A. (Hrsg.) (2009) Untersuchung des Deformationsreliefs an Oberflächen metallischer Werkstoffe mittels konfokaler Mikroskopie zur Beschreibung des FließverhaltensFortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 145-149. Frankfurt: Werkstoff-Informationsges., 2009.
    ISBN: 978-3-88355-376-4
  • Springer, R.; Gershteyn, G.; Schaper, M.; Merklein, M. (Hrsg.) ; Lechler, J. (Hrsg.) (2009) Transmissionselektronenmikroskopische Bestimmung der Phasenanteile von pressgehärtetem Vergütungsstahl 22MnB5 zur Verwendung in der numerischen ProzessanalyseTagungsband zum 4. Erlanger Workshop Warmblechumformung. 11. November 2009, S. 33-44. Bamberg: Meisenbach, 2009.
    ISBN: 9783875252989
  • Springer, R.; Gerstheyn, G.; Schaper, M. (2009) Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach SDPR – Hochhochgeschwindigkeits-Austenitisieren mit anschließendem Abschrecken M. Merklein und J. Lechler (Hg.): Tagungsband zum 4. Erlanger Workshop Warmblechumformung. 11. November 2009. DFG ortsverteilte Forschungsgruppe 552 Erlangen 11. November 2009. Bamberg: Meisenbach, S. 33–44
  • Tiemann, S.; Bach, Fr.-W. (Hrsg.) ; Plorin, T. (Hrsg.) ; Tillmann, W. (Hrsg.) (2009) Flussmittelfreies Ofenlöten in reaktiven ProzessgasenHerstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme, S. 7-12. Garbsen: PZH Produktionstechnisches Zentrum GmbH and PZH Produktionstechn. Zentrum, 03.05.2009.
    ISBN: 978-3-941416-14-7
  • Yu, Z.; Nürnberger, F.; Gretzki, T.; Schaper, M.; Bach, Fr.-W. (2009) Simulation of microstructure and residual stress development in cylinders of AISI 4140 during quenching by spray cooling and following temperingMaterials Science & Technology Conference and Exhibition 2009 Vol. 4, S. 2422-2433. Red Hook, NY: Curran, 2009.
    ISBN: 978-161567636-1
  • Bach, Fr.-W.; Bormann, D.; Walden, L.; Kleiner, M. (Hrsg.) (2008) Influence of Forming Rate on the Microstructure and Properties of Materials subjected to Electromagnetic Forming: A SynopsisICHSF 2008, S. 55-64. Dortmund: Technische Universität Dortmund, 2008.
  • Bach, Fr.-W.; Drößler, B.; Möhwald, K. (2008) Thermally sprayed coatings with stochastic microstructures for thermomechanically high stressed surfaces Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Erne, M.; Möhwald, K.; Wielage, B. (Hrsg.) (2008) Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaf-ten von thermisch gespritzten SchichtenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 66-72. Chemnitz: Eigenverlag, 2008. Online verfügbar unter http://www.worldcat.org/oclc/318648539 Weitere Informationen
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2008) Oberflächenbehandlungen von Polymeren und Werkzeugen zur PolymerbearbeitungFahlbusch, Pfalz (Hg.) 2008 – Tagungsband Hannoversches Zentrum für Optische Technologien; Workshop Optische Technologien
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008) Development of near net shape coatings for wear and corrosion protectionTagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T.; Scheer, C. (2008) Characterisation of thermally sprayed near net shape oxide ceramic and cermet coatings by acoustic emission analysisTagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Wielage, B. (Hrsg.) (2008) Optimierung von Eisenbasisfülldrähten für das Lichtbogenspritzen mittels statistischer MethodenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 73-79. Chemnitz: Eigenverlag, 2008.
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Bobzin, K.; Bagcivan, N.; Petkovic, I.; Schein, J.; Forster, G.; Zimmermann, S. (2008) Homogenization of coating properties in Atmospheric Plasma Spraying - technical objectives and first results of a DFG funded research group Proc. International Thermal Spray Conference, June 2-4, 2008, Maastricht, The Netherlands, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C.; Wielage, B. (Hrsg.) (2008) Neue Entwicklungen beim Hartlöten im SchutzgasdurchlaufofenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 209-214. Chemnitz: Eigenverlag, 2008.
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2008) Verfahrenskombinationen und Hybride aus thermischem Beschichten und Fügen3. Aachener Oberflächentechnik-Kolloquium 12.12.2008, S. 31-50. Aachen: Shaker Verlag, 2008.
    ISBN: 978-3-8322-7831-1
  • Bach, Fr.-W.; Schaper, M.; Bormann, D.; Reimche, W.; Mroz, G.; Rodman, M. (2008) Investigation of magnetic magnesium alloys4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.
  • Bach, Fr.-W.; Schaper, M.; Grydin, O.; Tekkaya, A. E.; Brosius, A.; Cwiekala, T.; Svendsen, B.; Barthel, C. (2008) Efficient modeling and calculation of sheet metal forming using steel LH800Steel Research int., Special Edition to 12th International Conference "Metal Forming" Vol. 2008, S. 99-105, 2008.
  • Bach, Fr.-W.; Schenk, A.; Rümenapp, T.; Brüggemann, P. (2008) Rückbau kerntechnischer AnlagenTagungsband des 6. Steinkolloquiums des Instituts für Fertigungstechnik und Werkzeugmaschinen. Hannover
  • Bernard, M.; Bombosch, S.; Reimche, W.; Bach, Fr.-W. (2008) Nachweis von Härterissen im Verzahnungsbereich von Zahnrädern mit Thermographie und WirbelstromtechnikDGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Biskup, C.; Schenk, A.; Bach, Fr.-W. (2008) Cutting perfomance comparison of the AWIJ technique with intake of abrasive/air-mixture or supsension as well as the AWSJ19th International Conference on Water Jetting, Nottingham, UK, 15.-17. Oktober 2008, S. 155-168
  • Böhm, V.; Scheer, C.; Reimche, W.; Bach, Fr.-W. (2008) Klassifizierung von Getriebeschäden mit Schwingungsanalyse und WirbelstromtechnikDGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Bosse, M.; Hoyer, P.; Bach, Fr.-W.; Bormann, D. (2008) Influence of cutting and non-cutting processes on the corrosion behavior and the mechanical properties of magnesium alloysSupplemental proceedings, TMS 2008 137th annual meeting & exhibition. : [held March 9 - 13, in New Orleans, Louisiana, USA]. Warrendale, Pa.: TMS, S. 383–388
    ISBN: 9780873397179
  • Hassel, T.; Linzunkova, Y.; Wolyniec, A.; Bach, Fr.-W. (2008) Herstellung und Entwicklung von selbstschützenden Doppelmantelfülldrahtelektroden zum kontinuierlen UnterwasserschweißenDie Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl., S. 83–88
  • Höh, N. v. d.; Rechenberg, B. v.; Bormann, D.; Lucas, A.; Meyer-Lindenberg, A. (2008) Influence of different surface machining treatments of resorbable magnesium alloy implants on degradation: EDX-analysis and histology resultsBiomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutschen Gesellschaft für Biomaterialien. Duisburg, S. 48–49
  • Klose, C.; Angrisani, G. L.; Wienecke, S.; Männer, J.; Yelbuz, T. M.; Bormann, D.; Bach, Fr.-W. (2008) 3D-Darstellung des embryonalen Herzen mittels Mikro-Computer-Tomographie (Mikro-CT): Erste Ergebnisse einer MachbarkeitsstudieJochen Weil (Hg.): 40. Jahrestagung der Deutschen Gesellschaft für Pädiatrische Kardiologie, 01.09.2008. Clinical Research in Cardialogy. Sonderdruck. Steinkopff (97), S. 674.
  • Klümper-Westkamp, H.; Vetterlein, J.; Lütjens, J.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2008) Bainite sensor - A new tool for process and quality control of the bainite transformationProc. European Conf. on Heat Treatment 2008, Innovation in Heat Treatment for Industrial Competetiveness (ECHT 2008), 07.-09.05.2008, Verona, Italien, Associazione Italiana di Metallurgia/AIM (Hrsg.), 2008, auf CD-ROM. – ISBN 88-85298-64-8
  • Kohorst, P.; Tegtmeyer, S.; Biskup, C.; Bach, Fr.-W.; Stiesch-Scholz, M. (2008) Einfluss des Abrasivmediums bei der Dentinbearbeitung mittels WasserabrasivstrahlverfahrenJahrestagung der Deutschen Gesellschaft für Zahn-, Mund- und Kieferheilkunde, Poster3, Stuttgart, Oktober 2008.
  • Lau, K.; Konya, R.; Bach, Fr.-W. (2008) Untersuchungen der Eignung des Elektronenstrahlschweißens an Atmosphäre zur Verarbeitung von höherfesten, verzinkten KarosseriebaustählenDie Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl.
  • Meyer-Lindenberg, A.; Thomann, M.; Krause, A.; Krause, C.; Bormann, D.; Hassel, T.; Windhagen, H. (2008) Influence of magnesium fluoride coating of degradable magnesium implants (MgCa0,8%) on the degradation behavior54th Annual Meeting of the Orthopaedic Research Society Vol. 33, 2008.
  • Mroz, G.; Reimche, W.; Bach, Fr.-W. (2008) Acquisition of Discrete Component and Loading Information in the Component's Edge Re-gion Using Innovative Sensor Technology4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.
  • Nürnberger, F.; Yu, Z.; Wilkening, L.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; CADFEM (Hrsg.) (2008) Simulation der Eigenspannungsentwicklung beim Abschrecken von Zylindern aus 42CrMo4 mittels SpraykühlungANSYS Conference & 26th CADFEM Users' Meeting, 2008.
  • Psyk, V.; Gershteyn, G.; Demir, O. K.; Brosius, A.; Tekkaya, A. E.; Schaper, M.; Bach, Fr.-W.; Kleiner, M. (Hrsg.) (2008) Process Analysis and Physical Simulation of Electromagnetic Joining of Thin-walled PartsProceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 181–190
    ISBN: 3-9809535-3-X
  • Reimche, W.; Bernard, M.; Bombosch, S.; Scheer, C.; Böhm, V.; Bach, Fr.-W. (2008) Entwicklung und Qualifizierung von Prüftechniken zur Prozessüberwachung und Qualitäts-sicherung in der Fertigung9. DELTA TEST Fachtagung 2008, 12.-14. November 2008
  • Reimche, W.; Denkena, B. (Hrsg.) (2008) Gentelligente Bauteilidentifikation und IntegritätsbewertungGenetik und Intelligenz - neue Wege in der Produktionstechnik, S. 10. Garbsen: PZH Produktionstechnisches Zentrum, 2008.
    ISBN: 9783939026815
  • Reimche, W.; Zwoch, S.; Böhm, V.; Bach, Fr.-W.; Vetterlein, J.; Klümper-Westkamp, H.; Zoch, H.-W. (2008) Entwicklung einer prozessfähigen Prüftechnik zum sensorkontrollierten Bainitisieren in der WärmebehandlungDGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Risch, D.; Gershteyn, G.; Dudzinski, W.; Beerwald, C.; Brosius, A.; Schaper, M.; Tekkaya, A. E.; Bach, Fr.-W.; Kleiner, M. (Hrsg.) (2008) Design and Analysis of a Deep Drawing and Inprocess Electromagnetic Sheet Metal Forming ProcessProceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 201–212
    ISBN: 3-9809535-3-X
  • Scheer, C.; Reimche, W.; Bach, Fr.-W. (2008) Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavlet-Transformation.DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008) Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer WirbelstromsensorikDGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Tekkaya, A.E; Brosius, A.; Cwiekala, T.; Bach, Fr.-W.; Grydin, O.; Schaper, M.; Svendsen, B.; Barthel, C. (2008) Zeiteffiziente Prozesskettenmodellierung und -berechnung in der Blechumfor-mung und -verarbeitungIn: MEFORM 2008. Simulation von Umformprozessen. Institut für Metallformung, TU Bergakademie Freiberg. Freiberg, Deutschland: ACATRAIN e.V., S. 262–274.
  • Thomann, M.; Krause, C.; Bormann, D.; Höh, N. v. d.; Windhagen, H.; Meyer-Lindenberg, A. (2008) Comparison of the resorbable magnesium alloys LAE442 and MgCa0,8 concerning their mechanical properties, gradient of degradation and bone-implant-contact after 12 months implantation in rabbit modelBiomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutschen Gesellschaft für Biomaterialien. Duisburg, S. 107–108
  • Wadouh, T.; Besdo, S.; Klose, C.; Glasmacher, B. (2008) Zerstörungsfreie Untersuchungen an explantierten HerzklappenprothesenM. Lange (Hg.): Biomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutsche Gesellschaft für Biomaterialien. Duisburg, S. 87.
  • Bach, F.; Denkena, B.; Bouzakis, K.; Geiger, M. (Hrsg.) (2007) Proceedings of the 6th International Conference THE Coatings 2007Hannover, 25.-26. Oktober 2007. Garbsen: PZH Produktiontechnisches Zentrum GmbH Weitere Informationen
  • Bach, Fr.-W.; Behrens, B.-A.; Möhwald, K.; Bistron, M.; Deißer, T. A. (2007) Wear reducing measures on forging dies by application of technical surfaces Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 23-32, 2007.
    ISBN: 978-3-939026-64-8
  • Bach, Fr.-W.; Biskup, C.; Kremer, G.; Kirsch, L.; Schmolke, S. (2007) Investigation of the Abrasive Water Injection Jet Drilling Process in Cortical BoneProceedings of the 2007 American WJTA Conference and Expo, Aug 2007, Houston, USA, paper 1-D
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Krause, C.; Höh, N. v. d.; Meyer-Lindenberg, A. (2007) Absorbable Hybrid Implants1st Symposium on Intelligent Implants. Biometrology, Telemetry, Manufacturing. Garbsen, 9. - 10.Mai 2007. Produktionstechnisches Zentrum Hannover; Medizinische Hochschule Hannover. Hannover
  • Bach, Fr.-W.; Bormann, D.; Plorin, T.; Palkowski, H. (Hrsg.) (2007) Lokal ausgeschäumte, profilgewalzte, geschlossene ProfileHochfeste Strukturen, S. 35-42. Clausthal Zellerfeld: Technische Universität Clausthal, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Wielage, B. (Hrsg.) (2007) Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 125-129. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.-A.; Kamps, T.; Bistron, M. (2007) Keramik-Metall-Verbundwerkzeuge für die MetallbearbeitungTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 52-58. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2007) Thermally Sprayed Coatings with Stochastic Microstructure for Improved Lubricant RetentionProceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 317-322, 2007.
    ISBN: 978-3-939026-64-8
  • Bach, Fr.-W.; Möhwald, K.; Erne, M. (2007) Diamantimprägnieren durch Thermisches Spritzen als Verfahren zur SchleifwerkzeugbeschichtungBernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 286-291. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Hartz, K. (2007) Metall-Kapillardruckgießen und Dampfphasen-Schmelzinfiltration: Zwei innovative Verfahren für das Herstellen metallischer MikrobauteileThomas Gessner (Hg.): Proceedings / Mikrosystemtechnik-Kongress 2007. 15. - 17. Oktober 2007 in Dresden ; gemeinsame Veranstaltung von: Bundesministerium für Bildung und Forschung (BMBF), VDE Verband der Elektrotechnik Elektronik Informationstechnik. Berlin, Offenbach: VDE-Verl, S. 123–126
    ISBN: 978-3-8007-3061-2
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2007) Flammlöten von AluminiumschmiedeteilenBernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 202-212. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Hartz, K.; Nicolaus, M. (2007) Gas/Solid-TLP-Bonding Ein neues Verfahren zum Herstellen und Fügen von Miniatur- und MikrobauteilenTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 319-324. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007) Entwicklung eines neuen Produktionsverfahrens für die Fertigung komplexer Metallverbunde- Gas/Solid-TLP-BondingTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 231-236. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007) Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -Drähte und -Folien Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 393-397. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2007) SCIB - Self-Cleaning Inert-Gas Brazing? Ein neues Verfahren zum flussmittelfreien Hartlöten korrosionsbeständiger KonstruktionswerkstoffeTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 235-241. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J. (2007) Elektrochemische Messmethoden zur Online-Bestimmung des Kupfergehaltes in bleifreien Sn-Basis-LotbädernTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 261-267. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Drößler, B. (2007) Untersuchungen zur Spritzwerkstoffeinbringung beim Dreikathoden-PlasmaspritzprozessTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 136-142. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Reimche, W.; Duhm, R.; Mroz, G.; Denkena, B. (Hrsg.) (2007) Gentelligente Bauteilidentifikation und IntegritätsbewertungGentelligente Bauteile im Lebenszyklus, S. 31-38. Garbsen: PZH Produktionstechnisches Zentrum, 2007.
    ISBN: 978-3-939026-46-4
  • Bach, Fr.-W.; Schaper, M.; Nowak, M.; Rodman, M.; Denkena, B. (Hrsg.) (2007) Magnetische Magnesiumlegierungen. Entwicklung von Magnesiumlegierungen mit magnetischen Ausscheidungen.Gentelligente Bauteile im Lebenszyklus, S. 7-12. Garbsen: PZH Produktionstechnisches Zentrum, 2007.
    ISBN: 978-3-939026-46-4
  • Bach, Fr.-W.; Schaper, M.; Rodman, M.; Nowak, M.; Kainer, K. U. (Hrsg.) (2007) Magnesium with Magnetic Properties for Sensory UseKainer, K.U. ; DGM, Oberursel: Magnesium. Proceedings of the 7th International Conference on Magnesium Alloys and their Applications 2006 : 06-09. November 2006, Dresden, pp. 992-996. Weinheim: Wiley-VCH, 2007.
    ISBN: 978-3-527-31764-6
  • Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Bistron, M. (2007) Use of a TiBN multilayer coating for wear reductionProceedings of 9th International Conference on Numerical Methods in Industrial Forming Processes - numiform'07, S. 1047-1052. Porto, Portugal, 2007.
    ISBN: 978-0-7354-0416-8
  • Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Küper, A.; Deißer, T. A.; Bistron, M. (2007) Reduction of Wear by a TiBN Multilayer Coating31st Int. Cocoa Beach Conference ICACC Jan. 2007 // Proceedings of the 31st International Conference on Advanced Ceramics and Composites, January 21-26, 2007, Daytona Beach, Florida, USA. Westerville, Ohio: American Ceramic Soc
    ISBN: 978-0-470-24679-5
  • Bernard, M.; Reimche, W.; Bach, Fr.-W. (2007) Zerstörungsfreie Bestimmung der Randzoneneigenschaften hoch beanspruchter MaschinenbauteileDGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
  • Bernard, M.; Reimche, W.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007) Prozessfähige Randhärte- und Einhärtungstiefenbestimmung an dick- und dünnwandigen BauteilenKonstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
    ISBN: 9783514007536
  • Denkena, B.; Kramer, N.; Behrens, B.-A.; Bistron, M.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A. (2007) Manufacturing of ceramic reinforced high precision forging diesProceedings of 4th International Conference and Exhibition on Design and Production of Machines and Dies/Molds, Cesme, Turkey, June 21-23, 2007, 2007.
  • Dyllong, N.; Steinwarz, W.; Wienert, R.; Kramm, K.-H.; Bach, F.-W.; Hassel, T.; Behrens, S. (2007) Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End-und Zwischenlagerbauteilen zur Reduktion von ReparaturenIn: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2007 – Tagungsband. 8. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“. Dresden, 21.-23.03.2007, S.534- 539
  • Grydin, O.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W. (2007) Mathematical model for simulation of steel behavior during integrated heat treatment on the base of software ANSYSComputational Mechanics & Enhancement and Promotion of Computational Methods in Engineering and Science. Kyoto, Japan, 3.-6.12.2007.
  • Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Holländer, U. (2007) Hot Cracks in Pulsed Laser Beam Welds of Cr-Ni-alloyed Steels ? Detection methods and Prevention by using Predeposited Plasma Spray LayersProc. of the Third International Conference on Laser Technologies in Welding and Materials Processing, Katsiveli (Crimea, UA), 29 May - 2 June, 2007, 2007.
  • Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2007) Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen? Heißrisstests und Vermeidung durch vordeponierte Spritzschichten Vortragsband zu 7. Int. Konf. Strahltechnik 17.-19.4.2007 in Halle (Saale). SLV Halle, GSI: DVS, 2007.
  • Lindemeier, D.; Steiner, A.; Stahl, M.; Biskup, C.; Schmolke, S.; Pude, F.; Bormann, D.; Witte, F.; Gross, G.; Hauser, H.; Hoffmann, A.; Mueller, P.P. (2007) Cell Culture Models for the Evaluation of Magnesium Alloys as Degradable Implant MaterialsJahrestagung DGBM Biomaterialien, 2007, Vol. 8, S. 189
  • Michaeli, W.; Kamps, T.; Bach, Fr.-W.; Hartz, K.; Schmachtenberg, E.; Vetter, K.; Schmiederer, D.; Lurz, A.; Piotter, V.; Prokop, J. (2007) Neue Verfahren zur Herstellung von Mikrobauteilen über flüssige PhasenMikroSystemTechnik Kongress 2007 Proceedings, 15. - 17. Oktober 2007 in Dresden, S. 635-638. Berlin und Offenbach: VDE Verlag GmbH, 2007.
    ISBN: 978-3-8007-3061-2
  • Mroz, G.; Diebel, M.; Reimche, W.; Bach, Fr.-W. (2007) Entwicklung von Sensortechnik zur Erfassung diskreter Bauteil und Belastungsinformationen in der BauteilrandzoneDGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
  • Mroz, G.; Reimche, W.; Diebel, M.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007) Erfassung diskreter Bauteil- und Belastungsinformationen in der Bauteilrandzone mit inno-vativer SensortechnikKonstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
    ISBN: 9783514007536
  • Reimche, W.; Bernard, M.; Bach, Fr.-W.; Kronemeijer, D. A.; Kücheknecht, B.; Pohl, M. (Hrsg.) (2007) Qualifizierung zerstörungsfreier Prüftechniken zur wiederkehrenden Prüfung austenitischer Rohre hinsichtlich chloridinduzierter LochkorrosionM. Pohl (Hg.): Konstruktion, Qualitätssicherung und Schadensanalyse. [Tagung "Werkstoffprüfung 2007", 29. und 30. November 2007 in Neu-Ulm]. Deutsche Gesellschaft für Materialkunde; Deutscher Verband für Materialforschung und -prüfung; Stahl-Institut VDEh. Düsseldorf: Verl. Stahleisen
    ISBN: 9783514007536
  • Reimche, W.; Bernard, M.; Zwoch, S.; Bach, Fr.-W. (2007) Anwendung von Simulationsverfahren zur Entwicklung von zerstörungsfreien Prüftechniken im Rahmen der Qualitätsprüfung von Schweißverbindungen1. Fachtagung „Prüfen in der Schweißtechnik“. 30. und 31. Januar 2007, Halle (Saale). Gesellschaft für Schweißtechnik International mbH, Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH. Halle (Saale), S. 4–15
  • Reimche, W.; Duhm, R.; Bernard, M.; Bach, Fr.-W.; Kronemeijer, D. A.; Kücheknecht, B. (2007) Zerstörungsfreie Fehlerprüfung und Fehlertiefenbestimmung chlorinduzierter Lochkorrosion in austenitischen RohrenDGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
  • Reimche, W.; Mroz, G.; Diebel, M.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2007) Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen6. Industriekolloquium "Hochfeste Strukturen", S. 89-98. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2007.
    ISBN: 3923605242(2)
  • Reimche, W.; Scheer, C.; Bach, Fr.-W. (2007) Frühzeitige Schadenserkennung an rotierenden Bauteilen mittels Schallemissionsanalyse und einer Wirbelstromtechnik unter Anwendung der Wavelet-TransformationSchwingungsüberwachung und Diagnose von Maschinen VDI-Berichte Vol. 1982, CD-ROM, S. 39-55. Düsseldorf: VDI-Verl., 2007.
    ISBN: 978-3-18-091982-9
  • Reimche, W.; Zwoch, S.; Bernard, M.; Bach, Fr.-W. (2007) Entwicklung und Qualifizierung einer Fernfeld-Wirbelstromtechnik zur Fehlerprüfung von Schweißnähten und dickwandigen BauteilenDGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.
  • Scheer, C.; Brüggemann, P.; Reimche, W.; Bach, Fr.-W. (2007) Beurteilung des Entschichtungszustands beim Trockeneisstrahlen mittels Analyse und Or-tung von Schallemissionssignalen16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.
  • Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007) Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavelet-Transformation16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.
  • Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007) Early fault detection at gear units by acoustic emission and wavelet analysis5th International Conference on Acoustic Emission, Lake Tahoe, Nevada, USA, October 29 to November 2, 2007
  • Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007) Schwingungsdiagnostische Beurteilung des Lauf- und Verschleißverhaltens von präzisionsgeschmiedeten und konventionellen Zahnrädern im VergleichSchwingungsüberwachung und Diagnose von Maschinen. VDI-Schwingungstagung 2007 ; Tagung Würzburg, 27. und 28. Februar 2007. Schwingungstagung; Gesellschaft Entwicklung, Konstruktion, Vertrieb. Düsseldorf: VDI-Verl. (VDI-Berichte, 1982, CD-ROM), S. 185–204
    ISBN: 978-3-18-091982-9
  • Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007) Schallemissions- und Waveletanalysen zur frühzeitigen Schadenserkennung an hochbelas-teten rotierenden BauteilenDGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.
  • Scheer, C.; Reimche, W.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007) Frühzeitige Erfassung und Klassifizierung der Schadensentwicklung in hochbeanspruchten rotierenden Bauteilen mittels Schallemissions- und Wavelet-AnalysenKonstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
    ISBN: 9783514007536
  • Vetterlein, J.; Klümper-Westkamp, H.; Reimche, W. (2007) Sensorkontrolliertes Bainitisieren zur Prozesssteuerung und Qualitätssicherung63. Kolloquium für Wärmebehandlung, Werkstofftechnik, Fertigungs- und Verfahrenstechnik, HK 2007, Wiesbaden, 10.-12. Oktober 2007
  • Bach, Fr.-W. (Hg.) (2006) CAMC und CAMG als Schneidtechnik für den Rückbau kerntechnischer AnlagenInternationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und G. Kremer. KONTEC Gesellschaft für technische Kommunikation.
  • Bach, Fr.-W.; Biskup, C.; Kremer, G.; Schenk, A.; Kirsch, L.; Schmolke, S. (2006) Möglichkeiten und Grenzen der Wasserstrahltechnik zur Bearbeitung von spongiösem HartgewebeJahrestag der Schweizerischen, Deutschen und Österreichischen Gesellschaft für Biomedizinische Technik, Zürich, Schweiz, September 2006, S. 70
  • Bach, Fr.-W.; Biskup, C.; Kremer, G.; Schenk, A.; Kirsch, L.; Schmolke, S. (2006) Temperature measurement during abrasive waer jet cutting of cortical bone blocs measured by thermocouples18th International Conference on Water Jetting, Danzig, Polen, September 2006, S. 203-212
    ISBN: 1-85598-081-9
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A. (2006) Ceramic-Metal Composites in Forging Applications inProceedings of the 3rd International Soldering and Brazing Conference IBSC2006, S. 73-78. Materials Park, OH 44073-0002: ASM International, 2006.
    ISBN: 0-87170-838-8
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.- A.; Bistron, M. (2006) Maßnahmen zur Erhöhung der Verschleißresistenz von Gesenkmatrizen zum Präzisionsschmieden von ZahnrädernBernhard Wielage (Hg.): Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 // Verbundwerkstoffe und Werkstoffverbunde. Tagungsband zum 9. Werkstofftechnischen Kolloquium in Chemnitz, 7. bis 8. September 2006, Bd. 24. Chemnitz: TU, Lehrstuhl für Verbundstoffe, S. 505–511
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Duda, T.; Engl, L. (2006) Untersuchungen zum Hochgeschwindigkeitsflammspritzen von MCrAlY-Schichtsystemen mit angepasster Oberflächenrauheit Tagungsband zum 3. GTV Kolloquium "Thermisches Spritzen", 09.06.2006, Luckenbach, 2006, S. 24-32, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Kolar, D. (2006) Thermal Spray Joining - Soldering and Filling of Aluminum Substrates under Atmospheric Conditions by a Combined Thermal Spray / Fusing TechniqueTagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
    ISBN: 0-87170-836-1
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Duda, T. (2006) Roughness Enhancement of HVOF Sprayed MCrAlY Bond Coatings for Adhesion Improvement of Ceramic Top LayersTagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
    ISBN: 0-87170-836-1
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2006) Niedrig schmelzende Glaslote auf Phosphatbasis zum Fügen von Aluminium-Keramik-Verbunden Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 430-435. Chemnitz: Eigenverlag, 2006.
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2006) Heating behaviour of differently tempered forged aluminium alloy components in a flame brazing process Tagungsband zum "4. International Congress Aluminium Brazing, 16t - 18th May 2006". Düsseldorf: Aluminium-Verlag, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2006) Modellierung der Stängelkristallitbildung beim Hartlöten am Beispiel des Werkstoffsystems Fe-C-CuTagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 400-406. Chemnitz: Eigenverlag, 2006.
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Schenk, A. (2006) Abrasive Water jet Cutting: Technology and ApplicationsInternational Conference on Cutting Technologies 2006, Hannover (D), 10th and 11th October 2006
  • Bach, Fr.-W.; Schenk, A.; Kremer, G.; Biskup, C.; Meier, O.; Fargas, M.; Bunte, J.; Jäscke, P. (2006) Increase of erosive potential of water jets by laser pulsing18th International Conference on Water Jetting, Danzig, Polen, 13.-15. September 2006, S. 357-366
  • Bach, Fr.-W.; Versemann, R. (Hg.) (2006) Qualifizierung der Wasserabrasivinjektorstrahlverfahren für den Rückbau kerntechnischer AnlagenInternationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und D. Peter. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover; RWE Power AG.
  • Bach, Fr.-W.; Versemann, R. (Hg.) (2006) Plasma-Autogen-Pulver-Schneiden - Ein experimentelles VerfahrenInternational Conference on Cutting Technologies 2006. Unter Mitarbeit von Fr.-W. Bach, Th. Rümenapp und Thomas [Dipl -Ing ]. Joszko. Leibzig Universität Hannover, Institut für Werkstoffkunde; RWE Power AG.
  • Bormann, D.; Bach, Fr.-W.; Krause, C.; Plorin, T.; Krause, A.; Hackenbroich, C.; Höh, N. v. d.; Meyer-Lindenberg, A. (2006) Strukturanalyse von orthopädischen und kardivaskulären Implantaten mittels Micro-ComputertomographieAktuelle Implantatentwicklung - Funktionalisierung von Materialien, S. 12-13: DECHEMA, Februar 2006.
  • Grydin, O.; Nürnberger, F.; Schaper, M. (2006) Matematiceskaja model' prognozirovanija struktury i mechaniceskich svojstv stali posle gorjacej deformacii i termoobrabotkiUdoskonalennja Procesiv i Obladnannja Obrobky Tyskom v Metalurhiï I Mašynobuduvanni. Tematyčnyj zbirnyk naukovych prac'. Donbas'ka deržavna mašynobudivna akademija. Kramators'k, S. 36–41
    ISBN: 966-379-070-9
  • Hassel, Th.; Bach, Fr.-W.; Golovko, A.; Krause, C. (2006) Investigation of the mechanical properties and the corrosion behaviour of low alloyed magnesium–calcium alloys for use as absorbable biomaterial in the implant techniqueMagnesium Technology in the global age. 45th Annual Conference of Metallurgists of CIM. Montreal, S. 359–370
  • Jäschke, P.; Meier, O.; Fargas, M.; Bach, Fr.-W.; Schenk, A.; Biskup, C. (2006) Abtragen mit lasergepulsten WasserstrahlenInternationale Schneidtechnische Tagung 2006, Hannover, Deutschland, Oktober 2006, S.70-75
    ISBN: 3-9806415-7-0
  • Krause, C.; Bormann, D.; Hassel, T.; Bach, Fr.-W.; Windhagen, H.; Krause, A.; Hackenbroich, C.; Meyer-Lindenberg, A.; Pekguleryuz, M. O. (Hrsg.) (2006) Mechanical Properties of Degradable Magnesium Implants in Dependance of the Implantation DurationInternational Symposium on Magnesium Technology in the Global Age, S. 329-343. Montreal, Quebec, Canada: CIM, 2006.
  • Kucharski, R.; Cholewa-Kowalska, K.; Chlopek, J.; Bach, Fr.-W.; Bormann, D. (2006) Resorbable Composite Based on Magnesium and Bioglass for Treating the Osseous TissueBiomaterials in Regenerative Medicine. Proceedings of the International Conference. Wien, 22. - 25.10.2006. Polish Academy of Sciences; Scientific Centre in Vienna. Wien, S. 109–112
  • Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005) Non- vakuum Elektronenstrahlschweißen von dünnwandigen StrukturbauteilenDVM Tag 2005 "Dünnwandige Strukturbauteile" Berlin. DVM.
  • Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005) Nonvakuum-Elektronenstrahlfügen von Stahl-Aluminium-HybridstrukturenBerichtskolloquium der DFG-Forschergruppe 505 Hochleistungsfügetechnik für Hybridstukturen. Forschergruppe Grundlagen der Warmblechumformung von Höchstfesten Vergütungsstählen. Garbsen: PZH, Produktionstechnisches Zentrum
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P. (2005) Production and Properties of Foamed MagnesiumR. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 77–80
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P. (2005) Detachable Fasteners for Aluminium FoamsR. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 181–184
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P.; Lugscheider, E. (Hrsg.) (2005) Herstellung und Eigenschaften von MagnesiumschäumenE. Lugscheider (Hg.): Innovative Werkstofftechnologie. 12. Werkstoffwissenschaftliches Kolloquium. Aachen 10.12.2004. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie. Aachen, S. 72–77
  • Bach, Fr.-W.; Jäger, S.; Konja, R.; Lau, K.; Versemann, R. (2005) Elektronenstrahlschweißen von Feinblechen an Atmosphäre: Heinz Palkowski (Hg.): Fünftes Industriekolloquium SFB 362 "Fertigen in Feinblech". Abschlusskolloquium Werkstoffe - Verfahren - Konzepte, 23. und 24. November 2005, Aula der Technischen Universität Clausthal. Industriekolloquium Fertigen in Feinblech. Clausthal-Zellerfeld: Techn. Univ. Clausthal.
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2005) Development of a technique for hard coating of component parts by synthesis of silicon carbide in thermal spray processesErich Lugscheider (Hg.): Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2005) Verbindungsspritzen - ein hybrides Fügeverfahren aus thermischem Spritzen und UmschmelzenUniv.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 157–163
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Lugscheider, E.; Parco, M. (2005) Properties of thermally sprayed coatings on magnesium parts for enhancement of wear and corrosion resistanceConference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Lugscheider, E. (2005) Qualification of a Modified Triplex II Plasma Gun for Processing of Liquid Precursors and Wire- or Powder Shaped Spray Materials under Controlled AtmosphereConference Proceedings ITSC 2005. Düsseldorf: DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Lugscheider, E. (2005) Self propagating high temperature synthesis of aluminium-matrix-composite coatings by means of atmospheric plasma sprayingConference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Nürnberger, F.; Krause, Ch.; Schaper, M.; Grydin, O. (2005) Simulation von Gefügeumwandlungen beim Abschreckhärten aus der Schmiedewärme mittels ZweiphasenströmungUniv.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 117–122
  • Bach, Fr.-W.; Schaper, M.; Bosse, M.; Gershteyn, G.; Nowak, M. (2005) Casting of Magnesium alloys with magnetic propertiesFirst International Conference and Exhibition Magnesium - Broad Horizons, S. 16-19. Moscow, Russia, 2005.
  • Bach, Fr.-W.; Schaper, M.; Krause, Ch.; Nürnberger, F. (2005) Heat treatment of precision forged steel gears by usage of the forging heatSučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 488–493
  • Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Grydin, O. (2005) Simulation of the microstructure transformation during quenchingSučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 27–31
  • Bach, Fr.-W.; Versemann, R.; Schenk, A.; Schuster, B. (2005) Bearbeitung von Hybridmaterialien mit dem WasserstrahlCongress Intelligente Leichtbau Systeme
  • Biskup, C.; Krömer, S.; Höver, M.; Versemann, R.; Bach, Fr.-W.; Kirsch, L.; Andreae, A.; Pude, F.; Schmolke, S.; (2005) Heat generation during abrasive water jet oesteotomies measuered by thermocouples8th International Conference on Management of Innovative Technologies, Fiesa, Slovenia, 2005
    ISBN: 961-6238-96-5
  • Biskup, C.; Pude, F.; Schenk, A.; Schmolke, S.; Kuhlmann, C.; Krömer, S.; Andreae, A.; Kirsch, L. (2005) Erste klinische Überprüfung der Andwendbarkeit des Wasserabrasivstrahls als Osteotomiewerkzeug im TierversuchBiomechanica 2005, Hamburg, Deutschland, März 2005, S. 173
  • Bormann, D. (2005) CT Investigations: Mechanical and Structural Properties of Magnesium SpongesInternationales Kolloquium des SFB599 4./5.11.2005
  • Hassel, Th.; Bach, Fr.-W.; Krause, C.; Wilk, P. (2005) Corrosion protection and repassivation after the deformation of magnesium alloys coated with a protective magnesium fluoride layerNeal R. Neelameggham, Howard I. Kaplan und Bob Ross Powell (Hg.): Magnesium technology 2005. Proceedings of the symposium. Warrendale, Pa: TMS, S. 485–490.
  • IMI (Hg.) (2005) Water Jet Technology - State of the art and futher developmentsConference on Water Jetting, Perspectives 2005-2015. Unter Mitarbeit von H. Louis, A. Schenk und R. Versemann.
  • Lugscheider, E.; Bach, Fr.-W.; Bobzin, K.; Möhwald, K.; Parco, M.; Richardt, K.; Engl, L. (2005) New approaches concerning the enhancement of wear and corrosion resistance of magnesium parts by thermally sprayed coating systemsK.-D Bouzakis (Hg.): Tagungsband zur Konferenz THE Coatings, 5.-7. Oktober 2005, Thessaloniki, Griechenland // 5th International Conference "the coatings" on Manufacturing Engineering and Eureka partnering event. Thessaloniki: Ed. Ziti, S. 241–248
  • Meyer-Lindenberg, A.; Krause, A.; Hassel, T.; Bormann, D.; Höh, N. v. d.; Windhagen, H.; Hackenbroich, C. (2005) Experimentelle Untersuchungen zu degradablen metallischen Osteosynthese-Materialien auf MagnesiumbasisJahrestagung der Arbeitsgemeinschaft Osteosynthese, Veterinärmedizin, 30.9. - 2.10.2005, Hannover.
  • Scheer, Ch.; Reimche, W.; Peter, D.; Bach, Fr.-W.; Südmersen, U. (2005) Qualitätssicherung und Produktivitätssteigerung in Produktionsanlagen am Beispiel Wasserabrasivstrahlschneiden15. Kolloquium Schallemission. DGZfP
  • Schmolke, S.; Kirsch, L.; Biskup, C.; Pude, F. (2005) Biomechanical properties of osseous interference screwsPoster, 7th European Federation of National Associations of Orthopaedics and Traumatology Congress, Lisabon, Portugal, 2005
  • Versemann, R.; Bach, Fr.-W.; Kremer, G.; Brüggemann, P. (2005) Research and Development Results for Dismantling and Decontamination ApplicationProceedings: 2005 Waste Management Symposium. Global Accomplishments in Environmental and Radioactive Waste Management: Cost Effectiveness, Risk Reduction and Technology Implementation. 2005 Waste Management Symposium, 02.03.2005.
  • Bach, Fr.-W.; Demmler, A.; Möhwald, K.; Bach, C. (2004) Neue Lotapplikationstechniken mittels Thermischer Spritzverfahren DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 35-37. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Kutku, I.; Möhwald, K.; Deißer, T. A.; Weinert, K.; Peters, C. (2004) Hochleistungswerkzeuge aus Keramik-Metall-Werkstoffverbunden DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 300-303. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Lugscheider, E.; Parco, M.; Dicks, R. (2004) Thermally Sprayed Coatings on Mg Alloys for Improved Wear and Corrosion Resistance 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 425-434. Friedrich-Alexander-Universität Erlangen-Nürnberg: Verlag, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Rothardt, T.; Bouzakis, K. D.; Denkena, B.; Geiger, M.; Toenshoff, H. K.; Popp, U. (2004) State of the Art and Future Trends in Thermal Spraying4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 41-55. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004) Thermally sprayed filler metal coatings for high temperature brazingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004 // Thermal spray 2004. Advances in technology and application, 10-12 May 2004, Osaka, Japan : proceedings of the International Thermal Spray Conference. Materials Park, Ohio: ASM International
  • Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004) Beschichtungsverfahren als leistungsfähige Alternative zu konventionellen LotapplikationstechnikenTagungsband zu "Oberflächentage 2004", 7. Mehrländertagung der Deutschen Gesellschaft für Galvano- und Oberflächentechnik e. V. am 22.-24.09.2004 in Dresden, S. 13-19, 2004.
    ISBN: 3-9806061-2-0
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Kolar, D. (2004) An Alternative Coating Process Underwater Plasma SprayingTagungsband zum 12. Plasma Technik Workshop Ilmenau, S. 81-88, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Labod, B.; Lugscheider, E.; Parco, M. (2004) Thermisch gespritzte Schichtsysteme zur Erhöhung des Verschleiß- und Korrosionsschutzes von Magnesiumbasis-LegierungenTagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18, S. 17-23. Chemnitz: Eigenverlag, 2004.
    ISBN: 3000135537
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2004) Weiterentwicklung des Hochtemperaturlötens mit LedeburitlotenDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 353-357. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2004) Flussmittelfreies Hartlöten dünnwandiger Titanlegierungen mit partieller ErwärmungDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 362-364. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2004) Flussmittelfreies Flammlöten von Aluminiumlegierungen durch UltraschallunterstützungDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 358-361. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Engl, L. (2004) Corrosion Protective Coatings by Modified Underwater Plasma SprayingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Schäpers, M.; Bouzakis, K. D. (Hrsg.) ; Denkena, B. (Hrsg.) ; Geiger, M. (Hrsg.) ; Toenshoff, H. K. (Hrsg.) ; Bach, Fr.-W. (Hrsg.) ; Popp, U. (Hrsg.) (2004) Aspects of PVD-Coatings of Plasma Nitratet Tool Steels4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 103-109. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Horstmann, R. (2004) Verarbeiten von kolloidal gelösten Nanopartikeln durch Thermisches SpritzenTagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18. Chemnitz: Eigenverlag, 2004.
    ISBN: 3000135537
  • Biskup, C.; Louis, H.; Pude, F.; Kirsch, L.; Schmolke, S. (2004) Machining of bony interference srews by means of an abrasive waterjetPaper, 17th International Conference on Water Jetting, Deutschland, September 2004, pp 231-243
  • Haferkamp, H.; Bach, Fr.-W.; Bunte, J.; Versemann, R.; Flade, K.; Meier, O.; Bormann, A. (2004) Laser- und Nonvakuum-Elektronenstrahlschweißen von höherfesten Stahlwerkstoffen.4. Industriekolloquium SFB 362. DFG
  • Schmolke, S.; Pude, F.; Biskup, C.; Bohnsack, M. (2004) Ossäre Interferenzschrauben - Herstellung und biomechanische Testung21.Kongress der Deutschsprachigen Arbeitsgemeinschaft für Arthroskopie (AGA), Luzern, Schweiz, Oktober 2004
  • Schmolke, S.; Pude, F.; Biskup, C.; Kirsch, L.; Hurschler, C.; Bohnsack, M. (2004) Herstellung und biomechanische Testung von Interferenzschrauben aus KnochenmaterialDeutscher Orthopädenkongress, Berln, Deutschland, Oktober 2004
  • Tillmann, W.; Vogli, E.; Rechlin, R.; Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T. (2004) Manufacturing diamond impregnated tools for stone machining through thermal sprayingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
  • Bach, Fr.-W.; Babiak, Z.; Möhwald, K.; Rothardt, T. (2003) Wlasnosci warstw kompozytowych natryskiwanych gazowo-detonacyjnie na podloza stopów lekkich na osnowie Al i MgProc. Conf. "Modern Wear and Corrosion Resistant Coatings Obtained by Thermal Spraying", Warschau, 2003, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Babiak, Z. (2003) Advantages of reactive spraying by simultaneous self-propagating high temperature synthesis (SHS) IWW Annual Assembly 2003.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2003) Particle Image Velocimetry Thermal SprayingSDMA/ICSF 2003 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June, S. Kapitel 7, S. 115-126. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
    ISBN: 3-8330-0571-8
  • Bach, Fr.-W.; Möhwald, K.; Schäpers, M. (2003) Aspekte der PVD-Beschichtung plasmanitrierter WerkzeugstähleTagungsband zur 5. Industriefachtagung "Oberflächen- und Werkstofftechnik" und zum 6. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und Werkstofftechnische Anwendungen Vol. 16, S. 265-270. Chemnitz: Eigenverlag, 2003.
  • Bach, Fr.-W.; Tegeder, G.; Babiak, Z.; Prehm, J.; Rothardt, T. (2003) State of the Art of Thermal Spraying 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
    ISBN: 3-8330-0571-8
  • Bach, Fr.-W.; Versemann, R.; Biena, H.; Kremer, G. (2003) CAMX - A High Performance Cutting Technique for Underwater Use. WM´03 Conference
  • Bach, Fr.-W.; Wilk, P.; Bormann, D. (2003) Cellular Magnesium: Magnesium mit zellenförmiger StrukturMetFoam. Cellular Metals: Manufacture, Properties, Applications. International Conference Berlin 23. - 25.06.2003. Berlin: Metall Innovation Technologie MIT, S. 255–258
  • Böhm, R.; Nürnberger, F.; Rodman, M.; Weber, J. (2003) Thermographische Analyse beim Walzen von Magnesiumblechen11. Magnesium Abnehmerseminar ; 26./26. September 2003 in Aalen &. 11th Magnesium Automotive and End User Seminar. Europäische Forschungsgemeinschaft Magnesiumguss. Aalen, S. 18.0-18.5
    ISBN: 3-932291-36-0
  • Haußelt, J.; Michaeli, W.; Schinköthe, W.; Ehrfeld, W.; Gatzen, H.-H.; Piotter, V.; Ruprecht, R.; Hülsenberg, D.; Möhwald, K. (2003) Themenschwerpunkt "Urformen"Mikromechanische Produktionstechnik, Abschlusskolloquium zum DFG-Schwerpunktprogramm 1012, S. 115-147, 2003.
  • Bach, Fr.-W. (Hg.). Unter Mitarbeit von St. Brandt, P.-T. Chuong, H. Louis, M. Mohamed, F. Pude, Christoph von Rad und A. Schenk. (2002) Internationale Schneidtechnische Tagung 2002. Wasserstrahltechnologie im 21. Jahrhundert - ein Ausblick auf Forschritt und künftige EntwicklungsfelderLeibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Rothardt, T.; Josefiak, L. A. (2002) Partikeldiagnostik mittels Particle Image Velocimetry (PIV) beim HochgeschwindigkeitsflammspritzenTagungsband des GTV-Kolloquiums 2002, Luckenbach, S. 21-32, 2002.
  • Bach, Fr.-W.; Versemann, R. (Hg.) (2002) Abrasive waterjet technology in aerospace and aircraft manufacturing industries. Wasserabrasivstrahltechnologie für die Luft- und Raumfahrtindustrie.Internationale Schneidtechnische Tagung 2002. Unter Mitarbeit von Ch. Biskup, F. Pude, E. Zheng, F. Chen und E. Siores. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation.
  • Biskup, C.; Pude, F.; Zheng, X.; Chen, F.; Siores, E. (2002) Two-dimensional and three-dimensional abrasive waterjet machining of aerospace composite components16th International Conference on Water Jetting, Aix-en-Provence, France, Oct. 2002, pp. 211-224
    ISBN: 1-85598-042-8
  • Biskup, C.; Pude, F.; Zheng, X.; Chen, F.; Siores, E. (2002) Abrasive Waterjet Technology in Aerospace and Aircraft Manufacturing IndustriesInternational Conference on Cutting Technology (ICCT), Hannover, Germany, April 2002, pp. 143-152
    ISBN: 3-9806415-5-4
  • Bratutin, W.; Nürnberger, F. (2002) Analysis of changing material properties of low carbon steel wire St1Kp after heat treatment and bendingSučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (5), S. 377–382
  • Haferkamp, H.; Bach, Fr.-W.; Goede, Martin; Versemann, R.; Bunte, J.; Bormann, D. et al. (2002) Hochleistungsstrahlverfahren für moderne Schweißkonstruktionen2. Intensivseminar Elektronenstrahltechnik. mi information center. Landsberg: verlag moderne industrie.
  • Rother, B.; Bach, Fr.-W.; Bormann, D.; Baumgärtner, F.; Balzer, H. (2002) Oxide Coated Transparent Aluminum Foaming MouldsProceedings of Materials Week 2002. München 30.09. - 02.10.2002: Werkstoff-Informationsgesellschaft
  • Bach, Fr.-W.; Berthold, M.; Crostack, H.-A.; Yanik, A. (2001) Prozessdiagnose und -regelung beim Löten mittels UltraschallTagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, S. 329-334. Düsseldorf: DVS-Verlag, 2001.
  • Bach, Fr.-W.; Haferkamp, H.; Niemeyer, M.; Bormann, D. (2001) Casting Process for Foamed MagnesiumJ. Banhart, M. F. Ashby und N. A. Fleck (Hg.): Cellular Metals and Metal Foaming Technology. Bremen 18. - 20.06.2001. Bremen: Metall Innovation Technologie MIT, S. 175–180
  • Bach, Fr.-W.; Möhwald, K.; Berthold, M.; Gundlfinger, K. (2001) Untersuchungen zum industriellen Weichlöten von Kupfer an RotgußTagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 5-10. Düsseldorf: DVS-Verlag, 2001.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2001) Flußmittelfreies Löten von Aluminiumlegierungen mit SchutzgasaktivatorenDVS (Hg.): Tagungsband zur “Löt 2001”, 6. Internationales Kolloquium, Bd. 212. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH (212), S. 375–379
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Duda, T. (2001) Neue Lösungsansätze zum Löten von Aluminiumlegierungen mit artgleichen und nicht artgleichen FügepartnernTagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 231-235. Düsseldorf: DVS-Verlag, 2001.
  • Bach, Fr.-W.; Szelagowski, A.; Versemann, R.; Zelt, M. (2001) Non-Vakuum-Elektronenstrahlschweißen: Ein Verfahren zum Fügen von FeinblechenE. Lugscheider (Hg.): 9. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie 2001. VDI. Aachen: VDI-Gesellschaft Werkstofftechnik, S. 59–67
  • Bach, Fr.-W.; Versemann, R.; Niemeyer, M.; Zeit, M.; Szelagowski, A. (2001) Non-Vakuum-Elektronenstrahlschweißen an Al- und Mg-FeinblechenTagungsband zur 5. Konferenz „Strahltechnik“ am 27. und 28. November 2001, S. 46–53
  • Bach, Fr.-W.; Haferkamp, H.; Bormann, D.; Niemeyer, M.; Clyne, T. W. (Hrsg.) (2000) Casting Process for the Production of Foamed Magnesium Structural PartsT. W. Clyne (Hg.): Metal matrix composites and metallic foams. Euromat 1999 European Congress on Advanced Materials and Processes, München 27. - 30.09.1999. Weinheim: Wiley-VCH (5), S. 46–50
  • Bach, Fr.-W.; Möhwald, K.; Gatzen, H.-H.; Morsbach, C.; Lugscheider, E. (Hrsg.) (2000) Metall-Kapillardruckgießen: Ein neues Urformverfahren für die MikromechanikE. Lugscheider (Hg.): 7. Werkstoffwissenschaftliches Kolloquium - Innovative Werkstofftechnologie 1999, Werkstoffwissenschaftliche Schriftenreihe. Aachen: Shaker Verlag (41), S. 67–73
  • Möhwald, K.; Morsbach, C.; Bach, Fr.-W.; Gatzen, H.-H. (1999) Investigations on Capillary Action Microcasting of Metals1st International Conference and General Meeting of the European Society for Precision Engineering and Nanotechnology, Bremen, Germany, S. 490-493, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M.; Meininghaus, T. (1998) Anwendungsorientierte LotentwicklungTagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 48-51, 1998.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Meininghaus, T.; Berthold, M. (1998) Fluß-mittelfreies Löten von Leichtmetall/Stahl-VerbindungenTagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 206-210, 1998.
  • Haferkamp, H.; Bach, Fr.-W.; Burmeister, I.; Kreutzburg, K.; Niemeyer, M. (1997) Nd: YAG laser beam welding of magnesium constructionsG. W. Lorimer (Hg.): Proceedings of the Third International Magnesium Conference. 10-12 April 1996, Manchester, UK. London: Institute of Materials, S. 89–98.

Berichte

  • Hassel, T. (2018) Autogenes MAG-C Schweißen als Hybridprozess für das kontinuierliche, nasse hyperbare Unterwasserschweißen(UW-A-MAG-C) mit Massivdrahtelektroden | Datei |
  • Behrens, B.-A.; Pielka, T.; Bach, Fr.-W.; Schaup, J. (2010) Erhöhung der Verschleißfestigkeit von Schneidstempeln durch partielle Integration von Hartmetall- und Keramiksegmenten mittels stoffschlüssigem Fügen: Ergebnisse eines Vorhabens der industriellen Gemeinschaftsforschung (IGF) EFB-Forschungsbericht, Nr. 308. Hannover: EFB, 2010.
    ISBN: 978-3-86776-344-8

Zeitschriften/Aufsätze

  • Acar, S.; Gerstein, G.; Cui, C.; Schulz, A.; Nürnberger, F. (2019) Preparation Methods for Scanning Electron Microscope Characterization of Nano-Carbides in Cold Work Steel X153CrMoV12Pract. Metallogr. 56, 2019 (5), 303-316
    DOI: 10.3139/147.110555
  • Behrens, B.-A.; Breidenstein, B.; Duran, D.; Herbst, S.; Lachmayer, R.; Löhnert, S.; Matthias, T.; Mozgova, I.; Nürnberger, F.; Prasanthan, V.; Siqueira, R.; Töller, F.; Wriggers, P. (2019) Simulation-Aided Process Chain Design for the Manufacturing of Hybrid ShaftsHTM 74, 2019 (2), 115-135
    DOI: 10.3139/105.110378
  • Eftifeeva, A.; Panchenko, E.; Chumlyakov, Y.; Yanushonite, E.; Gerstein, G.; Maier, H. J. (2019) Compressive response of high-strength [001]-oriented single crystals of a Co35Ni35Al30 shape memory alloyJournal of Alloys and Compounds 787, 2019, 963-971
    DOI: 10.1016/j.jallcom.2019.02.185
  • Karsten, E.; Gerstein, G.; Golovko, O.; Dalinger, A.; Lauhoff, C.; Krooss, P.; Niendorf, T.; Samsonenko, A.; Maier, H. J. (2019) Tailoring the Microstructure in Polycrystalline Co–Ni–Ga High-Temperature Shape Memory Alloys by Hot ExtrusionShap. Mem. Superelasticity 5, 2019 (1), 84-94
    DOI: 10.1007/s40830-019-00208-7
  • Konoplyuk, S.; Kokorin, V.; Mashirov, A.; Dilmieva, E.; Dalinger, A. (2019) Giant reversible stress-induced change of resistivity in Ni-Mn-In-Co alloysJournal of Applied Physics 125, 2019 (19), 195103
    DOI: 10.1063/1.5088233
  • Krooß, P.; Lauhoff, C.; Langenkämper, D.; Paulsen, A.; Reul, A.; Degener, S.; Aminforoughi, B.; Frenzel, J.; Somsen, C.; Schmahl, W. W.; Eggeler, G.; Maier, H. J.; Niendorf, T. (2019) Impact of Heating–Cooling Rates on the Functional Properties of Ti–20Ta–5Al High-Temperature Shape Memory AlloysShap. Mem. Superelasticity 5, 2019 (1), 95-105
    DOI: 10.1007/s40830-019-00207-8
  • Panchenko, E. Y.; Timofeeva, E. E.; Chumlyakov, Y. I.; Osipovich, K. S.; Tagiltsev, A. I.; Gerstein, G.; Maier, H. J. (2019) Compressive shape memory actuation response of stress-induced martensite aged Ni51Fe18Ga27Co4 single crystalsMaterials Science and Engineering: A 746, 2019, 448-455
    DOI: 10.1016/j.msea.2019.01.004
  • Sajadifar, S. V.; Yapici, G. G.; Demler, E.; Krooß, P.; Wegener, T.; Maier, H. J.; Niendorf, T. (2019) Cyclic deformation response of ultra-fine grained titanium at elevated temperaturesInternational Journal of Fatigue 122, 2019, 228-239
    DOI: 10.1016/j.ijfatigue.2019.01.021
  • Schöler, S.; Schmieding, M.; Yilkiran, D.; Özkaya, F.; Nowak, C.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2019) Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfacesWear 426-427, 2019, 1603-1615
    DOI: 10.1016/j.wear.2019.01.009
  • Schwarzenböck, E.; Hack, T.; Kolb, M.; Engel, C.; Heidenblut, T.; Maier, H. J. (2019) Evolution of surface characteristics of two industrial 7xxx aluminium alloys exposed to humidity at moderate temperatureSurface and Interface Analysis 51, 2019 (19), 5775
    DOI: 10.1002/sia.6652
  • Spachtholz, J.; Affeldt, E. E.; Maier, H. J.; Hammer, J. (2019) The effect of temperature gradients in thermo-mechanical fatigue testingMaterials at High Temperatures 36, 2018 (2), 97-103
    DOI: 10.1080/09603409.2018.1466500
  • Zeller, S.; Baldrich, M.; Gerstein, G.; Nuernberger, F.; Loehnert, S.; Maier, H. J.; Wriggers, P. (2019) Material models for the thermoplastic material behaviour of a dual-phase steel on a microscopic and a macroscopic length scaleJournal of the Mechanics and Physics of Solids 129, 2019, 205-228
    DOI: 10.1016/j.jmps.2019.04.012
  • Angrisani, G. L.; Taptimthong, P.; Thürer, S. E.; Klose, C.; Maier, H. J.; Wurz, M. C.; Möhwald, K. (2018) Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt CoatingsAdv. Eng. Mater. 20, 2018 (9), 1800102
    DOI: 10.1002/adem.201800102
  • Anton, D.; Reichardt, M.; Hassel, T.; Budelmann, H. (2018) Decommissioning of Nuclear Facilities: An Interdisciplinary Task for Junior Staffatw - International Journal for Nuclear Power 63, 2018 (11/12), 601-604
  • Bal, B.; Koyama, M.; Canadinc, D.; Gerstein, G.; Maier, H. J.; Tsuzaki, K. (2018) On the Utility of Crystal Plasticity Modeling to Uncover the Individual Roles of Microdeformation Mechanisms on the Work Hardening Response of Fe-23Mn-0.5C TWIP Steel in the Presence of HydrogenJ. Eng. Mater. Technol 140, 2018 (3), 31002
    DOI: 10.1115/1.4038801
  • Barton, S.; Reimche, W.; Maier, H.J. (2018) Three-Dimensional Data Storage in the Subsurface Region and Fast Read-Out Technologies for Determining the Mechanical Load History of ComponentsHTM 73, 2018 (1), 13-26
    DOI: 10.3139/105.110343
  • Behrens, B.-A.; Klose, C.; Chugreev, A.; Heimes, N.; Thürer, S.; Uhe, J. (2018) A Numerical Study on Co-Extrusion to Produce Coaxial Aluminum-Steel Compounds with Longitudinal Weld SeamsMetals 8, 2018 (9), 717
    DOI: 10.3390/met8090717
  • Chatterjee, A.; Heidenblut, T.; Edler, F.; Olsen, E.; Stöckmann, J. P.; Tegenkamp, C.; Pfnür, H. (2018) Shaping single atomic junctions in ultra-thin Ag structures by electromigrationAppl. Phys. Lett. 113, 2018 (1), 13106
    DOI: 10.1063/1.5040405
  • Chugreeva, A.; Mildebrath, M.; Diefenbach, J.; Barroi, A.; Lammers, M.; Hermsdorf, J.; Hassel, T.; Overmeyer, L.; Behrens, B.-A. (2018) Manufacturing of High-Performance Bi-Metal Bevel Gears by Combined Deposition Welding and ForgingMetals 8, 2018 (11), 898
    DOI: 10.3390/met8110898
  • Demler, E.; Gerstein, G.; Dalinger, A.; Epishin, A.; Heidenblut, T.; Nürnberger, F.; Maier, H. J. (2018) Influence of High Current-Density Impulses on the Stress-Strain Response and Microstructural Evolution of the Single Crystal Superalloy CMSX-4Materials Research 21, 2018 (6), 1063
    DOI: 10.1590/1980-5373-MR-2018-0428
  • Demler, E.; Gerstein, G.; Dalinger, A.; Nürnberger, F.; Epishin, A.; Molodov, D. A. (2018) Effect of Electrical Pulses on the Mechanical Behavior of Single Crystals of Nickel-Based CMSX-4 Superalloy and the Mobility of Low-Angle Grain Boundary in Aluminum BicrystalsBulletin of the Russian Academy of Sciences: Physics 82, 2018 (9), 1079-1085
    DOI: 10.3103/S106287381809006X
  • Demler, E.; Rodman, D.; Rodman, M.; Gerstein, G.; Grydin, O.; Briukhanov, A. A.; Klose, C.; Nürnberger, F.; Maier, H. J. (2018) The Influence of Alternating Low-Cycle Bending Loads on Sheet Properties Having an Hcp Crystal LatticeJ. of Materi Eng and Perform 27, 2018 (2), 541-549
    DOI: 10.1007/s11665-018-3123-2
  • Denkena, B.; Breidenstein, B.; Grove, T.; Prasanthan, V.; Overmeyer, L.; Nothdurft, S.; Kaierle, S.; Wallaschek, J.; Twiefel, J.; Ohrdes, H.; Maier, H. J.; Hassel, T.; Mildebrath, M. (2018) Surface integrity of turned laser-welded hybrid shaftsProd. Eng. Res. Devel., 2018
    DOI: 10.1007/s11740-018-0862-8
  • Denkena, B.; Mücke, A.; Schumacher, T.; Langen, D.; Hassel, T. (2018) Technology-based re-contouring of blade integrated disks after weld repairJ. Eng. Gas Turbines Power, 2018
    DOI: 10.1115/1.4040738
  • Epishin, A.; Petrushin, N.; Nolze, G.; Gerstein, G.; Maier, H. J. (2018) Investigation of the γ′-Strengthened Quaternary Co-Based Alloys Co-Al-W-TaMetall and Mat Trans A 49, 2018 (9), 4042-4057
    DOI: 10.1007/s11661-018-4756-3
  • Gerstein, G.; Firstov, G. S.; Kosorukova, T. A.; Koval, Y. N.; Maier, H. J. (2018) Development of B2 Shape Memory Intermetallics Beyond NiAl, CoNiAl and CoNiGaShap. Mem. Superelasticity 4, 2018 (3), 360-368
    DOI: 10.1007/s40830-018-0180-1
  • Gerstein, G.; Firstov, G.; Chumlyakov, Y.; Krooß, P.; Niendorf, T.; Dalinger, A.; Maier, H. J. (2018) Magnetic pulse controlled microstructure development in Co 49 Ni 21 Ga 30 single crystalsMaterials Science and Technology 34, 2018 (16), 1954-1964
    DOI: 10.1080/02670836.2018.1497129
  • Gerstein, G.; L'vov, V. A.; Kosogor, A.; Maier, H. J. (2018) Internal pressure as a key thermodynamic factor to obtain high-temperature superelasticity of shape memory alloysMaterials Letters 210, 2018, 252-254
    DOI: 10.1016/j.matlet.2017.09.034
  • Gerstein, G.; L'vov, V. A.; Żak, A.; Dudziński, W.; Maier, H. J. (2018) Direct Observation of Nano-dimensional Internal Structure of Ferromagnetic Domains in the Ferromagnetic Shape Memory Alloy Co-Ni-GaJournal of Magnetism and Magnetic Materials, 2018
    DOI: 10.1016/j.jmmm.2018.06.066
  • Hecht-Linowitzki, V.; Klett, J.; Hassel, T. (2018) Kontinuierliches Unterwasserschweißen mit MassivdrahtelektrodenSchweißen und Schneiden 70, 2018 (10), 720-726
  • Herbst, S.; Maier, H. J.; Nürnberger, F. (2018) Strategies for the Heat Treatment of Steel-Aluminium Hybrid ComponentsHTM 73, 2018 (5), 268-282
    DOI: 10.3139/105.110368
  • Julmi, S.; Krüger, A.-K.; Waselau, A.-C.; Meyer-Lindenberg, A.; Wriggers, P.; Klose, C.; Maier, H. J. (2018) Processing and coating of open-pored absorbable magnesium-based bone implantsMaterials Science and Engineering: C 98, 2019, 1073-1086
    DOI: 10.1016/j.msec.2018.12.125
  • Kadletz, P. M.; Motemani, Y.; Iannotta, J.; Salomon, S.; Khare, C.; Grossmann, L.; Maier, H. J.; Ludwig, A.; Schmahl, W. W. (2018) Crystallographic Structure Analysis of a Ti-Ta Thin Film Materials Library Fabricated by Combinatorial Magnetron SputteringACS combinatorial science 20, 2018 (3), 137-150
    DOI: 10.1021/acscombsci.7b00135
  • Klose, C.; Freytag, P.; Otten, M.; Thürer, S. E.; Maier, H. J. (2018) Thermal Properties of Intermetallic Phases at the Interface of Aluminum-Copper Compound CastingsAdv. Eng. Mater. 20, 2018 (6), 1701027
    DOI: 10.1002/adem.201701027
  • Langen, D.; Maier, H. J.; Hassel, T. (2018) The Effect of SiC Addition on Microstructure and Mechanical Properties of Gas Tungsten Arc-Welded Ti-6Al-4V AlloyJ. of Materi Eng and Perform 27, 2018 (1), 253-260
    DOI: 10.1007/s11665-017-3091-y
  • Mildebrath, M.; Maier, H. J.; Hassel, T.; Coors, T.; Pape, F.; Poll, G.; Barroi, A.; Lammers, M.; Hermsdorf, J.; Overmayer, L. (2018) Herstellungsprozess und Wälzfestigkeit von hybriden HochleistungsbauteilenKonstruktion 70, 2018 (9), 84-89 Weitere Informationen
  • Mohammadi, A.; Koyama, M.; Gerstein, G.; Maier, H. J.; Noguchi, H. (2018) Hydrogen-assisted failure in a bimodal twinning-induced plasticity steel: Delamination events and damage evolutionInternational Journal of Hydrogen Energy 43, 2018 (4), 2492-2502
    DOI: 10.1016/j.ijhydene.2017.11.177
  • Nicolaus, M.; Rottwinkel, B.; Alfred, I.; Möhwald, K.; Nölke, C.; Kaierle, S.; Maier, H. J.; Wesling, V. (2018) Future regeneration processes for high-pressure turbine bladesCEAS Aeronaut J 9, 2018 (1), 85-92
    DOI: 10.1007/s13272-017-0277-9
  • Niendorf, T.; Lauhoff, C.; Karsten, E.; Gerstein, G.; Liehr, A.; Krooß, P.; Maier, H. J. (2018) Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructureScripta Materialia 162, 2019, 127-131
    DOI: 10.1016/j.scriptamat.2018.10.051
  • Nothdurft, S.; Springer, A.; Kaierle, S.; Ohrdes, H.; Twiefel, J.; Wallaschek, J.; Mildebrath, M.; Maier, H. J.; Hassel, T.; Overmeyer, L. (2018) Laser welding of dissimilar low-alloyed steel-steel butt joints and the effects of beam position and ultrasound excitation on the microstructureJournal of Laser Applications 30, 2018 (3), 32417
  • Panchenko, E.; Eftifeeva, A.; Chumlyakov, Y.; Gerstein, G.; Maier, H. J. (2018) Two-way shape memory effect and thermal cycling stability in Co 35 Ni 35 Al 30 single crystals by low-temperature martensite ageingScripta Materialia 150, 2018, 18-21
    DOI: 10.1016/j.scriptamat.2018.02.013
  • Panchenko, E.; Timofeeva, E.; Eftifeeva, A.; Osipovich, K.; Surikov, N.; Chumlyakov, Y.; Gerstein, G.; Maier, H. J. (2018) Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystalsScripta Materialia 162, 2019, 387-390
    DOI: 10.1016/j.scriptamat.2018.12.003
  • Rieck genannt Best, F.; Koch, J.; Lilienkamp, G.; Körkemeyer, F.; Maier, H. J.; Caro, J.; Lange, K. (2018) Spiky Nickel Electrodes for Electrochemical Oxygen Evolution Catalysis by Femtosecond Laser StructuringInternational Journal of Electrochemistry, 2018 (12), 1-12
    DOI: 10.1155/2018/9875438
  • Rodriguez Diaz, M.; Knödler, P.; Möhwald, K.; Freiburg, D.; Biermann, D. (2018) Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatingsThermal Spray Bulletin 70, 2018 (2), 104-111
  • Schöler, S.; Wulff, D.; Yilkiran, D.; Behrens, B.-A. (2018) Inductive heat treatment as an alternative tempering method for the selective oxidation of 1.2379 tool steel surfacesDry Met. Forming OAJ FMT 4, 2018, 13-17
  • Shi, L.; Iwan, B.; Ripault, Q.; Andrade, J. R. C.; Han, S.; Kim, H.; Boutu, W.; Franz, D.; Nicolas, R.; Heidenblut, T.; Reinhardt, C.; Bastiaens, B.; Nagy, T.; Babuskin, I.; Morgner, U.; Kim, S.-W.; Steinmeyer, G.; Merdji, H.; Kovačev, M. (2018) Resonant-Plasmon-Assisted Subwavelength Ablation by a Femtosecond OscillatorPhys. Rev. Applied 9, 2018 (2), 024001-10
    DOI: 10.1103/PhysRevApplied.9.024001
  • Shi, L.; Nicolas, R.; Andrade, J. R. C.; Boutu, W.; Franz, D.; Heidenblut, T.; Reinhardt, C.; Morgner, U.; Merdji, H.; Kovacev, M. (2018) Impact of Plasmon-Induced Atoms Migration in Harmonic GenerationACS Photonics 5, 2018 (4), 1208-1214
    DOI: 10.1021/acsphotonics.7b01560
  • Spachtholz, J.; Affeldt, E. E.; Maier, H. J.; Hammer, J. (2018) Modelling of the fatigue crack growth of a coated single crystalline nickel-based superalloy under thermal mechanical loadingInternational Journal of Fatigue 116, 2018, 268-274
    DOI: 10.1016/j.ijfatigue.2018.06.015
  • Strauß, C.; Gustus, R.; Maus-Friedrichs, W.; Schöler, S.; Holländer, U.; Möhwald, K. (2018) Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446Journal of Materials Processing Technology 264, 2019, 1-9
    DOI: 10.1016/j.jmatprotec.2018.08.038
  • Toker, S. M.; Gerstein, G.; Maier, H. J.; Canadinc, D. (2018) Effects of microstructural mechanisms on the localized oxidation behavior of NiTi shape memory alloys in simulated body fluidJ Mater Sci 53, 2018 (2), 948-958
    DOI: 10.1007/s10853-017-1586-4
  • Vogel, F.; Biermann, D.; Rodriguez, M.; Nicolaus, M.; Möhwald, K. (2018) Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-BeschichtungenUnter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
  • Wolf, L. O.; Cordebois, J.-P.; Rodman, D.; Nürnberger, F.; Maier, H. J. (2018) Effect of Different Intercritical Annealing Treatments without and with Overaging on the Mechanical Material BehaviorSteel Research Int. 89, 2018 (10), 1800196
    DOI: 10.1002/srin.201800196
  • Żak, A.; Łaszcz, A.; Hasiak, M.; Gerstein, G.; Maier, H. J.; Dudzinski, W. (2018) Ion polishing as a method of imaging the magnetic structures in CoNiGa monocrystalResults in Physics 10, 2018, 277-280
    DOI: 10.1016/j.rinp.2018.06.020
  • Almohallami, A.; Arghavani, M.; Böhmermann, F.; Freiße, H.; Herrmann, M.; Mousavi, S. A.; Schöler, S.; Scholz, P.; Tenner, J.; Teller, M.; Umlauf, G.; Wulff, D.; Yilkiran, D.; Maier, H. J. (2017) How dry is dry? - A critical analysis of surface conditions used in dry metal formingDry Met. Forming OAJ FMT 3, 2017, 90-94
  • Astafurova, E. G.; Moskvina, V. A.; Maier, G. G.; Melnikov, E. V.; Zakharov, G. N.; Astafurov, S. V.; Maier, H. J. (2017) Hydrogen-enhanced Orientation Dependence of Stress Relaxation and Strain-aging in Hadfield Steel Single CrystalsScripta Materialia 136, 2017, 101-105
    DOI: 10.1016/j.scriptamat.2017.04.028
  • Astafurova, E.; Maier, G.; Melnikov, E.; Naydenkin, E.; Smirnov, A.; Bataev, V.; Odessky, P.; Dobatkin, S.; Maier, H. J. (2017) The Influence of the Thermomechanical Processing Regime on the Structural Evolution of Mo-Nb-Ti-V Microalloyed Steel Subjected to High-Pressure TorsionMetall and Mat Trans A 48, 2017 (7), 3400-3409
    DOI: 10.1007/s11661-017-4085-y
  • Bagehorn, S.; Wehr, J.; Maier, H. J. (2017) Application of mechanical surface finishing processes for roughness reduction and fatigue improvement of additively manufactured Ti-6Al-4V partsInternational Journal of Fatigue 102, 2017, 135-142
    DOI: 10.1016/j.ijfatigue.2017.05.008
  • Behrens, B.-A.; Nürnberger, F.; Bonk, C.; Hübner, S.; Behrens, S.; Vogt, H. (2017) Influences on the formability and mechanical properties of 7000-aluminum alloys in hot and warm forming J. Phys.: Conf. Ser. 896, 2017, 12004
    DOI: 10.1088/1742-6596/896/1/012004
  • Blohm, T.; Mildebrath, M.; Stonis, M.; Langner, J.; Hassel, T.; Behrens, B.-A. (2017) Investigation of the coating thickness of plasma-transferred arc deposition welded and cross wedge rolled hybrid partsProd. Eng. Res. Devel. 11, 2017 (3), 255-263
    DOI: 10.1007/s11740-017-0734-7
  • Demler, E.; Gerstein, G.; Dalinger, A.; Epishin, A.; Rodman, D.; Nürnberger, F. (2017) Influence of High-Current-Density Impulses on the Compression Behavior: Experiments with Iron and a Nickel-Based AlloyJournal of Materials Engineering and Performance 26, 2017 (1), 177-184
    DOI: 10.1007/s11665-016-2457-x
  • Denkena, B.; Grove, T.; Mücke, A.; Langen, D.; Nespor, D.; Hassel, T. (2017) Residual stress formation after re-contouring of micro-plasma welded Ti−6Al−4 V parts by means of ball end millingMat.-wiss. u. Werkstofftech. 48, 2017 (11), 1034-1039
    DOI: 10.1002/mawe.201600743
  • Emde, B.; Leschke, J.; Hermsdorf, J.; Kaierle, S.; Overmeyer, L.; Hassel, T.; Hecht-Linowitzki, V. (2017) Rückbau von Stahlstrukturen unter Wasser mittels LaserstrahlschneidenSchiff und Hafen 69, 2017 (11), 40-44
  • Gerstein, G.; Besserer, H.-B.; Nürnberger, F.; Barrales-Mora, L. A.; Shvindlerman, L. S.; Estrin, Y.; Maier, H. J. (2017) Formation and growth of voids in dual-phase steel at microscale and nanoscale levelsJournal of Materials Science 52, 2017 (8), 4234-4243
    DOI: 10.1007/s10853-016-0678-x
  • Gerstein, G.; Clausmeyer, T.; Isik, K.; Nürnberger, F.; Tekkaya, A. E.; Bruchanov, A. A.; Maier, H.J. (2017) Experimental analysis of anisotropic damage in dual-phase steel by resonance measurementInternational Journal of Damage Mechanics 26, 2016 (8), 1147-1169
    DOI: 10.1177/1056789516650245
  • Gerstein, G.; Isik, K.; Gutknecht, F.; Sieczkarek, P.; Ewert, J.; Tekkaya, A. E.; Clausmeyer, T.; Nürnberger, F. (2017) Microstructural characterization and simulation of damage for geared sheet componentsJ. Phys.: Conf. Ser. 896, 2017, 12076
    DOI: 10.1088/1742-6596/896/1/012076
  • Gerstein, G.; L’vov, V.; Chumlyakov, Y.; Niendorf, T.; Krooß, P.; Dalinger, A.; Heidenblut, T.; Maier, H. J. (2017) Pulsed magnetic field-induced changes in the meso- and nanostructure of Co49Ni21Ga30 martensiteFunct. Mater. Lett. 10, 2017 (04), 1750044
    DOI: 10.1142/S1793604717500448
  • Hecht-Linowitzki, V.; Hassel, T. (2017) Manuelles und halbautomatisches Elektrokontakttrennen von Spundwänden unter WasserSchweißen und Schneiden 69, 2017 (5), 244-251
  • Heidenblut, T., Veil, S. (2017) Die Sonnenscheibe aus Moordorf - Bronzezeit oder FälschungDGM-Jahresmagazin - Materialographie/Metallographie 2017, 44-46
  • Herbst, S.; Aengeneyndt, H.; Maier, H. J.; Nürnberger, F. (2017) Microstructure and Mechanical Properties of Friction Welded Steel-Aluminum Hybrid Components after T6 Heat TreatmentMaterials Science and Engineering: A 696, 2017, 33-41
    DOI: 10.1016/j.msea.2017.04.052
  • Herbst, S.; Dovletoglou, C. N.; Nürnberger, F. (2017) Method for Semi-Automated Measurement and Statistical Evaluation of Iron Aluminum Intermetallic Compound Layer Thickness and MorphologyMetallogr. Microstruct. Anal. 6, 2017 (5), 367-374
    DOI: 10.1007/s13632-017-0378-1
  • Kokorin, V. V.; Konoplyuk, S. M.; Dalinger, A.; Maier, H. J. (2017) Influence of martensitic transformation on the magnetic transition in Ni-Mn-GaJournal of Magnetism and Magnetic Materials 432, 2017, 266-270
    DOI: 10.1016/j.jmmm.2017.02.008
  • Leschke, J.; Hecht-Linowitzki, V.; Hassel, T.; Hermsdorf, J.; Kaierle, S.; Overmayer, L.; Maier, H. J. (2017) Laserstrahlschneiden unter Wasser für höhere ProduktivitätSchweißen und Schneiden 69, 2017 (11), 774-780
  • Maier, H. J.; Karsten, E.; Paulsen, A.; Langenkämper, D.; Decker, P.; Frenzel, J.; Somsen, C.; Ludwig, A.; Eggeler, G.; Niendorf, T. (2017) Microstructural evolution and functional fatigue of a Ti–25Ta high-temperature shape memory alloyJ. Mater. Res. 32, 2017 (23), 4287-4295
    DOI: 10.1557/jmr.2017.319
  • Mildebrath, M.; Blohm, T.; Hassel, T.; Stonis, M.; Langner, J.; Maier, H. J.; Behrens, B.-A. (2017) Influence of Cross Wedge Rolling on the Coating Quality of Plasma-Transferred Arc Deposition Welded Hybrid Steel PartsInternational Journal of Emerging Technology and Advanced Engineering 7, 2017 (7), 1-7
  • Mildebrath, M.; Somonov, V.; Nothdurft, S.; Ohrdes, H.; Springer, A.; Kaierle, S.; Hassel, T.:, Maier, H.-J.; Wallascheck, J. (2017) Influence of silicon on the structure and weldability of steel-aluminium joints processed by non-vacuum electron beam weldingInternational Journal of Emerging Technology and Advanced Engineering 7, 2017 (9), 348-356
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017) A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/AlJ Therm Spray Tech 26, 2017 (7), 1659-1668
    DOI: 10.1007/s11666-017-0612-z
  • Nürnberger, F.; Gerstein, G.; Dalinger, A.; Thürer, S. E.; Vinogradov, A.; Feldhoff, A.; Maier, H. J. (2017) Surface modification of an austenitic stainless steel wire by a multi-pulse treatment with a high-power electric currentJournal of Materials Science 52, 2017 (13), 8007-8015
    DOI: 10.1007/s10853-017-1003-z
  • Otten, M.; Klose, C.; Möhwald, K.; Knödler, P.; Maier, H. J. (2017) Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten DruckgussbauteilenGiesserei Special, 2017 (1), 74-89 Weitere Informationen
  • Panchenko, E.; Timofeeva, E. E.; Larchenkova, N. G.; Chumlyakov, Y.; Tagiltsev, A. I.; Maier, H. J.; Gerstein, G. (2017) Two-way shape memory effect under multi-cycles in [001]-oriented Ni 49 Fe 18 Ga 27 Co 6 single crystal Materials Science and Engineering: A 706, 2017, 95-103
    DOI: 10.1016/j.msea.2017.08.108
  • Reschka, S.; Munk, L.; Wriggers, P.; Maier, H. J. (2017) An EBSD Evaluation of the Microstructure of Crept Nimonic 101 for the Validation of a Polycrystal–Plasticity ModelJ. of Materi Eng and Perform 26, 2017 (12), 6087-6098
    DOI: 10.1007/s11665-017-3046-3
  • Röhlig, K.-J.; Häfner, D.; Lux, K.-H.; Hassel, T.; Stahlmann, J. (2017) Einschluss oder Zugriff, Tiefenlagerung ohne oder mit Vorkehrungen zur RückholbarkeitGAiA Ökologische Perspektiven für Wissenschaft und Gesellschaft, 2017 (2), 114-117
    DOI: 10.14512/gaia.26.2.13
  • Schilling, T.; Bauer, M.; Biskup, C.; Haverich, A.; Hassel, T. (2017) Engineering of biodegradable magnesium alloy scaffolds to stabilize biological myocardial graftsBiomedizinische Technik. Biomedical engineering 62, 2017 (5), 493-504
    DOI: 10.1515/bmt-2016-0205
  • Shi, L.; Andrade, J. R. C.; Kim, H.; Han, S.; Nicolas, R.; Franz, D.; Boutu, W.; Heidenblut, T.; Segerink, F. B.; Bastiaens, B.; Merdji, H.; Kim, S.-W.; Morgner, U.; Kovačev, M. (2017) Investigating the origin of third harmonic generation from diabolo optical antennasAppl. Phys. Lett. 111, 2017 (17), 173102
    DOI: 10.1063/1.5001005
  • Shi, L.; Iwan, B.; Nicolas, R.; Ripault, Q.; Andrade, J. R. C.; Han, S.; Kim, H.; Boutu, W.; Franz, D.; Heidenblut, T.; Reinhardt, C.; Bastiaens, B.; Nagy, T.; Babushkin, I.; Morgner, U.; Kim, S.-W.; Steinmeyer, G.; Merdji, H.; Kovacev, M. (2017) Self-optimization of plasmonic nanoantennas in strong femtosecond fieldsOptica 4, 2017 (9), 1038-1043
    DOI: 10.1364/OPTICA.4.001038
  • Suero, E. M.; Westphal, R.; Zaremba, D.; Citak, M.; Hawi, N.; Citak, M.; Stuebig, T.; Krettek, C.; Liodakis, E. (2017) Robotic guided waterjet cutting technique for high tibial dome osteotomy: A pilot studyThe international journal of medical robotics + computer assisted surgery MRCAS 4, 2017 (2), 174-179
    DOI: 10.1002/rcs.1825
  • Thürer, S. E.; Uhe, J.; Golovko, O.; Bonk, C.; Bouguecha, A.; Behrens, B. A.; Klose, C. (2017) Mechanical Properties of Co-Extruded Aluminium-Steel CompoundsKey Engineering Materials 742, 2017, 512-519
    DOI: 10.4028/www.scientific.net/KEM.742.512
  • Timofeeva, E. E.; Panchenko, E. Y.; Chumlyakov, Y. I.; Maier, H. J.; Gerstein, G. (2017) Peculiarities of high-temperature superelasticity in Ni–Fe–Ga single crystals in compressionTech. Phys. Lett. 43, 2017 (3), 320-323
    DOI: 10.1134/S1063785017030245
  • Wolf, L. O.; Nürnberger, F.; Rodman, D.; Maier, H. J. (2017) 1-Step “Quenching and Partitioning” of the Press-Hardening Steel 22MnB5Steel Research Int. 88, 2017 (6), 1600307
    DOI: 10.1002/srin.201600307
  • Wolf, L. O.; Nürnberger, F.; Rodman, D.; Maier, H. J. (2017) The Effect of Intercritical Annealing on the Microstructure and Mechanical Properties of Ferritic-Martensitic Two-Phase SteelsSteel Research Int. 88, 2017 (2), 271-280
    DOI: 10.1002/srin.201600107
  • Yilkiran, D.; Wulff, D.; Almohallami, A.; Özkaya, F.; Bouguecha, A.; Hübner, S.; Möhwald, K.; Maier, H. J.; Behrens, B.-A. (2017) Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal formingWear 376-377, 2017, 1789-1803
    DOI: 10.1016/j.wear.2017.01.084
  • Yilkiran, D.; Wulff, D.; Özkaya, F.; Hübner, S.; Holländer, U.; Maier, H. J.; Behrens, B.-A. (2017) Wear Testing of Thermally Oxidised Tool Steel Specimens with α-Fe2O3 LayersDry Met. Forming OAJ FMT 3, 2017, 45-49
  • Zaremba, D.; Heitzmann, P.; Overmeyer, L.; Hillerns, L.; Hassel, T. (2017) Automatable Splicing Method for Steel Cord Conveyor Belts – Evaluation of Water Jetting as a Preparation ProcessJournal of Mechanical Engineering 63, 2017 (10), 590-596
    DOI: 10.5545/sv-jme.2017.4363
  • Zhao, S.; Seitz, J.-M.; Eifler, R.; Maier, H. J.; Guillory, R. J.; Earley, E. J.; Drelich, A.; Goldman, J.; Drelich, J. W. (2017) Zn-Li alloy after extrusion and drawing: Structural, mechanical characterization, and biodegradation in abdominal aorta of ratMaterials Science and Engineering: C 76, 2017, 301-312
    DOI: 10.1016/j.msec.2017.02.167
  • Bal, B.; Koyama, M.; Gerstein, G.; Maier, H. J.; Tsuzaki, K. (2016) Effect of strain rate on hydrogen embrittlement susceptibility of twinning-induced plasticity steel pre-charged with high-pressure hydrogen gasInternational Journal of Hydrogen Energy 41, 2016 (34), 15362-15372
    DOI: 10.1016/j.ijhydene.2016.06.259
  • Herbst, S.; Schledorn, M.; Maier, H. J.; Milenin, A.; Nürnberger, F. (2016) Process Integrated Heat Treatment of a Microalloyed Medium Carbon Steel: Microstructure and Mechanical PropertiesJ. of Materi Eng and Perform 25, 2016 (4), 1453-1462
    DOI: 10.1007/s11665-016-2004-9
  • Alkan, S.; Chowdhury, P.; Sehitoglu, H.; Rateick, R. G.; Maier, H. J. (2016) Role of nanotwins on fatigue crack growth resistance – Experiments and theoryInternational Journal of Fatigue 84, 2016, 28-39
    DOI: 10.1016/j.ijfatigue.2015.11.012
  • Angrisani, N.; Reifenrath, J.; Zimmermann, F.; Eifler, R.; Meyer-Lindenberg, A.; Vano-Herrera, K.; Vogt, C. (2016) Biocompatibility and degradation of LAE442-based magnesium alloys after implantation of up to 3.5years in a rabbit modelActa Biomaterialia 44, 2016, 355-365
    DOI: 10.1016/j.actbio.2016.08.002
  • Behrens, B.-A.; Bouguecha, A.; Vucetic, M.; Huskic, A.; Uhe, J.; Frischkorn, C.; Matthias, T.; Stakhieva, A.; Duran, D.; Thürer, S. E.; Golovko, O.; Klose, C. (2016) Umformtechnische Herstellung hybrider Lagerbuchsenwt Werkstattstechnik online 106, 2016 (10), 743-748
  • Behrens, B.-A.; Lippold, L.; Puppa, J.; Hübsch, C.; Langen, D.; Möhwald, K. (2016) Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf TitanbasisForsch. Ingenieurwes. 81, 2017 (1), 1-12
    DOI: 10.1007/s10010-016-0209-6
  • Besserer, H.-B.; Boiarkin, V.; Rodman, D.; Nürnberger, F. (2016) Qualifying Electrically Conductive Cold Embedding-Media for Scanning Electron MicroscopyMetallogr. Microstruct. Anal. 5, 2016 (4), 332-341
    DOI: 10.1007/s13632-016-0286-9
  • Besserer, H.-B.; Dalinger, A.; Rodman, D.; Nürnberger, F.; Hildenbrand, P.; Merklein, M.; Maier, H. J. (2016) Induction heat treatment of sheet-bulk metal-formed parts assisted by water-air spray coolingSteel Research Int. 87, 2016 (9), 1220-1227
    DOI: 10.1002/srin.201500404
  • Besserer, H.-B.; Gerstein, G.; Dalinger, A.; Jablonik, L.; Rodman, D.; Nürnberger, F. (2016) Ion Beam Processing in the Sample Preparation for the Analysis of Ductile Damage in Deep Drawing SteelsPrakt. Metallogr. 53, 2016 (4), 221-236
    DOI: 10.3139/147.110377
  • Besserer, H.-B.; Gerstein, G.; Maier, H. J.; Nürnberger, F. (2016) Specimen Preparation by Ion Beam Slope Cutting for Characterization of Ductile Damage by Scanning Electron MicroscopyMicrosc. Res. Tech. 79, 2016 (4), 321-327
    DOI: 10.1002/jemt.22633
  • Besserer, H.-B.; Hildenbrand, P.; Gerstein, G.; Rodman, D.; Nürnberger, F.; Merklein, M.; Maier, H. J. (2016) Ductile Damage and Fatigue Behavior of Semi-Finished Tailored Blanks for Sheet-Bulk Metal Forming ProcessesJournal of Materials Engineering and Performance 25, 2016 (3), 1136-1142
    DOI: 10.1007/s11665-016-1908-8
  • Bobzin, K.; Öte, M.; Schein, J.; Zimmermann, S.; Möhwald, K.; Lummer, C. (2016) Modelling the Plasma Jet in Multi-Arc Plasma SprayingJ Therm Spray Tech 25, 2016 (6), 1111-1126
    DOI: 10.1007/s11666-016-0438-0
  • Brand, S.; Bauer, M.; Petri, M.; Schrader, J.; Maier, H. J.; Krettek, C.; Hassel, T. (2016) Impact of intraprosthetic drilling on the strength of the femoral stem in periprosthetic fractures: A finite element investigationIn: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Engineering in Medicine 230, 2016 (7), 675-681
    DOI: 10.1177/0954411916647078
  • Bruchwald, O.; Frąckowiak, W.; Reimche, W.; Maier, H. J. (2016) Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling processMat.-wiss. u. Werkstofftech 47, 2016 (8), 780-788
    DOI: 10.1002/mawe.201600612
  • Bryukhanov, A. A.; Gerstein, G.; Dyachok, D. A.; Nürnberger, F. (2016) Effect of Deformation Texture on the Anisotropy of Elasticity and Damage of Two Phase Steel SheetsThe Physics of Metals and Metallography 117, 2016 (7), 719-724
    DOI: 10.1134/S0031918X16050033
  • Eifler, R.; Seitz, J. M.; Weber, C. M.; Grundke, S.; Reifenrath, J.; Kietzmann, M.; Lenarz, T. H.; Maier, H. J.; Klose, C.; Durisin, M. (2016) MgNd2 alloy in contact with nasal mucosa: an in vivo and in vitro approachJ Mater Sci: Mater Med 27, 2016 (2), 25
    DOI: 10.1007/s10856-015-5636-7
  • Epishin, A. I.; Petrushin, N. V.; Link, T.; Nolze, G.; Loshchinin, Y. V.; Gerstein, G. (2016) Thermal Stability of the Structure of a Heat-Resistant Cobalt Alloy Hardened with Intermetallic γ'-Phase PrecipitatesRussian Metallurgy, 2016 (4), 286-291
  • Gerstein, G.; Bruchanov, A. A.; Dyachok, D. V.; Nürnberger, F. (2016) The effect of texture in modeling deformation processes of bcc steel sheetsMaterials Letters 164, 2016, 356-359
    DOI: 10.1016/j.matlet.2015.11.007
  • Gerstein, G.; Clausmeyer, T.; Isik, K.; Nürnberger, F.; Tekkaya, A. E.; Bruchanov, A. A.; Maier, H. J. (2016) Experimental analysis of anisotropic damage in dual-phase steel by resonance measurementInternational Journal of Damage Mechanics, 2016
    DOI: 10.1177/1056789516650245
  • Hassel, T.; Murray, N.; Klimov, G.; Beniyash, A. (2016) Cutting and Welding of High-Strength Steels Using Non-Vacuum Electron Beam as a Universal Tool for Material ProcessingWJET 04, 2016 (04), 598-607
    DOI: 10.4236/wjet.2016.44056
  • Herbst, S.; Besserer, H.-B.; Grydin, O.; Milenin, A.; Maier, H. J.; Nürnberger, F. (2016) Holistic consideration of grain growth behavior of tempering steel 34CrNiMo6 during heating processesJournal of Materials Processing Technology 229, 2016, 61-71
    DOI: 10.1016/j.jmatprotec.2015.09.015
  • Herbst, S.; Steinke, K. F.; Maier, H. J.; Milenin, A.; Nürnberger, F. (2016) Determination of heat transfer coefficients for complex spray cooling arrangementsInternational Journal of Microstructure and Materials Properties 11, 2016 3/4, 229-246
    DOI: 10.1504/IJMMP.2016.079149
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2016) Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter ProzessgaseSchweißen und Schneiden 68, 2016 (5)
  • Hoppe, C.; Ebbert, C.; Grothe, R.; Schmidt, H. C.; Hordych, I.; Homberg, W.; Maier, H. J.; Grundmeier, G. (2016) Influence of the Surface and Heat Treatment on the Bond Strength of Galvanized Steel/Aluminum Composites Joined by Plastic DeformationAdv. Eng. Mater. 18, 2016 (8), 1371-1380
    DOI: 10.1002/adem.201600085
  • Hoppe, C.; Ebbert, C.; Voigt, M.; Schmidt, H. C.; Rodman, D.; Homberg, W.; Maier, H. J.; Grundmeier, G. (2016) Molecular Engineering of Aluminum-Copper Interfaces for Joining by Plastic DeformationAdv. Eng. Mater. 18, 2016 (6), 1066-1074
    DOI: 10.1002/adem.201500501
  • Hordych, I.; Rodman, D.; Nürnberger, F.; Hoppe, C.; Schmidt, H. C.; Grundmeier, G.; Homberg, W.; Maier, H. J. (2016) Effect of Pre-Rolling Heat Treatments on the Bond Strength of Cladded Galvanized Steels in a Cold Roll Bonding ProcessSteel Research Int. 87, 2016 (12), 1619-1626
    DOI: 10.1002/srin.201600021
  • Isik, K.; Gerstein, G.; Clausmeyer, T.; Nürnberger, F.; Tekkaya, A. E.; Maier, H. J. (2016) Evaluation of Void Nucleation and Development during Plastic Deformation of Dual-Phase Steel DP600Steel Research Int. 87, 2016 (12), 1583-1591
    DOI: 10.1002/srin.201500483
  • Isik, K.; Gerstein, G.; Gutknecht, F.; Clausmeyer, T.; Nürnberger, F.; Maier, H. J.; Tekkaya, A. E. (2016) Investigations of ductile damage in DP600 and DC04 deep drawing steel sheets during punchingProcedia Structural Integrity 2, 2016, 673-680
    DOI: 10.1016/j.prostr.2016.06.087
  • Isik, K.; Gerstein, G.; Schneider, T.; Schulte, R.; Rosenbusch, D.; Clausmeyer, T.; Nürnberger, F.; Vucetic, M.; Koch, S.; Hübner, S.; Behrens, B.-A.; Tekkaya, A. E.; Merklein, M. (2016) Investigations of ductile damage during the process chains of toothed functional components manufactured by sheet-bulk metal formingProduction Engineering 10, 2016 (1), 5-15
    DOI: 10.1007/s11740-016-0656-9
  • Kiliclar, Y.; Demir, O. K.; Engelhardt, M.; Rozgić, M.; Vladimirov, I. N.; Wulfinghoff, S.; Weddeling, C.; Gies, S.; Klose, C.; Reese, S.; Tekkaya, A. E.; Maier, H. J.; Stiemer, M. (2016) Experimental and numerical investigation of increased formability in combined quasi-static and high-speed forming processesJournal of Materials Processing Technology 237, 2016, 254-269
    DOI: 10.1016/j.jmatprotec.2016.06.007
  • Krämer, M.; Schilling, M.; Eifler, R.; Hering, B.; Reifenrath, J.; Besdo, S.; Windhagen, H.; Willbold, E.; Weizbauer, A. (2016) Corrosion behavior, biocompatibility and biomechanical stability of a prototype magnesium-based biodegradable intramedullary nailing systemMaterials Science and Engineering: C 59, 129-135
    DOI: 10.1016/j.msec.2015.10.006
  • Krooß, P.; Kadletz, P. M.; Somsen, C.; Gutmann, M. J.; Chumlyakov, Y. I.; Schmahl, W. W.; Maier, H. J.; Niendorf, T. (2016) Cyclic Degradation of Co49Ni21Ga30 High-Temperature Shape Memory Alloy: On the Roles of Dislocation Activity and Chemical OrderShap. Mem. Superelasticity 2, 2016 (1), 37-49
    DOI: 10.1007/s40830-015-0049-5
  • Lehmann, R.; Schmidt, H. J.; Costa, B. F. O.; Blumers, M.; Sansano, A.; Rull, F.; Wengerowsky, D.; Nürnberger, F.; Maier, H. J.; Klingelhöfer, G.; Renz, F. (2016) 57Fe Mössbauer, SEM/EDX, p-XRF and μ-XRF studies on a Dutch paintingHyperfine Interact 237, 2016 (1)
    DOI: 10.1007/s10751-016-1296-3
  • Lippold, L.; Kazhai, M.; Bouguecha, A.; Vucetic, M.; Hübsch, C.; Möhwald, K. (2016) Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging DieAdvanced Materials Research 1140, 2016, 91-98
    DOI: 10.4028/www.scientific.net/AMR.1140.91
  • Lützenkirchen-Hecht, D.; Wulff, D.; Wagner, R.; Holländer, U.; Maier, H. J.; Frahm, R. (2016) Ex-situ and in-situ investigations of thermal anti-oxidation treatments of stainless steels by reflection mode EXAFSJ. Phys.: Conf. Ser. 712, 2016, 12047
    DOI: 10.1088/1742-6596/712/1/012047
  • Milenin, A.; Kustra, P.; Byrska-Wójcik, D.; Grydin, O.; Schaper, M.; Mentlein, T.; Gerstein, G.; Nürnberger, F. (2016) Analysis of Microstructure and Damage Evolution in Ultra-Thin Wires of the Magnesium Alloy MgCa0.8 at Multipass DrawingJOM 68, 2016 (12), 3063-3069
    DOI: 10.1007/s11837-016-2127-3
  • Nicolaus, M.; Möhwald, K.; Maier, H. J.; Abrahams, H.; Vogel, F.; Biermann, D. (2016) Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter SchichtenThermal Spray Bulletin 68, 2016 (1), 54-59
  • Onal, O.; Gumus, B.; Aksoy, B.; Gerstein, G.; Alaca, B. E.; Maier, H. J.; Canadinc, D. (2016) Micro-Scale Cyclic Bending Response of NiTi Shape Memory AlloyMaterials Transactions 57, 2016 (3), 472-475
    DOI: 10.2320/matertrans.M2015423
  • Puppa, J.; Dinkel, S.; Behrens, B.-A.; Maier, H. J. (2016) Intelligente Schmiedewerkzeuge – Effizienter Verschleißschutz durch zyklische Randschichthärtung?massivUMFORMUNG, 2016 (3), 44-48
  • Rahim, M. I.; Tavares, A.; Evertz, F.; Kieke, M.; Seitz, J.-M.; Eifler, R.; Weizbauer, A.; Willbold, E.; Maier, H. (2016) Phosphate conversion coating reduces the degradation rate and suppresses side effects of metallic magnesium implants in an animal modelJ. Biomed. Mater. Res., 2016
    DOI: 10.1002/jbm.b.33704
  • Schlobohm, J.; Bruchwald, O.; Frackowiak, W.; Li, Y.; Kästner, M.; Pösch, A.; Reimche, W.; Reithmeier, E.; Maier, H. J. (2016) Turbine blade wear and damage – An overview of advanced characterization techniquesMaterials Testing 58, 2016 (5), 389-394
    DOI: 10.3139/120.110872
  • Taube, A.; Kurtovic, A.; Niendorf, T.; Mertens, T.; Zinn, C.; Schaper, M.; Maier, H. J. (2016) Influence of surface pre-treatments on the high-cycle fatigue behavior of Ti–6Al–4V – From anodizing to laser-assisted techniquesInternational Journal of Fatigue 91, 2016, 195-203
    DOI: 10.1016/j.ijfatigue.2016.06.010
  • Uzer, B.; Toker, S. M.; Cingoz, A.; Bagci-Onder, T.; Gerstein, G.; Maier, H. J.; Canadinc, D. (2016) An exploration of plastic deformation dependence of cell viability and adhesion in metallic implant materialsJournal of the Mechanical Behavior of Biomedical Materials 60, 2016, 177-186
    DOI: 10.1016/j.jmbbm.2016.01.001
  • Vogel, F.; Abrahams, H.; Biermann, D.; Nicolaus, M.; Rodriguez Diaz, M.; Möhwald, K.; Maier, H. J. (2016) Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und FestwalzenWerkstoffe in der Fertigung, 2016 (4), 27-28
  • Yilkiran, D.; Almohallami, A.; Wulff, D.; Hübner, S.; Vucetic, M.; Maier, H.; Behrens, B.-A. (2016) New Specimen Design for Wear Investigations in Dry Sheet Metal FormingDry Met. Forming OAJ FMT 2, 2016, 62-66
  • Almohallami, A.; Yilkiran, D.; Wulff, D.; Hübner, S.; Vucetic, M.; Maier, H. J.; Behrens, B.-A. (2015) Numerical Modelling of the Tribology of a Selective Oxidised 1.2379 Tool Steel Surface Developed for Dry Metal Forming Dry Met. Forming OAJ FMT 1, 2015; 91-95
  • Andreiev, A.; Golovko, O.; Frolov, I.; Nürnberger, F.; Wolf, L. O.; Schaper, M.; Grydin, O. (2015) Testing of pipe sectionsMaterials Testing 57, 2015 (7-8); 643-648.
    DOI: 10.3139/120.110759
  • Bal, B.; Gumus, B.; Gerstein, G.; Canadinc, D.; Maier, H.J. (2015) On the micro-deformation mechanisms active in high-manganese austenitic steels under impact loadingMaterials Science and Engineering: A, 632; 29-34
    DOI: 10.1016/j.msea.2015.02.054
  • Bracht, K.; Angrisani, N.; Seitz, J.-M.; Eifler, R.; Weizbauer, A.; Reifenrath, J. (2015) The influence of storage and heat treatment on a magnesium-based implant material: an in vitro and in vivo studyBioMedical Engineering OnLine 14 (1), 1680
  • Bruchwald, O.; Frackowiak, W.; Bucquet, T.; Huskic, A.; Reimche, W.; Maier, H. J. (2015) In-situ-Erfassung der Werkstoffumwandlung und Gefügeausbildung von Schmiedebauteilen im AbkühlpfadHTM Journal of Heat Treatment and Materials 70 (3), 2015; S. 150-161
    DOI: 10.3139/105.110259
  • Bruchwald, O.; Frackowiak, W.; Reimche, W.; Maier, H. J. (2015) Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatmentLa Metallurgia Italiana - International Journal of the Italian Association for Metallurgy 2015 (11/12), 29-37
  • Chowdhury, P.; Sehitoglu, H.; Abuzaid, W.; Maier, H. J. (2015) Mechanical response of low stacking fault energy Co–Ni alloys – Continuum, mesoscopic and atomic level treatmentsInternational Journal of Plasticity 71, 2015; 32-61
  • Durisin, M.; Reifenrath, J.; Weber, C. M.; Eifler, R.; Maier, H. J.; Lenarz, T.; Seitz, J.-M. (2015) Biodegradable nasal stents (MgF 2 -coated Mg-2 wt %Nd alloy)-A long-term in vivo studyJournal of Biomedical Materials Research Part B: Applied Biomaterials
    DOI: 10.1002/jbm.b.33559
  • Durisin, M.; Seitz, J. M.; Reifenrath, J.; Weber, C. M.; Eifler, R.; Maier, H. J.; Lenarz, T.; Klose, C. (2015) A novel biodegradable frontal sinus stent (MgNd2): a long-term animal studyEuropean Archives of Oto-Rhino-Laryngology
    DOI: 10.1007/s00405-015-3774-7
  • Freytag, P.; Demminger, C. (2015) Verbundguss von Aluminium und Kupfer für Anwendungen als HochleistungskühlkörperGiesserei Praxis 66 (10); 459-462
  • Gerstein, G.; Klusemann, B.; Bargmann, S.; Schaper, M. (2015) Characterization of the Microstructure Evolution in IF-Steel and AA6016 during Plane-Strain Tension and Simple ShearMaterials 8; 285-301
    DOI: 10.3390/ma8010285
  • Golovko, O.; Bieliaiev, S. M.; Nürnberger, F.; Danchenko, V. M. (2015) Extrusion of the bimetallic aluminum-magnesium rods and tubesForsch Ingenieurwes 79, 2015 (1-2); 17–27
    DOI: 10.1007/s10010-015-0184-3
  • Gontarenko, A.; Möhwald, K.; Deißer, T. A.; Maier, H. J. (2015) Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-CoatingsApplied Mechanics and Materials 788, 2015, 143-150
    DOI: 10.4028/www.scientific.net/AMM.788.143
  • Grygier, D.; Dudziński, W.; Gerstein, G.; Nürnberger, F. (2015) The effectiveness of spheroidization pearlitic steel with regard to the degree of plastic deformationInterdisciplinary Journal of Engineering Sciences, 3, 2015 (1); 6-9
  • Gumus, B.; Bal, B.; Gerstein, G.; Canadinc, D.; Maier, H. J.; Guner, F.; Elmadagli, M. (2015) Twinning activities in high-Mn austenitic steels under high-velocity compressive loadingMaterials Science and Engineering: A 648; 104-112.
    DOI: dx.doi.org/10.1016/j.msea.2015.09.045
  • Hassel, T.; Hecht-Linowitzki, V.; Kussike, S. M.; Rehfeldt, D.; Bach, F.-W.; Klett, J. (2015) Systematic investigation into wet arc welding under water with covered stick electrodesWelding and Cutting 14, 2015 (1), 48-53
  • Hassel, T.; Klett, J.; Kunde, C.; Leuterer, R.; Maier, H. J.; Stuhr, J. (2015) Kraftschlüssiger Spaltausgleich an imperfekten FlanschverbindungenSchiff und Hafen 10, 2015; 40-42.
  • Hassel,T.; Hecht-Linowitzki, V.; Kussike, S.M.; Rehfeldt, D.; Bach, Fr.-W. (2015) Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVERWelding and Cutting 14 (1), 2015, S. 48-53
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2015) Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steelWelding and Cutting, 14, 2015 (5), 280-288
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2015) Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-StahlSchweißen und Schneiden, 67, 2015 (4), 174-182
  • Hübsch, C.; Dellinger, P.; Maier, H. J.; Stemme, F.; Bruns, M.; Stiesch, M.; Borchers, L. (2015) Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coatingActa Biomaterialia 11, S. 488–493
    DOI: 10.1016/j.actbio.2014.09.042
  • Kadletz, P. M.; Krooß, P.; Chumlyakov, Y. I.; Gutmann, M. J.; Schmahl, W. W.; Maier, H. J.; Niendorf, T. (2015) Martensite stabilization in shape memory alloys – Experimental evidence for short-range orderingMaterials Letters 159, 2015; S. 16-19.
    DOI: 10.1016/j.matlet.2015.06.048
  • Karaca, H. E.; Acar, E.; Ded, G. S.; Saghaian, S. M.; Basaran, B.; Tobe, H.; Kok, M.; Maier, H.J.; Noebe, R. D.; Chumlyakov, Y. I. (2015) Microstructure and transformation related behaviors of a Ni45.3Ti29.7Hf20Cu5 high temperature shape memory alloyMaterials Science and Engineering: A 627, S. 82–94
    DOI: 10.1016/j.msea.2014.12.111
  • Kiliclar, Y.; Vladimirov, I. N.; Wulfinghoff, S.; Reese, S.; Demir, O. K.; Weddeling, C.; Tekkaya, A. E.; Engelhardt, M.; Klose, C.; Maier, H. J. (2015) Finite element analysis of combined forming processes by means of rate dependent ductile damage modellingInternational Journal of Material Forming, 2015
    DOI: 10.1007/s12289-015-1278-z
  • Klett, J.; Hassel, T.; Maier, H. J.; Kunde, C.; Leuterer, R.; Stuhr, J. (2015) Friction-locked gap compensation in imperfect flange connectionsShip & Offshore 6, 2015, 36 - 38.
  • Knödler, P.; Otten, M.; Möhwald, K.; Maier, H. J.; Freiburg, D.; Peuker, A.; Biermann, D. (2015) Transplantation von thermisch gespritzten SchichtenThermal Spray Bulletin 8, 2015 (1), 50-55.
  • Kokorin, V. V.; Konoplyuk, S. M.; Dalinger, A.; Thürer, S.; Gerstein, G.; Maier, H. J. (2015) Stress-induced resistivity changes in a Ni-Mn-In alloyApplied Physics Letters, 2015, 106; 131908.
    DOI: 10.1063/1.4917016
  • Krooß, P.; Niendorf, T.; Kadletz, P. M.; Somsen, C.; Gutmann, M. J.; Chumlyakov, Y. I.; Schmahl, W. W.; Eggeler, G.; Maier, H. J. (2015) Functional Fatigue and Tension–Compression Asymmetry in [001]-Oriented Co49Ni21Ga30 High-Temperature Shape Memory Alloy Single CrystalsShape Memory and Superelasticity 1 (1), 2015; 6-17.
    DOI: 10.1007/s40830-015-0003-6
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2015) Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine bladesThermal Spray Bulletin, 2015, 8; S. 56-61.
  • Niendorf, T.; Krooß, P.; Somsen, C.; Eggeler, G.; Chumlyakov, Y. I.; Maier, H. J. (2015) Martensite aging – Avenue to new high temperature shape memory alloysActa Materialia 89, S. 298-304
    DOI: 10.1016/j.actamat.2015.01.042
  • Niendorf, T.; Krooß, P.; Somsen, C.; Rynko, R.; Paulsen, A.; Batyrshina, E.; Frenzel, J.; Eggeler, G.; Maier, H. J. (2015) Cyclic degradation of titanium–tantalum high-temperature shape memory alloys — the role of dislocation activity and chemical decompositionFunctional Materials Letters 8, 2015; S. 1550062-1 - 1550062-5
    DOI: 10.1142/S1793604715500629
  • Panchenko, E. Yu; Chumlyakov, Yu I.; Surikov, N. Yu; Maier, H. J.; Gerstein, G.; Sehitoglu, H. (2015) Superelasticity in high-strength heterophase single crystals of Ni51.0Ti36.5Hf12.5 alloyTechnical Physics Letters 41 (8), 2015; 797-800.
    DOI: 10.1134/S1063785015080283
  • Petrushin, N.; Hvatzkiy, K.; Gerasimov, V.; Link, T.; Epishin, A.; Nolze, G.; Gerstein, G. (2015) A Single-Crystal Co-Base Superalloy Strengthened by γ′ Precipitates: Structure and Mechanical PropertiesAdvanced Engineering Materials 17 (6) 2015, 755-760
    DOI: 10.1002/adem.201500088
  • Rahim, M. I.; Eifler, R.; Rais, B.; Mueller, P. P. (2015) Alkalization is responsible for antibacterial effects of corroding magnesiumJournal of Biomedical Materials Research Part A, 2015
    DOI: 10.1002/jbm.a.35503
  • Reifenrath, J.; Marten, A.-K.; Angrisani, N.; Eifler, R.; Weizbauer, A. (2015) In vitro and in vivo corrosion of the novel magnesium alloy Mg–La–Nd–Zr: influence of the measurement technique and in vivo implant locationBiomedical Materials 10 (4) 2015, 045021
    DOI: 10.1088/1748-6041/10/4/045021
  • Schlesselmann, D.; Yu, Z.; Dalinger, A.; Nacke, B. (2015) Neue Anwendungsbereiche numerischer Simulation beim induktiven Randschichthärten mit FeldkonzentratorenHTM Journal of Heat Treatment and Materials 70 (1), S. 40-49
    DOI: 10.3139/105.110250
  • Schmidt. H. S.; Ebbert, C.; Rodman, D.; Homberg, W.; Grundmeier, G.; Maier, H. J. (2015) Investigation of cold pressure welding: cohesion coefficient of copperKey Engineering Materials 651-653 (2015), S. 1421-1426
    DOI: 10.4028/www.scientific.net/KEM.651-653.1421
  • Schmolke, S.; Zaremba, D.; Biskup, C.; Andreae, A.; Pude, F. (2015) Herstellung, biomechanische Prüfung und Integrationsverhalten biologischer Interferenzschrauben aus ossärem MaterialFuß & Sprunggelenk 13, 2015, 182–191
    DOI: 10.1016/j.fuspru.2015.06.001
  • T. Niendorf, F. Brenne, P. Hoyer, D. Schwarze, M. Schaper, R. Grothe, M. Wiesener, G. Grundmeier, H.J. Maier (2015) Processing of New Materials by Additive Manufacturing: Iron-Based Alloys Containing Silver for Biomedical ApplicationsMetall. Mater. Trans. A 46, 2015; S. 2829-2833
    DOI: 10.1007/s11661-015-2932-2
  • Timofeeva, E. E.; Panchenko, E. Y.; Chumlyakov, Y. I.; Vetoshkina, N. G.; Maier, H. J. (2015) One-way and two-way shape memory effect in ferromagnetic NiFeGaCo single crystalsMaterials Science and Engineering: A 640, 2015; 465-470
    DOI: 10.1016/j.msea.2015.06.024
  • Turichin, G.; Tsibulskiy, I.; Kuznetsov, M.; Akhmetov, A.; Mildebrath, M.; Hassel, T. (2015) Influence of the Gap Width on the Geometry of the Welded Joint in Hybrid Laser-Arc WeldingPhysics Procedia 78, 2015, 14-23
    DOI: 10.1016/j.phpro.2015.11.013
  • Vollmer, M.; Krooß, P.; Segel, C.; Weidner, A.; Paulsen, A.; Frenzel, J.; Schaper, M.; Eggeler, G.; Maier, H. J.; Niendorf, T. (2015) Damage Evolution in Pseudoelastic Polycrystalline Co-Ni-Ga High-temperature Shape Memory AlloysJournal of Alloys and Compounds 633, 2015; 288-295.
    DOI: 10.1016/j.jallcom.2015.01.282
  • Weber, C. M.; Eifler, R.; Seitz, J.-M.; Maier, H. J.; Reifenrath, J.; Lenarz, T.; Durisin, M. (2015) Biocompatibility of MgF2-coated MgNd2 specimens in contact with mucosa of the nasal sinus – A long term studyActa Biomaterialia 18, 2015; 249-261
    DOI: 10.1016/j.actbio.2015.03.003
  • Weizbauer, A.; Kieke, M.; Rahim, M. I.; Angrisani, G. L.; Willbold, E.; Diekmann, J.; Flörkemeier, T.; Windhagen, H.; Müller, P. P.; Behrens, P.; Budde, S. (2015) Magnesium-containing layered double hydroxides as orthopaedic implant coating materials-An in vitro and in vivo studyJ. Biomed. Mater. Res. (Journal of Biomedical Materials Research Part B: Applied Biomaterials) 04/2015
    DOI: DOI: 10.1002/jbm.b.33422
  • Wulff, D.; Yilkiran, D.; Holländer, U.; Lützenkirchen-Hecht, D.; Wagner, R.; Hübner, S.; Möhwald, K.; Maier, H. J.; Behrens, B.-A. (2015) Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal FormingDry Met. Forming OAJ FMT 1, 2015, 72-78
  • Ojha, A.; Sehitoglu, H.; Patriarca, L.; Maier, H. J. (2014) Twin Nucleation in Fe-based BCC Alloys - Modeling and ExperimentsModell. Sim. Mater. Sci. Eng., 22, S. 075010-1 - 075010-21
    DOI: 10.1088/0965-0393/22/7/075010
  • Astafurova, E. G.; Tukeeva, M. S.; Maier, G. G.; Melnikov, E. V.; Maier, H. J. (2014) Microstructure and mechanical response of single-crystalline high-manganese austenitic steels under high-pressure torsion: The effect of stacking-fault energyMaterials Science and Engineering A., (604), S. 166-175
    DOI: 10.1016/j.msea.2014.03.029
  • Bataev, I. A.; Golkovskii, M. G.; Losinskaya, A. A.; Bataev, A. A.; Popelyukh, A. I.; Hassel, T.; Golovin, D. D. (2014) Non-vacuum electron-beam carburizing and surface hardening of mild steelApplied Surface Science 322; S. 6-14
    DOI: 10.1016/j.apsusc.2014.09.137
  • Batyrshina, E.; Maier, H. J. (2014) Metalle, die sich erinnern: Mit Formgedächtnis immer in der richtigen FassungUnimagazin 01/02 2014, S. 30-33
  • Behrens, B.-A.; Maier, H. J.; Bach, F.-W.; Reimche, W.; Mroz, G.; Schrödter, J.; Jocker, J. (2014) A method to detect the level and direction of mechanical forces with the aid of load-induced martensitic phase transformationProd. Eng. Res. Devel., vol 8, 63-72
  • Biermann, D.; Kirschner, M.; Maier, H. J.; Bach, F.-W.; Möhwald, K.; Schaup, J. (2014) Verbundbohrwerkzeug vereint Eigenschaftsvorteile der Fügepartner, Forum Schneidwerkzeug- und SchleiftechnikForum Schneidwerkzeug- und Schleiftechnik, 2014, 102-109
  • Biermann, D.; Kirschner, M.; Maier, H. J.; Bach, F.-W.; Möhwald, K.; Schaup, J. (2014) Active brazed ceramic cemented carbide compound drills for machining lamellar graphite cast ironProd. Eng. Res. Devel. (Production Engineering), 2014, vol. 8, 3
    DOI: 10.1007/s11740-014-0547-x
  • Bryukhanov, A.A.; Rodman, M.; Volchok, N.A.; Bryuhanova, Z.A.; Schaper, M.; Klose, C. (2014) Texture and Mechanical Properties of AZ31 Magnesium Alloy Sheets Rolled of BlanksTechnology of Metals 2, S. 12-18
  • Bryukhanov, A.A.; Rodman, M.; Volchok, N.A.; Stoyanov, P.P.; Schaper, M.; Klose, C. (2014) Mechanical Properties of AZ31 Alloy Sheets Deformed by Low-Cycle Reverse BendingThe Physics of Metals and Metallography 115 (1), S. 98-105
    DOI: 10.1134/S0031918X14010037
  • Bucquet T.; Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2014) EcoForge – Ressourceneffiziente Prozessketten für Hochleistungsbauteile Schmiede Journal (2), S. 22-27
  • Demling, A.; Heuer, W.; Dittmer, M.; Heidenblut, T.; Schwestka-Polly, R.; Stiesch, M.; Elter, C. (2014) Analyse der Biofilmbildung auf kieferorthopädischen ApparaturenZWR - Das Deutsche Zahnärzteblatt 123, 2014 (05), 192-199
    DOI: 10.1055/s-0034-1383514
  • Diekamp, M.; Wolf, L.; Moritz, J. (2014) Kurzer Prozess – Umformen und HärtenTechnologie-Informationen, Innovation Niedersachsen, 2/2014, S. 7 Weitere Informationen
  • Dietrich, D.; Grittner, N.; Mehner, T.; Nickel, D.; Schaper, M.; Maier, H. J.; Lampke, T. (2014) Microstructural evolution in the bonding zones of co-extruded aluminium/titaniumJ Mater Sci, 2014, vol. 49, 2442-2455
    DOI: 10.1007/s10853-013-7912-6
  • Ebbert, C.; Schmidt, H. C.; Rodman, D.; Nürnberger, F.; Homberg, W.; Maier, H. J.; Grundmeier, G. (2014) Joining with electrochemical support (ECUF): Cold pressure welding of copperJournal of Materials Processing Technology, 2014, vol. 214, 2179–2187
    DOI: http://dx.doi.org/10.1016/j.jmatprotec.2014.04.015
  • Engelhardt, M.; Grittner, N.; Reimche, W.; Bach, Fr.-W. (2014) Non-destructive detection of weld seams in extruded aluminium profilesIn: Key Engineering Materials 585, S. 103–110.
  • Fischer, M.; Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H. J. (2014) EcoForge Energieeffiziente Prozesskette zur Herstellung von Hochleistungs-SchmiedebauteilenHTM Journal of Heat Treatment and Materials, 69 (4), S. 209-219
    DOI: 10.3139/105.110220
  • Freifrau von Maltzahn, N.; Kleibe, M.; Stiesch, M.; Hübsch, C.; Kohorst, P. (2014) Interfacial adhesion of zirconia/veneer bilayers with different thermal characteristicsDent. Mater. J. 33 (5), S. 583–590.
    DOI: 10.4012/dmj.2013-181
  • Gerstein, G.; Nürnberger, F.; Dudzinski, W.; Grygier, D.; Schaper, M.; Milenin, A. (2014) Structural Evolution of Thin Lamellar Cementite during Cold Drawing of Eutectoid SteelsProcedia Engineering 2014 (81), S. 694–699
    DOI: 10.1016/j.proeng.2014.10.062
  • Grittner, N.; Striewe, B.; von Hehl, A.; Engelhardt, M.; Klose, C.; Nürnberger, F. (2014) Characterization of the interface of co-extruded asymmetric aluminum-titanium composite profilesMaterialwissenschaft und Werkstofftechnik, 2014, 45; S. 1054-1060
    DOI: 10.1002/mawe.201400353
  • Grydin, O.; Nürnberger, F.; Zou, Y.; Schaper, M.; Brosius, A. (2014) Formation and Properties of Mixed Ferritic-Martensitic Microstructures in the Air-Hardening Steel LH800steel research int. 85 (9), S. 1340-1347
    DOI: 10.1002/srin.201300420
  • Herbst, S.; Gerstein, G.; Nürnberger, F.; Bach, F.-W. (2014) Suitable Impact Parameters for High-Speed Joining and Influence on the Bonding Zone MicrostructureJournal of Materials Engineering and Performance 23 (3), S. 944-953
    DOI: 10.1007/s11665-013-0845-z
  • Holzweissig, M. J.; Kanagarajah, P.; Maier, H. J. (2014) Digital image correlation at high temperatures for fatigue and phase transformation studiesThe Journal of Strain Analysis for Engineering Design (49), S. 204-211
    DOI: 10.1177/0309324713498737
  • Kokorin, V. V.; Koledov, V. V.; Shavrov, V. G.; Konoplyuk, S. M.; Thürer, S.; Troyanovsky, D. A.; Maier, H. J.; Khovaylo, V. V. (2014) Effect of thermal cycling on the martensitic transformation in Ni-Mn-In alloysJournal of Applied Physics, 116; S. 103515
    DOI: 10.1063/1.4895585
  • Kornilov, S.; Rempe, N.; Beniyash, A.; Murray, N. (2014) On the focused beam parameters of an electron gun with a plasma emitter
    DOI: 10.1088/1742-6596/552/1/012004
  • Krooß, P.; Holzweissig, M. J.; Niendorf, T.; Somsen, C.; Schaper, M.; Chumlyakov, Y. I.; Maier H. J. (2014) Thermal Cycling Behavior of an Aged FeNiCoAlTa Single-crystal Shape Memory AlloyScripta Materialia (81), S. 28–31
    DOI: 10.1016/j.scriptamat.2014.02.020
  • Lizunkova, Y.; Tyurin, A.; Hassel, T. (2014) Microstructural and Tribological Characterization of Atmospheric Plasma-Nitrided HS6-5-2C Tool SteelApplied Mechanics and Materials, 2014, 698; S. 345-350
    DOI: 10.4028/www.scientific.net/AMM.698.345
  • Lützenkirchen-Hecht, D.; Wulff, D.; Wagner, R. ; Frahm, R.; Holländer, U.; Maier, H. J. (2014) Thermal anti-oxidation treatment of CrNi-steels as studied by EXAFS in reflection mode: the influence of monosilane additions in the gas atmosphere of a continuous annealing furnaceJournal of Material Science, 49, 2014, 5454-5461
    DOI: 10.1007/s10853-014-8257-5
  • M. Bauer, T. Schilling, M. Weidling, D. Hartung, Ch. Biskup, P. Wriggers, F. Wacker, Fr. -W. Bach, A. Haverich, T. Hassel (2014) Geometric adaption of biodegradable magnesium alloy scaffolds to stabilise bio-logical myocardial grafts. Part IJournal of Materials Science: Materials in Medicine (Springer Verlag), Volume 25, S. 909-916 Weitere Informationen
    DOI: 10.1007/s10856-013-5100-5
  • M. Stolbchenko, O. Grydin, M. Schaper, F. Nürnberger, A. Samsonenko (2014) Sandwich rolling of twin-roll cast aluminium-steel clad stripsProcedia Engineering 2014 (81) S. 1541-1546
    DOI: 10.1016/j.proeng.2014.10.187
  • Mroz, G.; Reimche, W.; Frackowiak, W.; Bruchwald, O.; Maier, H. J. (2014) Setting Discrete Yield-stress Sensors for Recording Early Component Loading Using Eddy-current Array Technology and Induction ThermographyProcedia Technology (15), S. 484–493
    DOI: 10.1016/j.protcy.2014.09.008
  • N. Rempe, S. Kornilov, A. Beniyash, N. Murray, T. Hassel, C. Ribton (2014) Characterisation of electron beams generated by a plasma cathode gunE&E – Electrotechnica & Electronica, 49 (5-6), 2014, 242-248, ISSN: 0861-4717
  • Niendorf, T.; Krooß, P.; Batyrsina, E.; Paulsen, A.; Frenzel, J.; Eggeler, G.; Maier, H. J. (2014) On the functional degradation of binary titanium–tantalum high-temperature shape memory alloys — A new concept for fatigue life extension Funct. Mater. Lett.; 2014
    DOI: 10.1142/S1793604714500428
  • Niendorf, T.; Krooß, P.; Batyrsina, E.; Paulsen, A.; Motemani, Y.; Ludwig, A.; Buenconsejo, P.; Frenzel, J.; Eggeler, G.; Maier, H. J. (2014) Functional and structural fatigue of titanium tantalum high temperature shape memory alloys (HT SMAs)Materials Science and Engineering: A (620), S. 359-366
    DOI: 10.1016/j.msea.2014.10.038
  • O. Golovko, I. Frolov, D. Rodman, F. Nürnberger, O. Grydin, M. Schaper (2014) Spray cooling of extruded EN AW-6082 aluminium alloy sheets: spatial heat transfer coefficientsForsch Ingenieurwes 78 (1-2), S. 1-7
    DOI: 10.1007/s10010-014-0181-y
  • Ojha, A.; Sehitoglu, H.; Patriarca, L.; Maier, H. J. (2014) Twin Migration in Fe-based BCC Crystals: Theory and ExperimentsPhilosophical Magazine, 2014, vol. 94:16, 1816-1840
    DOI: http://dx.doi.org/10.1080/14786435.2014.898123
  • P. Krooß, C. Somsen, T. Niendorf, M. Schaper, I. Karaman, Y. Chumlykov, G. Eggeler, H. J. Maier (2014) Cyclic Degradation Mechanisms in Aged FeNiCoAlTa Shape Memory Single CrystalsActa Materialia 79, S. 126-137
    DOI: http://dx.doi.org/10.1016/j.actamat.2014.06.019
  • Panchenko, E.; Chumlyakov, Y.; Eftifeeva, A.; Maier, H. J. (2014) Two-way Shape Memory Effect in Ferromagnetic Co₃₅Ni₃₅Al₃₀ Single Crystals Aged Under StressScripta Materialia, 2014, Vol. 90-91, S. 10-13
    DOI: 10.1016/j.scriptamat.2014.06.034
  • Rodman, M.; Bryukhanov, A.A.; Bach, Fr.-W.; Grydin, O.; Klose, C.; Gerstein, G. (2014) Complex Investigations of the Influence of Low Cycle Sign-Variable Bending on the Mechanical Properties of Magnesium Alloy AZ31 Sheet Plastic Deformation of Metals 1, S. 23-27
  • Schmidt, H. C.; Rodman, D.; Grydin, O.; Ebbert, C.; Homberg, W.; Maier, H. J.; Grundmeier, G. (2014) Joining with electrochemical support: cold pressure welding of copper – weld formation and characterizationAdvanced Materials Research, 2014, vol. 966-967, 453-460
    DOI: 10.4028/www.scientific.net/AMR.966-967.453
  • Seitz, J-M; Eifler, R.; Weber, C.; Lenarz, T. H.; Maier, H. J.; Durisin, M. (2014) In vivo degradation effects of alloy MgNd2 in contact with mucous tissueJournal of biomedical materials research. Part A.
    DOI: 10.1002/jbm.a.35382
  • Shkatulyak, N.M.; Usov, V.V.; Volchok, N.A.; Bryukhanov, A.A.; San’kova, S.V.; Rodman, M.; Schaper, M.; Klose, C. (2014) Effect of Reverse Bending on Texture, Structure and Mechanical Properties of Sheets of Magnesium Alloys with Zinc and ZirconiumThe Physics of Metals and Metallography 115 (6), S. 609-616
    DOI: 10.1134/S0031918X1406012X
  • Swider, M. A.; Hassel, T. (2014) Composite wires for flux-free arc brazingWIRE – English edition of the magazine for the spring, wire and cable industry, 64 (1), S. 62-64
  • Swider, M. A.; Hassel, T. (2014) Zusatzwerkstoffe zum Lichtbogen-HartlötenDRAHT – Deutsche Ausgabe der Zeitschrift für die Feder-, Draht- und Kabelindustrie 65 (2), S. 72-74
  • T. Hassel, N. Murray, A. Beniyash, N. Rempe, S. Kornilov (2014) Non-vacuum electron beam cutting - A new high performance processE&E – Electrotechnica & Electronica, 49 (5-6), 2014, 303-309, ISSN: 0861-4717
  • T. Hassel, V. Hecht-Linowitzki, S. M. Kussike, D. Rehfeldt, F.-W. Bach (2014) Systematische Untersuchung zum nassen Lichtbogenschweißen unter Wasser mit umhüllten StabelektrodenSchweißen und Schneiden, 2014, vol. 66, 05, 250-256 Weitere Informationen
  • Toker, S. M; Canadinc, D.; Taube, A.; Gerstein, G.; Maier, H. J. (2014) On the Role of Slip - Twin Interactions on the Impact Behavior of High-Manganese Austenitic SteelsMater. Sci. Eng. A., vol. 593, 120–126.
  • Varahram, A.; Breidenstein, B.; Hassel, T.; Bach, F. -W; Maier, H. J. (2014) New design and construction of expandable casing tubesForschung im Ingenieurwesen 78 (3-4), S. 145-149 Weitere Informationen
  • Wang, J.; Sehitoglu, H.; Maier, H. J. (2014) Dislocation slip stress prediction in shape memory alloysInternational Journal of Plasticity 54, S. 247–266
    DOI: 10.1016/j.ijplas.2013.08.017
  • Weizbauer, A.; Seitz, J. M.; Werle, P.; Hegermann, J.; Willbold, E.; Eifler, R.; Windhagen, H.; Waizy, H. (2014) Novel magnesium alloy Mg-2La caused no cytotoxic effects on cells in physiological conditionsMaterials science & engineering. C, Materials for biological applications 41, S. 267–273
    DOI: 10.1016/j.msec.2014.04.063
  • Wulf, E.; Bachmann, H.; Möhwald, K.; Eifler, R.; Maier, H. J. (2014) The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloysIJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
    DOI: 10.3139/146.111022
  • Abuzaid, W.; Oral, A.; Sehitoglu, H.; Lambros, J.; Maier, H. J. (2013) Fatigue crack initiation in Hastelloy X - the role of boundariesFatigue & Fracture of Engineering Materials & Structures, 2013, 36 (8); 809-826.
    DOI: 10.1111/ffe.12048
  • Angrisani, N.; Foth, F.; Kietzmann, M.; Schumacher, S.; Angrisani, G. L.; Christel, A.; Behrens, P.; Reifenrath, J.; (2013) Increased accumulation of magnetic nanoparticles by magnetizable implant materials for the treatment of implant-associated complicationsJournal of nanobiotechnology 11, S. 34
    DOI: 10.1186/1477-3155-11-34
  • Bondarenko, A.; Angrisani, N.; Meyer-Lindenberg, A.; Seitz, J.-M.; Waizy, H.; Reifenrath, J. (2013) Magnesium‐based bone implants: Immunohistochemical analysis of peri‐implant osteogenesis by evaluation of osteopontin and osteocalcin expressionIn: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.34828/full.
  • Bracht, K. ; Angrisani, N. ; Seitz, J.-M. ; Besdo, S. ; Reifenrath, J. (2013) Influence of Heat Treatment on the Degradation Behaviour of Degradable Magnesium Based Implants In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4057/bmt-2013-4057.xml.
  • Bruchwald, Oliver (2013) Die Qualität im Blick: Der Bainitsensor ermöglicht Einblicke in die Werkstoffumwandlungphi - Produktionstechnik Hannover informiert, S. 6-7
  • Chowdhury, P.B; Sehitoglu, H.; Rateick, R.G; Maier, H. J. (2013) Modeling Fatigue Crack Growth Resistance of Nanocrystalline AlloysIn: Acta Materialia 61, S. 2531–2547
  • Clausmeyer, T.; Gerstein, G.; Bargmann, S.; Svendsen, B.; van den Boogaard, A. H.; Zillmann, B. (2013) Experimental characterization of microstructure development during loading path changes in bcc sheet steelsIn: Journal of Materials Science 48 (2), S. 674–689
  • Drynda, A.; Seibt, J.; Hassel, T.; Bach, Fr.-W.; Peuster, M. (2013) Biocompatibility of fluoride-coated magnesiumcalcium alloys with optimized degradation kinetics in a subcutaneous mouse modelIn: J Biomed Mater Res Part A 101A, S. 33–43
  • Durisin, M.; Weber, C.; Seitz, J.-M.; Bach, Fr.-W.; Kietzmann, M.; Schumacher, S.; Lenarz, Th. (2013) The Biodegradable Magnesium Stent as an Alternative Treatment in Cases of chronic Ventilation Disorders of the Paranasal SinusesIn: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4049/bmt-2013-4049.xml.
  • Freytag, P.; Kerber, K.; Bach, Fr.-W. (2013) Laserbeschriftung von Hartferritmagneten zur Kennzeichnung von DruckgussteilenIn: Forschung im Ingenieurwesen 77 (1), S. 39–47. Online verfügbar unter http://link.springer.com/content/pdf/10.1007%2Fs10010-013-0161-7.pdf
  • Grydin, O.; Gerstein, G.; Nürnberger, F.; Schaper, M.; Danchenko, V. (2013) Twin-roll casting of aluminum–steel clad stripsIn: Journal of Manufacturing Processes 15 (4), S. 501–507.
  • Grydin, O.; Stolbchenko, M.; Nürnberger, F.; Schaper, M. (2013) Influence of Hot Deformation on Mechanical Properties and Microstructure of a Twin-Roll Cast Aluminium Alloy EN AW-6082Journal of Materials Engineering and Performance 23 (3), S. 937-943 Weitere Informationen
    DOI: 10.1007/s11665-013-0816-4
  • Hampp, C.; Angrisani, N.; Reifenrath, J.; Bormann, D.; Seitz, J.-M.; Meyer-Lindenberg, A. (2013) Evaluation of the biocompatibility of two magnesium alloys as degradable implant materials in comparison to titanium as non‐resorbable material in the rabbitIn: Materials Science and Engineering: C 33 (1), S. 317–326. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0928493112004237#.
  • Hassel, T.; Konya, R.; Collmann, P.; Schaumann, P.; Priebe, S.; Deißer, T. A.; Beniyash, A.; Murray, N.; Bach, Fr.-W. (2013) Economical joining of tubular steel towers for wind turbines employing non-vacuum electron beam welding for high-strength steels in comarsion with sub-merged arc welding In: Welding in the World. Online verfügbar unter http://www.springerlink.com/openurl.asp?genre=article&id=doi:10.1007/s40194-013-0050-6.
  • Hassel, T.; Murray, N.; Konya, R.; Beniyash, A.; Bach, Fr.-W. (2013) Nonvacuum electron beam cutting and welding—two partnering processes for fast and highly efficient metal workingIn: Welding in the World 57 (3), S. 315–322. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs40194-013-0032-8.
  • Herbst, S.; Jablonik, L.; Gerstein, G.; Nürnberger, F.; Bach, Fr.-W. (2013) Topographieoptimierende Präparation metallischer WerkstoffverbundeIn: Praktische Metallographie / Practical Metallography 50 (7), S. 491–500. Online verfügbar unter http://www.practical-metallography.com/PM110242.
  • Hokhman, O. R.; Volchok, N. A.; Fassmann, D. (2013) Distribution of Microdefects in Sheets of St1.03-12 Low-Carbon Steel in Tension at Different RatesMaterials Science, Vol. 49, Nr. 2, S. 199–205
    DOI: 10.1007/s11003-013-9599-x
  • Hoyer, P.; Angrisani, G. L.; Klose, C.; Bach, Fr.-W.; Hassel, T. (2013) Korrosionsverhalten binärer Magnesium-Zink-Legierungen in salzhaltigen MedienIn: Materialwissenschaft und Werkstofftechnik 44 (1), S. 84–93.
  • Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Abo-Namous, O.; Kästner, M.; Reithmeier, E. (2013) Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und VerschleißbeanspruchungenIn: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract
  • K.-G. Kosch, P. Freytag, T. Matthias, K. Kerber, A. Bouguecha (2013) Verbund-Gießschmieden hybrider AluminiumbauteileMat.-wiss. u. Werkstofftech. (Materialwissenschaft und Werkstofftechnik), S. 819-824
    DOI: 10.1002/mawe.201300125
  • Kanagarajah, P.; Brenne, F.; Niendorf, T.; Maier, H. J. (2013) Inconel 939 Processed by Selective Laser Melting: Effect of Microstructure and Temperature on the Mechanical Properties Under Static and Cyclic LoadingIn: Materials Science and Engineering A 588, S. 188–195.
  • Karaca, H.E; Saghaian, S.M; Ded, G.; Tobe, H.; Basaran, B.; Maier, H. J.; Noebe, R.D; Chumlyakov, Y.I. (2013) Effects of Nanoprecipitation on the Shape Memory and Material Properties of an Ni-rich NiTiHf High Temperature Shape Memory AlloyIn: Acta Materialia 61, S. 7422–7431.
  • Klose, C.; Demminger, C.; Mroz, G.; Reimche, W.; Bach, Fr.-W.; Maier, H. J.; Kerber K. (2013) Influence of Cobalt on the Properties of Load-Sensitive Magnesium AlloysIn: Sensors 13, S. 106–118. Online verfügbar unter http://www.mdpi.com/1424-8220/13/1/106/.
  • Krüger, R.; Seitz, J.-M.; Ewald, A.; Bach, Fr.-W.; Groll, J. (2013) Strong and tough magnesium wire reinforced phosphate cement composites for load-bearing bone replacementIn: Journal of the Mechanical Behavior of Biomedical Materials 20, S. 36–44.
  • Kurtovic, A.; Brandl, E.; Mertens, T.; Maier, H. J. (2013) Laser Induced Surface Nano-structuring of Ti-6Al-4V for Adhesive BondingIn: Int. J. Adhesion & Adhesives 45, S. 112–117.
  • Lalk, M.; Reifenrath, J.; Angrisani, N.; Bondarenko, A.; Seitz, J.-M.; Mueller, P.; Meyer-Lindenberg, A. (2013) Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbitsIn: J Mater Sci: Mater Med 24, S. 417–436
  • Lehmann, E.; Faßmann, D.; Löhnert, S.; Schaper, M.; Wriggers, P. (2013) Texture development and formability prediction for pre-textured cold rolled body-centred cubic steelIn: International Journal of Engineering Science 68 (July 2013), S. 24–37
    DOI: 10.1016/j.ijengsci.2013.03.003
  • Maier, G.G; Astafurova, E.G; Maier, H. J.; Naydenkin, E.V; Raab, G.I; Odessky, P.D; Dobatkin, S.V. (2013) Annealing Behavior of Ultrafine Grained Structure in Low-carbon Steel Produced by Equal Channel Angular PressingIn: Mater. Sci. Eng. A 581, S. 104–107
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Maier, H. J. (2013) Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von TurbinenschaufelnIn: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
  • Nowak, M.; Golovko, O.; Nürnberger, F.; Frolov, I.; Schaper, M. (2013) Water-Air Spray Cooling of Extruded Profiles: Process Integrated Heat Treatment of the Alloy EN AW-6082Journal of Materials Engineering and Performance 22, 2013 (9), 2580-2587
  • Oosterbeek, R. N.; Seal, C. K.; Seitz J.-M.; Hyland M. M. (2013) Polymer-bioceramic composite coatings on magnesium for biomaterial applicationsIn: Surface and Coatings Technology 236 (15), S. 420–428. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0257897213009638.
  • Paggi, M.; Lehmann, E.; Weber, C.; Carpinteri, A.; Wriggers, P.; Schaper, M. (2013) A numerical investigation of the interplay between cohesive cracking and plasticity in polycrystalline materialsIn: Computational Materials Science 77, S. 81–92.
  • Pataky, G.J; Sehitoglu, H.; Maier, H. J. (2013) Creep Deformation and Mechanisms in Haynes 230 at 800 °C and 900 °CIn: J Nuclear Materials 443, S. 484–490.
  • Patriarca, L.; Abuzaid, W.; Sehitoglu, H.; Maier, H. J. (2013) Slip transmission in bcc FeCr polycrystalMaterials Science & Engineering A, 588 (2013); 308–317.
    DOI: 10.1016/j.msea.2013.08.050
  • Reifenrath, J.; Angrisani, N.; Erdmann, N.; Lucas, A.; Waizy, H.; Seitz, J.-M.; Bondarenko, A.; Meyer-Lindenberg, A. (2013) Degrading magnesium screws ZEK100: biomechanical testing, degradation analysis and soft-tissue biocompatibility in a rabbit modelIn: Biomedical Materials 8 (4).
  • Reifenrath, J.; Badar, M.; Dziuba, D.; Müller, P. P.; Heidenblut, T.; Bondarenko, A.; Meyer-Lindenberg, A. (2013) Assessment of cellular reactions to magnesium as implant material in comparison to titanium and to glyconate using the mouse tail modelIn: JABFM 11 (2), S. 89–94.
  • Reimche, W.; Bruchwald, O.; Frackowiak, W.; Bach, Fr.-W.; Maier, H. J. (2013) Non-destructive determination of local damage and material condition in high-performance componentsHTM (HTM Journal of Heat Treatment and Materials), S. 59-67
    DOI: 10.3139/105.110176
  • Rodman, D.; Boiarkin, V.; Nürnberger, F.; Dalinger, A.; Schaper, M.; (2013) Modeling of Spray Cooling during Induction Hardening of Spur Gearwheels Made from 42CrMo4 Hardening and Tempering SteelSteel Research Int. 85 (5), S. 741-755
    DOI: 10.1002/srin.201300201
  • Rodman, D.; Nürnberger, F.; Dalinger, A.; Schaper, M.; Krause, C.; Kästner, M.; Reithmeier, E. (2013) Tempering Induction Hardened 42CrMo4 Steel Helical Gearwheels from Residual Heat Using Spray Coolingsteel research int. 85 (3), S. 415-425
    DOI: 10.1002/srin.201300133
  • Schaper, M.; Grydin, O.; Nürnberger, F. (2013) Microstructure evolution of the air-hardening steel LH800 due to heat treatmentIn: Journal of Heat Treatment and Materials 68 (1), S. 42–48
  • Schilling, T.; Gudrun, B.; Tudorache, I.; Cebotari, S.; Hilfiker, A.; Meyer, T.; Biskup, C.; Bauer, M.; Waldmann, K.-H.; Bach, Fr.-W.; Haverich, A.; Hassel, T. (2013) In vivo degradation of magnesium alloy LA63 scaffolds for temporary stabilisation of biological myocardial grafts in a swine modelIn: Biomedical Engineering/Biomedizinische Technik 58 (5), S. 407–416.
  • Schmidt, H.C; Homberg, W.; Grundmeier, G.; Maier, H. J. (2013) Partial Joining of Blanks with Electrochemical Support (ECUF)In: Key Engineering Materials 554-557, S. 1091–1095.
  • Seitz, J.-M.; Eifler, R.; Bach, Fr.-W.; Maier H. J. (2013) Magnesium Degradation Products: Effects on Tissue and Human MetabolismIn: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.35023/full.
  • Seitz, J.-M.; Fau, D. R.; Eifler, R.; Kietzmann, M.; Weber, C.; Durisin, M.; Bach, Fr.-W.; (2013) MgNd2 : A Future Resorbable Magnesium-Based Implant Material?In: Emerging Materials Research 2 (5), S. 239–247. Online verfügbar unter http://www.icevirtuallibrary.com/content/article/10.1680/emr.13.00034.
  • Ullmann, B.; Angrisani, N.; Reifenrath, J.; Seitz, J.-M.; Bormann, D.; Bach, Fr.-W.; Meyer-Lindenberg, A. (2013) The effects of handling and storage on magnesium based implants — First resultsIn: Materials Science and Engineering: C 33 (5), S. 3010–3017.
  • Ullmann, B.; Reifenrath, J.; Seitz, J.-M.; Bormann, D.; Meyer-Lindenberg, A. (2013) Influence of the grain size on the in vivo degradation behaviour of the magnesium alloy LAE442In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Enginee-ring in Medicine 227 (3), S. 317–326.
  • Waizy, H.; Seitz, J.-M.; Reifenrath, J.; Weizbauer, A.; Bach, Fr.-W.; Meyer-Lindenberg, A.; Denkena, B.; Windhagen, H. (2013) Biodegradable magnesium implants for orthopedic applicationsIn: Journal of Materials Science 48 (1), S. 39–50. Online verfügbar unter http://www.springerlink.com/content/n33l6487g9388578/.
    DOI: 10.1007/s10853-012-6572-2
  • Weizbauer, A. ; Modrejewski, C. ; Behrens, S. ; Klein, H. ; Helmecke, P. ; Seitz, J.-M. ; Windhagen, H. ; Möhwald, K. ; Reifenrath, J. ; Waizy, H. (2013) Comparative in vitro study and biomechanical testing of two different magnesium alloysJournal of Biomedical Applications 28, 2013 (8), 1264-1273
    DOI: 10.1177/0885328213506758
  • Wolters, L.; Angrisani, N.; Seitz, J.-M.; Helmecke, P.; Weizbauer, A.; Reifenrath, J. (2013) Applicability of Degradable Magnesium LAE442 Alloy Plate-Screw-Systems in a Rabbit ModelIn: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4059/bmt-2013-4059.xml.
  • Wulf, E.; Alphai, L.; Westphal, D.; Seitz, J.-M.; Schaper, M.; Becker, J.; Feldhoff, A.; Bach, Fr.-W. (2013) Grain refining of aluminium alloys and silicon by means of boron-nitride particlesInternational Journal of Material Research (IJMR), S. 266-274
    DOI: 10.3139/146.110866
  • Bach, Fr.-W.; Dellinger, P.; Holländer, U.; Möhwald, K.; Prehm, J. (2012) Oberflächenveredelung durch Metall-KapillardruckgießenIn: Mikroproduktion 2012/03, S. 62–67
  • Behrens, B. - A.; Bach, Fr.-W.; Bouguecha, A.; Nürnberger, F.; Schaper, M.; Yu, Z.; Klassen, A. (2012) Numerische Berechnung einer integrierten Wärmebehandlung für präzisionsge-schmiedete BauteileIn: Journal of Heat Treatment and Materials 67, S. 337–343. Online verfügbar unter http://www.htm-journal.de/HT110156.
  • Behrens, S.; Hassel, T.; Bach, F.-W.; Steinwarz, W.; Dyllong, N.; Tragsdorf, I. M. (2012) Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK. Ein Überblick zum Abschluss des ProjektesAtw. Internationale Zeitschrift für Kernenergie 57, 2012 (4), 250-254
  • Bryukhanov, A.A; Shkatulyak, N.M; Rodmasn, M.; Shaper, M.; Usov, V.V; Klose, C. (2012) Effect of reversed bending on texture, structure and mechanical properties of low-carbon steelsIn: Technologija Metallov (Technology of metals) (11), S. 19–24.
  • Dziuba, D.; Meyer-Lindenberg, A.; Seitz, J.-M.; Waizy, H.; Angrisani, N.; Reifenrath, J. (2012) Long Term In Vivo Degradation Behaviour and Biocompatibility of the Magnesium Alloy ZEK100 for Use as Biodegradable Bone ImplantIn: Acta Biomaterialia. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112004047
    DOI: 10.1016/j.actbio.2012.08.028
  • Engelhardt, M.; Grittner, N.; von Senden genannt Haverkamp, H.; Reimche, W.; Bormann, D.; Bach, Fr.-W. (2012) Extrusion of hybrid sheet metalsJournal of Materials Processing Tech. 212 (2012), pp. 1030-1038 (Final version published online 18. Feb 2012)
    DOI: 10.1016/j.jmatprotec.2011.12.013
    ISBN: 0924-0136
  • Erne, M.; Kolar, D.; Hübsch, C.; Möhwald, K.; Bach, Fr.-W.: (2012) Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma SprayingJournal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/
  • Faßmann, D.; Gerstein, G.; Gerstein, D.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W. (2012) Preparation Routine for In Situ Strain Analysis of deep drawing Steel DC04 by Means of Transmission Electron MicroscopyIn: Praktische Metallographie 2012 (9), S. 577–587
  • Faßmann, D.; Gerstein, G.; Schaper, M.; Bach, Fr.-W. (2012) Investigation of ductile damage development in ferritic steel subject to uniaxial deformationIn: Fatigue & Fracture of Engineering Materials & Structures 35 (10), S. 936–942. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1111/j.1460-2695.2012.01679.x/full.
  • Frolov, I.; Golovko, O.; Nürnberger, F.; Gretzki, T. (2012) Analiz parametrov vodo-vozdušnogo sprejernogo ohlaždeniâ metalla v integrirovannyh tehnologičeskih processahMetallurgičeskaja i gornorudnaja promyšlennost' 7, 2012, 208-212
  • Frolov, I.; Golovko, O.; Nürnberger, F.; Gretzki, T. (2012) Analiz izmeneniya temperatury metalla pri osevom vodovozdushnom spreyernom okhlazhdenii stalnykh tsilindricheskikh obraztsovMetallurgičeskaja i gornorudnaja promyšlennost' 6, 2012, 33-39
  • Gershteyn, G.; Shevchenko, N.; Diekamp, M.; Brosius, A.; Schaper, M.; Bach, Fr.-W. (2012) Features of austenitic steels’ microstructure following plastic deformationMaterialwissenschaft und Werkstofftechnik, 43, (2012), No. 3
  • Gerstein, G.; Nowak, M.; Bierbaum, M.; Zhuravina, T.; Schaper, M.; Bach, Fr.-W. (2012) Increase the deformability of NiCo single crystals using of electrical pulse-like currentsKey Engineering Materials, 504-506, 143
    DOI: 10.4028/www.scientific.net/KEM.504-506.143
  • Golovko A. N.; Rodman, D.; Nürnberger, F.; Schaper, M.; Frolov, Y. V.; Bieliaiev, S. M. (2012) Investigation of the Water-Air Cooling Process of the Thick-Walled Extruded Profile Made of Alloy AW-6060 on the Output TableMetallurgical and mining industry 4 (2), S. 66–74
  • Golovko, O.; Rodman, D.; Nürnberger, F.; Schaper, M.; Frolov, I.; Bieliaiev, S. M. (2012) Issledovanie processa vodo-vozdušnogo ohlaždeniâ tolstostennogo pressovannogo profilâ iz splava EN AW-6060 na vyhodnom stoleIn: Metallurgičeskaja i gornorudnaja promyšlennost' (2), S. 33–38
  • Grydin, O.; Rodman, D.; Schaper, M. (2012) Influence of Cold Forming and Heat Treatment on the Microstructure and Mechani-cal Properties of an Air-Hardening SteelIn: Steel Research International 83 (11), S. 1020–1028. Weitere Informationen
  • Hampp, C.; Ullmann, B.; Reifenrath, J.; Angrisani, N.; Dziuba, D.; Bormann, D.; Seitz, J.-M.; Meyer-Lindenberg, A. (2012) Research on the Biocompatibility of the New Magnesium Alloy LANd442—An In Vivo Study in the Rabbit Tibia over 26 WeeksAdv. Eng. Mater.; 14; pp. B28–B37
  • Hinrichs, B.; Reimche, W.; Bruchwald, O.; Frackowiak, W.; Fritsching, U.; Bach, Fr.-W. (2012) Sensorkontrolliertes Bainitisieren im SpraydüsenfeldGWI Gaswärme International, 3, pp. 77-85
  • Hoyer, P.; Angrisani, G. -L; Klose, C.; Bach, Fr.-W.; Hassel, T. (2012) Influence of Aluminium on the Corrosion Behaviour of Binary Magnesium-Aluminium Alloys in Saline SolutionsMaterials and Corrosion, DOI: 10.1002/maco.201206531
  • Hoyer, P.; Hassel, T.; Bach, Fr.-W. (2012) Einfluss der Oberflächenbehandlung auf das Korrosionsverhalten von MagnesiumlegierungenIn: Materialwissenschaft und Werkstofftechnik 43 (12), S. 1067–1073
  • Huehnerschulte, T.; Reifenrath, J.; Rechenberg, B. von; Dziuba, D.; Seitz, J.-M.; Bormann, D.; Windhagen, H.; Meyer-Lindenberg, A. (2012) In vivo assessment of the host reactions to the biodegra-dation of the two novel magnesium alloys ZEK100 and AX30 in an animal modelBioMedical Engineering OnLine; Vol.11 Iss. 14
  • Kammler, M.; Hadifi, T.; Nowak, M.; Bouguecha, A. (2012) Experimental and Numerical Investigations on Metal Flow during Direct Extrusion of EN AW-6082Key Engineering Materials Vol. 491 (2012) pp 137-144
  • Kiliclar, Yalin; Engelhardt, Markus; Vladimirov, Ivaylo N.; Pietryga, Michael P.; von Senden genannt Haverkamp, Hermann; Reese, Stefanie; Bach, Friedrich Wilhelm (2012) On the Improvement of Formability and the Prediction of Forming Limit Diagrams at Fracture by Means of Constitutive ModellingKEM (Key Engineering Materials), S. 29-34
    DOI: 10.4028/www.scientific.net/KEM.504-506.29
  • Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, Fr.-W. (2012) Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing ProcessesIn: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.
  • Klöpfer, E.; Bach, Fr.-W.; Evertz, T.; Otto, M.; Redenius, A. (2012) Ressourceneffizienz bei der Herstellung von dichtereduzierten Stählen mit dem BandgießverfahrenIn: Chemie Ingenieur Technik 84 (10), S. 1740–1748. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/cite.201200061/abstract.
  • Klose, C., Mroz, G., Rodman, M., Kujat, B., Bormann, D., Reimche, W., Bach, Fr.-W. (2012) Magnetic Magnesium Alloys Based on MgZn and SmCo with Sensory PropertiesAdvanced Engineering Materials, 14, 1-2 S. 28-34
  • Klose, C.; Kerber, K.; Otten, M.; Mroz, G.; Reimche, W.; Bach, Fr.-W. (2012) Mit magnetischen Legierungen werden ganze Bauteile zu SensorenIn: Maschinenmarkt (39), S. 62–65. Online verfügbar unter http://www.maschinenmarkt.vogel.de/themenkanaele/konstruktion/werkstoffe/articles/379106/.
  • Klose, C.; Mroz, G.; Angrisani, G. L.; Kerber, K.; Reimche, W.; Bach, Fr.-W. (2012) Casting Process and Comparison of the Properties of Adapted Load-Sensitive Magnesium AlloysIn: Production Engineering Research & Development. Online verfügbar unter http://link.springer.com/article/10.1007/s11740-012-0413-7.
  • Kohorst, P.; Borchers, L.; Strempel, J.; Stiesch, M.; Hassel, Th.; Bach, Fr.-W.; Hübsch, C. (2012) Low-temperature degradation of different zirconia ceramics for dental applications In: Acta Biomaterialia 8 (3), S. 1213–1220. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706111005034.
  • Lalk, M.; Reifenrath, J.; Angrisani, N.; Bondarenko, A.; Seitz, J.-M.; Mueller, P.; Meyer-Lindenberg, A. (2012) Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbitsIn: Journal of Materials Science: Materials in Medicine. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs10856-012-4812-2?LI=true.
  • Lehmann, E.; Schmaltz, S.; Germain, S.; Faßmann, D.; Weber, C.; Löhnert, S.; Schaper, M.; Bach, Fr.-W.; Steinamm, P.; Willner, K.; Wriggers, P. (2012) Material Model Identification for DC04 Based on the Numerical Modelling of the Polycrystalline Microstructure and Experimental DataKey Engineering Materials 504-506 pp.993–998
  • McMahon, R.E; Mab, J.; Verkhoturov, S.V; Munoz-Pinto, D.; Karaman, I.; Rubitschek, F.; Maier, H. J.; Hahn, M.S. (2012) A Comparative Study of the Cytotoxicity and Corrosion Resistance of Nickel--titanium and Titanium-niobium Shape Memory AlloysIn: Acta Biomaterialia 8, S. 2863–2870
  • Nürnberger, F.; Stolbchenko, M.; Grydin, O.; Gerstein, G.; Faßmann, D.; Schaper, M. (2012) Numerical investigation of in situ TEM tensile testsIn: Metallurgical and mining industry 4 (4), S. 37–44
  • Rodman, D.; Krause. C.; Nürnberger, F.; Bach, Fr.-W.; Gerdes, L.; Breidenstein, B. (2012) Investigation of the surface residual stresses in spray cooled induction hardened gearwheelsInternational Journal of Materials Research, Vol. 103, Nr. 1, pp. 73-79
    DOI: 10.3139/146.110622
  • Schaper, M.; Grydin, O. (2012) Stahlerzeugung am laufenden Band: Ressourcensparendes WalzgießenIn: Phi – Produktionstechnik Hannover informiert 13 (2), S. 16–17.
  • Schaup, J.; Holländer, U.; Roxlau, C.; Langohr, A.; Möhwald, K.; Bach, Fr.-W. (2012) Neue Nickelhartlote für den SchutzgasdurchlaufofenSchweissen und Schneiden 6 (64), S. 326–330
  • Seitz, J.-M., Bormann, U., Collier, K., Wulf, E., Eifler, R. and Bach, Fr.-W. (2012) Application of a Bioactive Coating on Resorbable, Neodymium Containing Magnesium Alloys, and Analyses of their Effects on the In Vitro Degradation Behavior in a Simulated Body FluidAdvanced Engineering Materials; DOI: 10.1002/adem.201180078; http://onlinelibrary.wiley.com/doi/10.1002/adem.201180078/full
  • Seitz, J.-M.; Eifler, R.; Stahl, J.; Kietzmann, M.; Bach, Fr.-W. (2012) Characterization of MgNd2 alloy for potential applications in bioresorbable implantable devicesIn: Acta Biomaterialia 8 (10), S. 3852–3864. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112002371
  • Shkatulyak, N.M; Briukhanov, A.A; Rodman, M.; Usov, V.V; Schaper, M.; Haferkamp, G.; Nastasyuk, V.A. (2012) Reverse Bending Effect on the Texture, Structure, and Mechanical Properties of Sheet CopperIn: The Physics of Metals and Metallography 112 (8), S. 810–816.
  • So, H.; Faßmann, D.; Hoffmann, H.; Golle, R.; Schaper, M. (2012) An investigation of the blanking process of the quenchable boron alloyed steel 22MnB5 before and after hot stamping processJournal of Materials Processing Technology 212 (2012), 437– 449
    DOI: 10.1016/j.jmatprotec.2011.10.006
  • Stolbchenko, M.; Grydin, O.; Schaper, M. (2012) Vlijanie bokovyh ogranichitelei na formirovanie tonkih polos pri valkovoi razlivke-prokatkeIn: Metallurgiceskaja i gornorudnaja promyvlennost' 277 (5), S. 32–36
  • Swider, M. A.; Langohr, A.; Möller, F.; Möhwald, K.; Bach, Fr-W; Hassel, T. (2012) Entwicklung flussmittelfreier Lote und Prozesse zum Löten von AluminiumlegierungenIn: Schweißen und Schneiden 64 (8), S. 490–496.
  • Usov, V.V; Bryukhanov, P.A; Rodman, M.; Shkatulyak, N.M; Shaper, M.; Klose, C.; Bach, Fr.-W. (2012) Influence of reversed bending on texture, strcture and mechanical properties of α-titanium sheetsIn: Deformation and Fracture of Materials (Deformatsiya I Razrushenie materialov) (9), S. 32–37.
  • Wulf, E.; Alphai, L.; Wetsphal, D.; Seitz, J.-M.; Schaper, M.; Becker, J.; Feldhoff, A.; Bach, Fr.-W. (2012) Grain refining of aluminium alloys and silicon by means of boron nitride particlesIn: International Journal of Material Research (IJMR). Online verfügbar unter http://www.ijmr.de/web/o_archiv.asp?ps=MK110866&task=03&o_id=25112811648-50.
  • Yu, Z.; Kuznietsov, K.; Mozgova, I.; Böhm, V.; Gretzki, T.; Nürnberger, F.; Schaper, M.; Reimche, W. (2012) Modeling the relationship between hardness and spray cooling parameters for pinion shafts using a neuro-fuzzy model strategy In: Journal of Heat Treatment and Materials 67 (1), S. 39–47.
  • Zaremba, D.; Biskup, C.; Heber, T.; Weckend, N.; Hufenbach, W.; Adam, F.; Bach, Fr.-W.; Hassel, T. (2012) Repair Preparation of Fiber-Reinforced Plastics by the Machining of a Stepped Peripheral ZoneIn: Journal of Mechanical Engineering 58 (10), S. 571–577.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C.; Langohr, A. (2011) Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnacesInternational Journal of Materials Research 2011/08, pp. 964-971
    DOI: 10.3139/146.110549
  • Belski, A.; Gastan, E.; Vahed, N.; Klose, C.; Rodman, M.; Lange, F.; Wurz, M.-C.; Bormann, D.; Rissing, L.; Behrens, B.-A.; Bach, Fr.-W. (2011) Process Principle for the Production of Sintered Dynamic Component-inherent Data StorageProduction Engineering Vol. 5, Nr. 3, S. 233-240, 2011. Weitere Informationen
    DOI: 10.1007/s11740-010-0290-x
  • Böhm, V.; Bruchwald, O.; Reimche, W.; Bach, Fr.-W.; Odening, D.; Behrens, B.-A. (2011) Acoustic Process Monitoring during Transient Precision Forging of High Strength Components.Metallurgical and mining industry 3 (7), S. 91–97.
  • Clausmeyer, T.; van den Boogaard, A. H.; Noman, M.; Gershteyn, G.; Schaper, M.; Svendsen, B. (2011) Phenomenological modeling of anisotropy induced by evolution of the dislocation structure on the macroscopic and microscopic scaleInternational Journal of Material Forming, 2011.
    DOI: 10.1007/s12289-010-1017-4
  • Diekamp, M.; Hübner, S.; Nürnberger, F.; Schaper, M.; Behrens, B.- A.; Bach, Fr.-W. (2011) Prozessoptimiertes Presshärten mittels Sprühkühlung – prozessintegrierte Wärme-behandlung von Blechen des Werkstoffes 22MnB5 In: HTM - Journal of Heat Treatment and Materials 2011 (6), S. 316–322. Online verfügbar unter http://www.htm-journal.de/HT110118
  • Elter, C.; Heuer, W.; Demling, A. P.; Hanning, M.; Heidenblut, T.; Stiesch, M. (2011) Comparative analysis of supra- and subgingival biofilm formation on polytetrafluorethylene and titanium surfaces of implant abutments.Int J. Prosthodontics (24), S. 373–375.
  • Engelhardt, M.; Grittner, N.; Bormann, D.; Bach, Fr.-W. (2011) Mikrostrukturelle Pressschweißnahtcharakterisierung im strangpressten Zustand für Al-Mg-Si-Legierungen: Microstructural weld seam characterisation in the as extruded condition for Al-Mg-Si-alloysMaterialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 531-541, 2011.
  • Erne, M. (2011) Das Institut für Werkstoffkunde der Leibniz Universität Hannover stellt seinen Bereich FORTIS vorThermal Spray Bulletin, Nr. 4/11, S. 14-19, 2011.
  • Faßmann, D.; Gershteyn, G.; Schaper, M.; Bach, Fr.-W. (2011) Präparations- und Analysestrategie zur Untersuchung verformungsinduzierter Poren in kaltverfomtem StahlPraktische Metallographie Vol. 48, Nr. 5, S. 232-238, 2011.
  • Golovko, O.; Danchenko, V.; Schaper, M. (2011) Correlation of temperature-speed extrusion parameters; tool design and quality of profiles of magnesium alloysMetallurgical and mining industry 3, 2011 (7), 23-31
  • Gretzki, T.; Rodman, D. (2011) Mit Spraykühlung Ressourcen schonen Phi – Produktionstechnik Hannover informiert 2/2011, S. 12-13
  • Gretzki, T.; Rodman, D.; Wolf, L.; Dalinger, A.; Krause, C.; Hassel, Th.; Bach, Fr.-W. (2011) Economic surface hardening by spray coolingHTM - Journal of Heat Treatment and Materials 66 (5), S. 290–296.
  • Grittner, N.; Engelhardt, M.; Hepke, M.; Bormann, D.; Behrens, B.-A.; Bach, Fr.-W. (2011) Modification of the mechanical anisotropy in extrudet AZ31 sheetsKey Engineering Materials Vol. 473, S. 490-497, 2011.
  • Grydin, O.; Schaper, M.; Danchenko, V. (2011) Twin-roll casting of high-strength age-hardened aluminium alloys.Metallurgical and mining industry 7 (3), S. 7–16.
  • Hampp, C.; Reifenrath, J.; Angrisani, N.; Bormann, D.; Seitz, J.-M.; Meyer-Lindenberg (2011) Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im KaninchenmodellBiomaterialien; 12; 1-4; S. 51
  • Hampp, C.; Reifenrath, J.; Angrisani, N.; Bormann, D.; Seitz, J.-M.; Meyer-Lindenberg, A. (2011) Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell.Biomaterialien 12 (1-4), S. 51.
  • Hassel, Th.; Lizunkova, Y.; Bach, Fr.-W.; Bataev, A.; Nikulina, A.; Teplich, A. (2011) Structure and properties of beaded welds created under water by power wireObrabotka Metallov 50 (1), S. 31–37
  • Hepke, M.; Rodman, M.; von Senden genannt Haverkamp, H.; Zilberg, J. V.; Briukhanov, A. A.; Bormann, D.; Schaper, M.; Bach, Fr.-W. (2011) Investigation of the influence of low cycle bending on the properties of thin sheetsInternational Aluminium Journal Vol. 87, Nr. 7-8, S. 60-62, 2011.
  • Hepke, M.; Rodman, M.; Zilberg, J. V.; Briukhanov, A. A.; Bormann, D.; Schaper, M.; Bach, Fr.-W. (2011) Investigation of the influence of low cycle alternating bending loads on the properties of thin sheets possessing different crystal lattice structuresMetallurgical and mining industry 3 (7), S. 69–73
  • Hoyer, P.; Hassel, Th.; Hübsch, C.; Birr, C.; Jendras, M.; Bach, Fr.-W. (2011) Einsatz innovativer Fügetechnologien und korrosionsschutzgerechter Designs an 200-l-Gebinden zur sicheren Lagerung schwach- und mittelradioaktiver Abfälleatw-International Journal for Nuclear Power 56 (10), S. 553–558
  • Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Bretschneider, M.; Kästner, M.; Reithmeier, E. (2011) Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structuresMaterialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
  • Hufenbach, W.; Adam, F.; Heber, T.; Weckend, N.; Bach, Fr.-W.; Hassel, T.; Zaremba, D. (2011) Novel Repair Concept for Composite Materials by Repetitive Geometrical Interlock ElementsMaterials 2011, 4; pp. 2219-2230.
  • Klose, Ch.; Mroz, G.; Rodman, M.; Kujat, B.; Bormann, D.; Reimche, W.; Bach, Fr.-W. (2011) Magnetic Magnesium Alloys based on MgZn and SmCo with Sensory PropertiesAdvanced Engineering Materials, 13, S. 1-7
    DOI: 10.1002/adem.201100197
  • Lie, L.; Langohr, A.; Erne, M.; Möhwald, K.; Bach, Fr.-W. (2011) Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die DruckindustrieIn: Thermal Spray Bulletin 4 (2), S. 114–120.
  • Lindel, I. D.; Elter. C.; Heuer, W.; Heidenblut, T.; Stiesch, M.; Schwestka-Polly, R.; Demeling, A.P. (2011) Comparative analysis of long-term biofilm formation on metal and ceramic brackets Angle Orthodontist, 81-5, S. 907-914
  • Lorenz, C.; Hoffmann, A.; Gross, G.; Windhagen, H.; Dellinger, P.; Möhwald, K.; Dempwolf, W.; Menzel, H. (2011) Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
  • Milenin, A.; Byrska, D.; Grydin, O. (2011) The multi-scale physical and numerical modeling of fracture phenomena in the MgCa0.8 alloyComputers & Structures 89, S. 1038–1049
  • Milenin, A.; Byrska-Wójcik, D.J; Grydin, O.; Schaper, M. (2011) The development with help of boundary element method, calibration and verifica-tion of the model of fracture of special magnesium alloys in microscaleIn: Rudy i metale niezelazne 56 (11), S. 581–587
  • Murray, N.; Konya, R.; Beniyash, A.; Bach, Fr.-W.; Hassel, Th. (2011) Schneiden und Schweißen von Kupfer mit dem ElektronenstrahlMetall - Internationalle Fachzeitschrift für Metallurgie 65 (11), S. 507–511
  • Nürnberger, F.; Grydin, O.; Yu, Z.; Schaper, M. (2011) Microstructural Behaviour of Tempering Steels during Precision Forging and Quenching from Hot-forming TemperaturesMetallurgical and Mining Industry, 2011, Vol. 3, No. 7, S. 79-86
  • Psyk, V.; Gershteyn, G.; Barlage, B.; Weddeling, C.; Albuja, B.; Brosius, A.; Tekkaya, A. E.; Bach, Fr.-W. (2011) Process Design for the Manufacturing of Magnetic Pulse Welded JointsKey Engineering Materials Vol. 473, S. 243-250, 2011.
    DOI: 10.4028/www.scientific.net/KEM.473.243
  • Rodman, D.; Kerber, K.; Yu, Z.; Mozgova, I.; Nürnberger, F.; Bach, Fr.-W. (2011) Orts- und temperaturabhängige Wärmeübergangskoeffizienten bei der Sprühkühlung von AlSi10Mg-GussplattenForschung im Ingenieurwesen Vol. 75, Nr. 1, S. 25-34, 2011.
    DOI: 10.1007/s10010-011-0131x
  • Rodman, D.; Krause, C.; Nürnberger, F.; Bach, Fr.-W.; Haskamp, K.; Kästner, M.; Reithmeier, E. (2011) Induction hardening of spur gearwheels made from 42CrMo4 hardening and tempering steel by employing spray coolingSteel Research International Vol. 82, Nr. 4, S. 329-336, 2011.
    DOI: 10.1002/srin.201000218
  • Schaper, M.; Lizunkova, Y.; Vucetic, M.; Cahyono, T.; Hetzner, H.; Opel, S.; Schneider, T.; Koch, J.; Plugge, B. (2011) Sheet-bulk Metal Forming a New Process for the Production of Sheet Metal Parts with Functional ComponentsIn: Metallurgical and mining industry 3 (7), S. 53–58.
  • Schaup, J.; Möhwald, K.; Bach, Fr.-W.; Deißer, T.A. (2011) Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und SchneidwerkzeugenInfo-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
  • Schumacher, S.; Stahl, J.; Bäumer, W.; Seitz, J.-M.; Bach, Fr.-W.; Petersen, L. J.; Kietzmann, M. (2011) Ex vivo examination of the biocompatibility of biodegradable magnesium via microdialysis in the isolated perfused bovine udder modelInt. J. Artif. Organs Vol. 34, Nr. 1, S. 34-43, 2011.
  • Seitz, J.-M., Utermöhlen, D., Wulf, E., Klose, C.; Bach, Fr.-W. (2011) Front Cover Advanced Materials 12/2011Advanced Engineering Materials; Vol. 13; Iss. 12; http://onlinelibrary.wiley.com/doi/10.1002/adem.201190032/abstract; doi: 10.1002/adem.201190032
  • Seitz, J.-M.; Collier, K.; Wulf, E.; Bormann, D.; Angrisani, N.; Meyer-Lindenberg, A.; Bach, Fr.-W. (2011) The Effect of Different Sterilization Methods on the Mechanical Strength of Magnesium Based Implant MaterialsAdvanced Engineering Materials.
    DOI: 10.1002/adem.201100074
  • Seitz, J.-M.; Collier, K.; Wulf, E.; Bormann, D.; Bach, Fr.-W. (2011) Comparison of the Corrosion Behavior of Coated and Uncoated Magnesium Alloys in an In Vitro Corrosion EnvironmentAdvanced Engineering Materials
    DOI: 10.1002/adem.201080144
  • Seitz, J.-M.; Eifler, R.; Bach, Fr.-W. (2011) Designentwicklung für einen resorbierbaren Magnesiumstent für die NasennebenhöhlenBiomaterialien 12 (1-4), S. 183
  • Seitz, J.-M.; Utermöhlen, D.; Wulf, E.; Klose, C.; Bach, Fr.-W. (2011) The manufacture of resorbable suture material from magnesium - drawning and stranding of thin wiresAdvanced Engineering Materials 13, 2011, S. 1087-1095
    DOI: 10.1002/adem.201100152
  • Soyarslan, C.; Faßmann, D.; Plugge, B.; Isik, K.; Kwiatkowski, L.; Schaper, M. et al. (2011) An Experimental and Numerical Assessment of Sheet-Bulk Formability of Mild Steel DC04Journal of Manufacturing Science and Engineering 133 (6). Online verfügbar unter http://link.aip.org/link/?MAE/133/061008 Weitere Informationen
  • Tiemann, S.; Lie, L.; Holländer, U.; Möhwald, K.; Bach, Fr.-W. (2011) Influence of reactive process gases on zinc solders on aluminium and steelWelding and Cutting 10 (5), S. 314–317
  • Ullmann, B.; Reifenrath, J.; Dziuba, D.; Seitz, J.-M.; Bormann, D.; Meyer-Lindenberg, A. (2011) In Vivo Degradation Behavoir of the Magnesium Alloy LAN442 in Rabbit TibiaeMaterials, 4; 12; P. 2197
  • Waltz, F.; Swider, M. A.; Hassel, Th.; Behrens, P.; Bach, Fr.-W. (2011) Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für MagnesiumUni Magazin (01|02 2011), S. 48–51
  • Waltz, F.; Swider, M. A.; Hassel, Th.; Behrens, P.; Bach, Fr.-W. (2011) Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für MagnesiumAlumniCampus (6), S. 32–35
  • Waltz, F.; Swider, M. A.; Hoyer, P.; Hassel, T.; Erne, M.; Möhwald, K.; Adlung, M.; Feldhoff, A.; Wickleder, C.; Bach, Fr.-W. (2011) Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloyJournal of Materials Science, Doi: 10.1007/s10853-011-5785-0
  • Bach, Fr.-W.; Bormann, D.; Rodman, M.; Haverkamp, H. (2010) Friction and Temperature Development in the Hot Roll Cladding ProcessSteel Research International Vol. 81, Nr. 1, S. 48-54, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2010) Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnacesKey Engineering Materials, Nr. 438, S. 73-80, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010) Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-ZnSchweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Reithmeier, E.; Kästner, M.; Abo-Namous, O. (2010) Non-contact geometry inspection of workpieces with optically non-cooperative surfacesKey Engineering Materials, Nr. 438, S. 123-129, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010) Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus LeichtmetalllegierungenMaterialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
  • Bach, Fr.-W.; Schaper, M.; Yu, Z.; Nürnberger, F.; Gretzki, T.; Rodman, D.; Springer, R. (2010) Computation of isothermal transformation diagrams of 42CrMo4 steel from dilatometer measurements with continuous cooling.International Heat Treatment and Surface Engineering Vol. 4, Nr. 4, S. 171-175, 2010.
  • Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010) Keramikinlays für SchneidstempelBleche Rohre Profile, Nr. 10, S. 16-17, 2010.
  • Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010) Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-SchneidstempelinlaysUTF science, Nr. III, S. 1-12, 2010.
  • Biskup, C.; Hassel, T.; Ojmertz, C. (2010) Cutting EdgeJournal of Medical Device Developments, Vol. 3, 2010, S. 54-58
  • Borchers, L.; Stiesch, M.; Bach, Fr.-W.; Buhl, J.-C.; Hübsch, C.; Jendras, M.; Keller, T.; Kohorst, P. (2010) Influence of hydrothermal and mechanical conditions on the strength of zirconiaActa Biomaterialia Vol. 2010, Nr. 6, S. 4547-4552, 2010.
  • Brukhanov, A. A.; Stoyanov, P. P.; Zilberg, J.; Schaper, M.; Rodman, M.; Hepke, M.; Rodman, D. (2010) Anisotropy of Mechanical Properties of Magnesium Alloy AZ31 Sheets as a Result of Sign-Variable Bending DeformationMetallurgical and Mining Industry. Vol. 2, Nr. 3, S. 215-219, 2010.
  • Brukhanov, A. A.; Zilberg, J.; Schaper, M.; Iovtschev, S.; Rodman, M.; Rodman, D. (2010) Vlijanie deformacii znakoperemennym izgibom na teksturu i anizotropiju uprugich svojstv listov nizkouglerodistoj staliMaterialovedenie Vol. 163, Nr. 10, S. 33-38, 2010.
  • Brukhanov, A. A.; Zilberg, J.; Schaper, M.; Stoyanov, P. P.; Rodman, M.; Hepke, M.; Rodman, D. (2010) Vlijanie cholodnoj pravki na teksturu i anizotropiju svojstv listov magnievogo splava AZ31Deformacija i razruvenie, Nr. 8, S. 34-41, 2010.
  • Danchenko, V.; Golovko, O.; Belyaev, S.; Schaper, M.; Nowak, M. (2010) Extrusion and Air-Water Cooling of AlSi1MgMn Alloy Extruded ProfilesMetallurgical and mining industry 2, 2010 (5), 355-362
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2010) Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-SchichtenGalvanotechnik, Nr. 11, S. 2646-2650, 2010.
  • Demling., A.; Elter, C.; Heidenblut, T.; Bach, Fr.-W.; Hahn, A.; Schwestka-Polly, R.; Stiesch, M.; Heuer, W. (2010) Reduction of biofilm on orthodontic brackets by use of a polytetrafluorethylene (PTFE) coatingEuropean Journal of Orthodontics, Nr. 32, S. 414-418, 2010.
  • Diebel, M.; Mroz, G.; Frackowiak, W.; Hauer, J.; Reimche, W.; Bach, Fr.-W. (2010) Setting of Gradient Material Properties and Quality Control of High Tension 3D NVEB-Weld JointsAdvanced Materials Research, Nr. 137, S. 375-411, 2010.
  • Drynda, A.; Hassel, Th.; Hoehn, R.; Perz, A.; Bach, Fr.-W.; Peuster, M. (2010) Development and biocompatibility of a novel corrodible fluoride-coated magnesium-calcium alloy with improved degradation kinetics and adequate mechanical properties for cardiovascular applications.Journal of Biomedical Materials Research Part A 93A (2), S. 763–775.
  • Erne, M.; Kolar, D.; Bach, Fr.-W.; Möhwald, K. (2010) Suspension Plasma Spraying of triboactive coatings for high temperature applicationsKey Engineering Materials, Nr. 438, S. 139-146, 2010.
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2010) Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying processMaterialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
  • Fassmann, D. (2010) Mittendrin statt nur dabei: Die Werkstoffkunde, elementare Säule der IngenieurwissenschaftenPhi Vol. 11, Nr. 2, S. 8-9, 2010.
  • Gershteyn, G.; Golosova, T.; Schaper, M.; Gerstein, D.; Lychagin, D.; Bach, Fr.-W. (2010) The Possible Mechanism of Slip Band FormationSistemnye Technologii Vol. 70, Nr. 5, S. 162-166, 2010.
  • Gershteyn, G.; Nowak, M.; Schaper, M.; Bach, Fr.-W. (2010) Untersuchung der mikrostrukturellen Werkstoffcharakteristik des Stahls DC06 bei der plastischen Umformung: Analysis on the micro structural material characteristic of the DC06 steel by the plastic deformationMaterialwissenschaft und Werkstofftechnik Vol. 41, Nr. 10, S. 844-852, 2010.
  • Grittner, N.; Bormann, D.; Springer, R.; Reimche, W.; Bach, Fr.-W. (2010) Zerstörungsfreie Messmethoden zur Bestimmung des Warmauslagerungszustandes von Aluminiumlegierungen am Beispiel der Legierung EN AW-6082Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 8, S. 646-651, 2010.
  • Grydin, O.; Ogins'kyy, Y.; Danchenko, O.; Bach, Fr.-W. (2010) Experimental twin-roll casting equipment for production of thin stripsMetallurgical and Mining Industry. Vol. 2, Nr. 5, S. 348-354, 2010.
  • Happel, C.-M.; Klose, C.; Witton, G.; Angrisani, G. L.; Wienecke, S.; Groos, S.; Bormann, D.; Bach, Fr.-W.; Männer, J.; Yelbuz, T. M. (2010) Non-destructive, high-resolution 3D visualization of a cardiac defect in the chick embryo resembling complex heart defect in humans using Micro-Computed Tomography. Double outlet right ventricle (DORV) with left juxtaposition of atrial appendages (LJAA).Circulation Vol. 122, Nr. 22, S. 561-564, 2010. Weitere Informationen
  • Hassel, T.; Birr, C.; Bach, Fr.-W. (2010) Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arcIn: Key Engineering Materials 438, S. 147–154.
  • Hassel, T.; Birr, C.; Bach, Fr.-W. (2010) Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arcKey Engineering Materials Vol. 2010, Nr. 438, S. 147-154, 2010.
  • Hepke, M.; Rodman, M.; Bormann, D.; Bach, Fr.-W.; Zilberg, J. (2010) Einfluss einer alternierenden Biegebeanspruchung auf die mechanischen Eigenschaften der Magnesiumlegierung AZ31Aluminium, Nr. 5, S. 55-58, 2010.
  • Höh, N. v. d.; Bormann, D.; Lucas, A.; Thorey, F.; Meyer-Lindenberg, A. (2010) Comparison of the In Vivo Degradation Progress of Solid Magnesium Alloy Cylinders and Screw-Shaped Magnesium Alloy Cylinders in a Rabbit ModelMaterials Science Forum, Nr. 638-642, S. 742-747, 2010.
  • Kasten, P.; Beyen, I.; Bormann, D.; Luginbühl, R.; Plöger, F.; Richter, W. (2010) The effect of two point mutations in GDF-5 on ectopic bone formation in a γ-tricalciumphosphate scaffoldBiomaterials Vol. 31, Nr. 14, S. 3878-3884, 2010.
  • Kirner, S.; Hartz-Behrend, K.; Forster, G.; Marques, J.-L.; Schein, J.; Erne, M.; Prehm, J.; Möhwald, K.; Bach, Fr.-W. (2010) Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels TomographieThermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
  • Klümper-Westkamp, H.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2010) Kontrolliertes Bainitisieren trumpft in puncto Wirtschaftlichkeit aufMaschinenmarkt, Nr. 24, S. 58-61, 2010.
  • Klümper-Westkamp, H.; Zoch, H.-W.; Reimche, W.; Zwoch, S.; Bach, Fr.-W. (2010) Wirtschaftlich Bainitisieren mit neuem Wirbelstrom-MesssystemGaswärme International Vol. 59, Nr. 6, S. 472, 2010.
  • Konya, R. (2010) Schneiden mit kleinsten TeilchenPhi, Nr. 1, S. 6-7, 2010.
  • Krause, A.; v. d. Höh, N.; Bormann, D.; Krause, C.; Bach, Fr.-W.; Windhagen, H.; Meyer-Lindenberg, A. (2010) Degradation behaviour and mechanical properties of magnesium implants in rabbit tibiae.Journal of Materials Science (45), S. 624–632.
  • Krause, C.; Springer, R.; Biasutti, F.; Gershteyn, G.; Bach, Fr.-W. (2010) Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach einer induktiven Hochgeschwindigkeitsaustenitisierung mit anschließendem AbschreckenJournal of Heat Treatment and Materials Vol. 65, Nr. 2, S. 96-101, 2010.
  • Milenin, A.; Byrska, D. I.; Grydin, O.; Schaper, M. (2010) Multi scale physical and numerical modelling of MgCa0,8 alloy tensile test in micro tensile/compression stage for a SEMComputer Methods in Materials Science Vol. 10, Nr. 2, S. 61-68, 2010.
  • Milenin, A.; Byrska, D. I.; Kustra, P.; Heidenblut, T.; Grydin, O.; Schaper, M. (2010) A model of ductility phenomena of MgCa0,8 alloy in cold forming processRudy i metale niezelazne Vol. 55, Nr. 4, S. 200-208, 2010.
  • Nürnberger, F.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; Koszurkiewicz, B.; Milenin, A. (2010) Microstructure transformations in tempering steels during continuous cooling from hot forging temperaturesSteel Research Vol. 81, Nr. 3, S. 224-233, 2010.
  • Plorin, T.; Bormann, D.; Heidenblut, T.; Bach, Fr.-W. (2010) Investigations into manufacturing composite profiles having local magnesium-foam reinforcementsAdvanced Materials Research, Nr. 137, S. 129-160, 2010.
  • Reich, A.; Schöne, O.; Keßler, O.; Grydin, O.; Nürnberger, F.; Nowak, M.; Schaper, M. (2010) Simulation of gas and spray quenching during extrusion of aluminium alloysKey Engineering Materials., Nr. 424, S. 57-64, 2010.
  • Rosen, S.; Varahram, A.; Möhring, H. C.; Hassel, T.; Denkena, B.; Bach, Fr.-W. (2010) Der Forschungsverbund "Geothermie und Hochleistungsbohrtechnik"Geothermische Energie - Mitteilungsblatt des GtV-Bundesverbandes Geothermie e.V. Vol. 19, Nr. 68, S. 21-23, 2010.
  • Schaup, J.; Katzenberg, F. (2010) Phase diagram of PMMA/PVDF-blends and effect of mixture-intensity on crystallization behaviorPolym. Mater. Sci. Eng, Nr. 239, S. 5951-5952, 2010.
  • Seitz, J.-M.; Bach, Fr.-W. (2010) Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der BiomedizintechnikAlumniCampus, Nr. 4, S. 44-46, 2010.
  • Seitz, J.-M.; Bach, Fr.-W. (2010) Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der BiomedizintechnikUnimagazin, Nr. 1, S. 48-50, 2010.
  • Seitz, J.-M.; Wulf, E.; Freytag, P.; Bormann, D.; Bach, Fr.-W. (2010) The Manufacture of Resorbable Suture Material from MagnesiumAdvanced Engineering Materials Vol. 12, Nr. 11, S. 1099-1105, 2010.
  • Thomann, M.; Höh, N. v. d.; Bormann, D.; Rittershaus, D.; Krause, C.; Windhagen, H.; Meyer-Lindenberg, A. (2010) Comparison of the Cross Sectional Area, the Loss in Volume and the Mechanical Properties of LAE442 and MgCa0.8 as Resorbable Magnesium Alloy Implants after 12 Months Implantation DurationMaterials Science Forum, Nr. 638-642, S. 675-680, 2010.
  • Wu, K. H.; Gastan, E.; Rodman, M.; Behrens, B.-A.; Bach, Fr.-W.; Gatzen, H.-H. (2010) Development and application of magnetic magnesium for data storage in gentelligent productsJournal of Magnetism and Magnetic Materials Vol. 322, Nr. 9-12, S. 1134-1136, 2010.
  • Wulf, E.; Seitz, J.-M.; Bormann, D.; Becker, J.-A.; Feldhoff, A.; Möhwald, K.; Bach, Fr.-W. (2010) In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen DiamantenSchweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
  • Zilberg, J.; Brukhanov, A. A.; Hepke, M.; Rodman, D.; Bormann, D.; Schaper, M.; Rodman, M. (2010) Izmenenie mechaniceskich svojstv lista iz splava AZ31 v rezul'tate rolikovoj pravkiRolling, Nr. 1, S. 3-6, 2010.
  • Alphei, L.; Braun, A.; Becker, V.; Feldhoff, A.; Becker, J.-A.; Wulf, E.; Krause, C.; Bach, Fr.-W. (2009) Crystallization of supercooled silicon droplets initiated through small silicon nitride particlesJournal of Crystal Growth Vol. 311, Nr. 5, S. 1250-1255, 2009.
  • Bach, Fr.-W.; Beniyash, A.; Lau, K.; Konya, R. (2009) Nonvacuum electron beam welding of structural steelsThe Paton Welding Journal, Vol. 2009, Nr. 5, pages 22-26.
  • Bach, Fr.-W.; Brukhanov, A. A.; Zilberg, J.; Wolshok, N. W.; Rodman, M.; Hepke, M. (2009) Entfestigung von Blechen aus der Mg-Legierung AZ31 beim alternierenden BiegenDeformation & Fracture of Materials, Nr. 5, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009) Zur Problematik des Gasaustausches beim Löten hohler Bauteile im SchutzgasdurchlaufofenINFO-SERVICE, Nr. 20, S. 16-19, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009) Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im SchutzgasofenINFO-SERVICE, Nr. 20, S. 6-11, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Schaup, J.; Holländer, U.; Wolter, K.-J.; Herzog, T.; Wohlrabe, H.; Wielage, B.; Lampke, T.; Weber-Nestler, D.; Bobzin, K.; Schlegel, A. (2009) Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die LötstelleSchweißen und Schneiden, Nr. 7, S. 358-368, 2009.
  • Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C. (2009) Gießformen mit Kapillareffekt.Gießerei-Erfahrungsaustausch (3), S. 22–23.
  • Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C. (2009) Gießformen mit Kapillareffekt Gießerei-Erfahrungsaustausch, Nr. 3, S. 22-23. Düsseldorf: Gießerei-Verlag GmbH, 2009.
  • Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C. (2009) Gießformen mit KapillareffektGießerei-Erfahrungsaustausch (3), S. 22–23
  • Bause, T.; Bach, Fr.-W.; Möhwald, K.; Erne, M. (2009) Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und KorrosionsschutzThermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
  • Behrens, B.-A.; Bach, Fr.-W.; Denkena, B.; Möhwald, K.; Deißer, T. A.; Kramer, N.; Bistron, M. (2009) Manufacturing of Reinforced High Precision Forging DiesSteel Research International, Nr. 12, S. 878-886, 2009.
  • Bernard, M.; Scheer, C.; Böhm, V.; Reimche, W.; Bach, Fr.-W. (2009) New Developments in Non-destructive Testing for Quality Assurance in Component ManufacturingSteel research int Vol. 80, Nr. 12, S. 916-928, 2009.
  • Bormann, D.; Milenin, A. (2009) Kleine Poren - große Wirkung: Magnesiumschwämme als bioresorbierbare ImplantateOrthopädie im Profil, Nr. 1, S. 14-15, 2009.
  • Demling, A.; Heuer, W.; Elter, C.; Heidenblut, T.; Bach, Fr.-W.; Schwestka-Polly, R.; Stiesch-Scholz, M. (2009) Analysis of supra- and subgingival long-term biofilm formation on orthodontic bandsEuropean Journal of Orthodontics, Nr. 31, S. 202-206, 2009.
  • Frolov, I.; Gretzki, T.; Yu, Z.; Nürnberger, F.; Hassel, T.; Bach, Fr.-W. (2009) Surface Hardening Spline Geometries of Heat-Treatable Steel Cf53 using Water-Air Spray CoolingMaterials Working by Pressure - Collection of science papers Vol. 20, Nr. 1, S. 270-275, 2009.
  • Golovko, O.; Danchenko, O.; Belyaev, S.; Kuzmina, O.; Nowak, M. (2009) Experimental research of pressing strips made of Mg-Al-Zn-Mn system alloy through precombustion chamber matrixesMetallurgiceskaja i gornorudnaja promyvlennost' Vol. 255, Nr. 3, S. 88-91, 2009.
  • Gretzki, T. (2009) Das Zwei-in-einem-Prinzip. Integrierte Wärmebehandlung präzisionsgeschmiedeter BauteileTechnologie-Informationen, Innovation Niedersachsen, Nr. 2, S. 10, 2009.
  • Gretzki, T. (2009) Randschichtvergüten durch gezieltes Abschrecken mit einer Wasser-Luft-Spraykühlung. Jahresbericht Produktionstechnisches Zentrum Hannover 2008, S. 78, 2009.
  • Gretzki, T.; Gershteyn, G. (2009) In situ Mikrostruktur während des Anlassens von 42CrMo4 im Transmissionselektronenmikroskop: Jahresbericht Produktionstechnisches Zentrum Hannover 2008, S. 77, 2009.
  • Gretzki, T.; Krause, C.; Frolov, I.; Hassel, T.; Nicolaus, M.; Bach, Fr.-W.; Kästner, M.; Abo-Namous, O.; Reithmeier, E. (2009) Manufacturing Surface Hardened Components of 42CrMo4 by Water-Air Spray CoolingSteel Research International Vol. 80, Nr. 12, S. 906-915, 2009.
  • Grittner, N.; Haverkamp, H.; Stelling, O.; Bormann, D.; Schimanski, K.; Nikolaus, M.; Hehl, A. v.; Bach, Fr.-W.; Zoch, H.-W. (2009) Verbundstrangpressen von Titan-Aluminium-VerbindungenMaterialwissenschaft und Werkstofftechnik Vol. 40, Nr. 12, S. 901-906, 2009.
  • Höh, N. v. d.; Bormann, D.; Lucas, A.; Denkena, B.; Hackenbroich, C.; Meyer-Lindenberg, A. (2009) Influence of Different Surface Machining Treatments of Magnesium-based Resorbable Implants on the Degradation Behaviour in RabbitsAdvanced Engineering Materials Vol. 11, Nr. 5, S. B47-B54, 2009.
  • Höh, N. v. d.; Rechenberg, B. v.; Bormann, D.; Lucas, A.; Meyer-Lindenberg, A. (2009) Influence of Different Surface Machining Treatments of Resorbable Magnesium Alloy Implants on Degradation: EDX-Analysis and Histology ResultsMaterialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 88-93, 2009.
  • Hübner, S.; Palkowski, H.; Behrens, B.-A.; Bach, Fr.-W.; Wesling, V.; Esderts, A.; Rudolph, K.-M.; Voges-Schwieger, K.; Weilandt, K.; Mielke, J.; Knigge, J.; Hagen, T.; Asadi, M.; Sokolova, O.; Wiche, H.; Medhurst, T.; Diebel, M. (2009) Im Fertigungsprozess lassen sich Bauteile spezifisch optimierenMaschinenmarkt Vol. 44, S. 26-29, 2009.
  • Krause, C.; Springer, R.; Gershteyn, G.; Dudzinski, W.; Bach, Fr.-W. (2009) In-situ high temperature microstructural analysis during tempering of 42CrMo4 using transmission electron microscopyInternational Journal of Materials Research Vol. 2009, Nr. 7, S. 991-1000, 2009.
  • Kustra, P.; Milenin, A.; Schaper, M.; Grydin, O. (2009) Multiscale modeling and interpretation of tensile test of magnesium alloy in microchamber for the SEMComputer Methods in Materials Science Vol. 9, Nr. 2, S. 207-214, 2009.
  • Nürnberger, F.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; Evertz, T.; Kluge, U. (2009) Isothermal Microstructural Transformations of the Heat-treatable Steel 42CrMo4 during Heat-treatment following Hot-formingSteel Research International Vol. 80, Nr. 12, S. 892-898, 2009.
  • Nürnberger, F.; Grydin, O.; Yu, Z.; Schaper, M.; Bach, Fr.-W. (2009) Simulation of Integrated Heat-treatment of Precision Forged ComponentsSteel Research International Vol. 80, Nr. 12, S. 899-905, 2009.
  • Nürnberger, F.; Rodman, D.; Grydin, O.; Diekamp, M.; Mozgova, I.; Bach, Fr.-W. (2009) Spray cooling of aluminium chassis framesSucasni problemy metalurhii Vol. 12, S. 92-99, 2009.
  • Nürnberger, F.; Schaper, M.; Bach, Fr.-W.; Mozgova, I.; Kuznetsov, K.; Halikova, A.; Perederieva, O. (2009) Prediction of continuous cooling diagrams for the precision forged tempering steel 50CrMo4 by means of artificial neural networksAdvances in Materials Science and Engineering, 2009.
  • Pfahl, A.; Puchert, A.; Behrens, B.-A.; Bach, Fr.-W. (2009) Legierungsentwicklung zur Verschleißreduzierung von Schmiedegesenken -Einfluss von Mangan auf die Absenkung der Ac1b-TemperaturHTM - Journal of Heat Treatment and Materials Vol. 64, Nr. 5, S. 291-296, 2009.
  • Reimche, W.; Bach, Fr.-W.; Zwoch, S.; Stahlhut, C.; von der Haar, C.; Kallage, P.; Herzog, D.; Haferkamp, H. (2009) Eddy current technology - a new procedure for the detection of zero-gap grooves during laser weldingWelding and Cutting Vol. 8, Nr. 6, S. 359-364, 2009.
  • Schaper, M.; Grydin, O. (2009) Experimentelle Untersuchungen der Mikrostrukturentwicklung und mechanischen Eigenschaften von Metallen mittels Zug/Druck/Biegemodul im Rasterelektronen-mikroskopIn: Praktische Metallographie 41 (Sonderband zur 43. Metallographie-Tagung), S. 139–144.
  • Schumacher, S.; Stahl, J.; Niedorf, F.; Bäumer, W.; Bach, Fr.-W.; Seitz, J.-M.; Petersen, L. J.; Kietzmann, M. (2009) In Vitro Testing of Biodegradable ImplantsJournal of Veterinary Pharmacology and Therapeutics Vol. 32, Nr. s1, S. 264-265, 2009.
  • Schumacher, S.; Stahl, J.; Niedorf, F.; Bäumer, W.; Krause, C.; Bach, Fr.-W.; Seitz, J.-M.; Kietzmann, M. (2009) In-Vitro Biocompatibility Testing of Degradable Magnesium-Based Alloys on Murine Fibroblasts L929Naunyn-Schmiedeberg's Archives of Pharmacology Vol. 379, Nr. Suppl.1, S. 70, 2009.
  • Shevchenko, N. V.; Gershteyn, G.; Schaper, M.; Bach, Fr.-W. (2009) Structure investigation of austenitic steel after cold rolling deformationSucasni problemy metalurhii Vol. 12, S. 107-113, 2009.
  • Stahlhut, C.; von der Haar, C.; Kallage, P.; Herzog, D.; Haferkamp, H.; Bach, Fr.-W.; Reimche, W.; Zwoch, S. (2009) Wirbelstromtechnik - ein neues Verfahren zur Detektion von Nullspaltfugen bei LaserstrahlschweißenSchweissen und Schneiden Vol. 61, Nr. 9, S. 520-527, 2009.
  • Teplyakova, L.; Gershteyn, G.; Popova, E.; Kozlov, L.; Ignatenko, R.; Springer, R.; Schaper, M.; Bach, Fr.-W. (2009) Scale-dependent hierarchy of structural elements in the microstructure of thermomechanical treated ferritic steels with residual austeniteMaterialwissenschaft und Werkstofftechnik Vol. 40, Nr. 9, S. 704-712, 2009.
  • Thomann, M.; Krause, C.; Bormann, D.; Höh, N. v. d.; Windhagen, H.; Meyer-Lindenberg, A. (2009) Comparison of the resorbable magnesium alloys LAE442 und MgCa0.8 concerning their mechanical properties, their progress of degradation and the bone-implant-contact after 12 months implantation duration in a rabbit modelMaterialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 82-87, 2009.
  • Thomann, M.; Krause, C.; Höh, N. v. d.; Bormann, D.; Hassel, T.; Windhagen, H.; Meyer-Lindenberg, A. (2009) Influence of a magnesium-fluoride coating of magnesium-based implants (MgCa0.8) on degradation in a rabbit modelJournal of Biomedical Materials Research, 2009.
  • Wulf, E. (2009) Nanopartikel als Kornfeiner: Jahresbericht Produktionstechnisches Zentrum Hannover 2008, S. 74, 2009.
  • Wulf, E. (2009) Kleine Teilchen - große WirkungPhi Vol. 10, Nr. 1, S. 6-7, 2009.
  • Wulf, E.; Krause, C.; Bormann, D.; Schaper, M.; Becker, J.-A.; Woenckhaus, V.; Bach, Fr.-W. (2009) Thermographic analysis of AlSi12 during crystallization as a function of cooling rateInternational Journal of Materials Research Vol. 100, Nr. 1, S. 97-103, 2009.
  • Zilberg, J.; Bach, Fr.-W.; Bormann, D.; Rodman, M.; Schaper, M.; Hepke, M. (2009) Effect of alternating bending on the structure and properties of strips from AZ31 magnesium alloyMetallovendenie Vol. 646, Nr. 4, S. 20-25, 2009.
  • Bach, Fr.-W.; Bormann, D.; Haverkamp, H. (2008) Walzplattierte LeichtmetallverbundeWerkstoffe in der Fertigung, Nr. 4, S. 33-35, 2008.
  • Bach, Fr.-W.; Bormann, D.; Rodman, M.; Haverkamp, H. (2008) Hybrides Walzen am Beispiel von Titan-Aluminium-VerbundenMaterialwissenschaft und Werkstofftechnik Vol. 39, Nr. 9, S. 588-593, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008) Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenSchweißen und Schneiden, Nr. 4, S. 192-199, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008) Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenMaterialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Erne, M. (2008) Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten PulvernSchweißen und Schneiden, Nr. 11, S. 625-631, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008) Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten SchichtenMaterialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Tillmann, W.; Vogli, E.; Nebel, J. (2008) Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal sprayingThermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S. (2008) Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von AluminiumwerkstoffenMaterialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
  • Behrens, B.-A.; Bach, Fr.-W.; Reimche, W.; Gastan, E.; Lange, F.; Mroz, G. (2008) Verfahren zur Einbringung und Wiedergabe von Daten in SinterbauteilenMetall - Internationalle Fachzeitschrift für Metallurgie Vol. 62, Nr. 5, S. 298-301, 2008.
  • Behrens, B.-A.; Bistron, M.; Kueper, A.; Möhwald, K. (2008) Investigation of Load Adapted Gears and Shafts Manufactured by Compound-ForgingJournal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
  • Belyaev, S.; Golovko, O.; Nowak, M.; Dizha, E. (2008) Analyse der Besonderheiten beim Strangpressen von bimetallischen Aluminium-Magnesium-VerbundenTheorie und Praxis der Metallurgie, Nr. 5-6, S. 46-50, 2008.
  • Cwiekala, T.; Brosius, A.; Tekkaya, A. E.; Grydin, O.; Schaper, M.; Bach, Fr.-W. (2008) Efficient Modelling and Simulation of Process Chains in Sheet Metal Forming and ProcessingSteel Research International Vol. 79, Nr. 10, S. 731-737, 2008.
  • Elter, C.; Heuer, W.; Demling, A.; Hannig, M.; Heidenblut, T.; Bach, Fr.-W.; Stiesch-Scholz, M. (2008) Supra- and subgingival biofilm formation on implant abutments with different surface characteristicsInternational Journal of Oral & Maxillofacial Implants Vol. 23, Nr. 2, S. 327-334, 2008.
  • Golovko, O.; Nowak, M.; Kuzmina, O. (2008) Influence of the die geometry parameters on the quality of the aluminum thick -wall extruded stripsHerald of the DSEA, Nr. 3E (14), S. 27-39, 2008.
  • Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2008) Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte SpritzschichtenSchweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
  • Heuer, W.; Elter, C.; Demling, A.; Suerbaum, S.; Heidenblut, T.; Bach, Fr.-W.; Hannig, M.; Stiesch-Scholz, M. (2008) Analyse der initialen Biofilmbildung auf oberflächenmodifizierten Healing-AbutmentsDeutsche Zahnärztliche Zeitschrift Vol. 63, Nr. 9, S. 632-638, 2008.
  • Höh, N. v. d.; Thomann, N.; Bormann, D.; Hassel, T.; Windhagen, H.; Meyer-Lindenberg, A. (2008) Einfluss verschiedener Implantate aus Magnesiumlegierungen auf den periostalen Knochenzuwachs in der KaninchentibiaBiomaterialien Vol. 9, Nr. 1/2, S. 66, 2008.
  • Klümper-Westkamp, H.; Vetterlein, J.; Lütjens, J.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2008) Bainite Sensor - A new tool for process and quality control of the bainite transformationHTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 3, S. 174-180, 2008.
  • Krause, C.; Bach, Fr.-W.; Bormann, D.; Zeddies, M.; Krause, A.; Meyer-Lindenberg, A.; Windhagen, H. (2008) Resorbierbare Marknägel auf MagnesiumbasisSchweizer Maschinenmarkt, Nr. 1/2, S. 94-99, 2008.
  • Krause, C.; Bormann, D.; Bach, Fr.-W.; {et al.} (2008) Randschichtvergüten von Zahnwellen mittels Wasser-Luft-SpraykühlungHMT - Journal of Heat Treatment and Materials - Zeitschrift für Werkstoffe, Wärmebehandlung, Fertigung Vol. 63, Nr. 1, S. 22-26, 2008.
  • Krause, C.; Hassel, T.; Frolov, I.; Gretzki, T.; Kästner, M.; Seewig, J.; Bormann, D.; Bach, Fr.-W. (2008) Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Sprühkühlung.HTM, Härterei-Technische Mitteilungen Vol. 63, Nr. 1, S. 22-26, 2008.
  • Krause, C.; Wulf, F.; Nürnberger, F.; Bach, Fr.-W. (2008) Wärmeübergangs- und Tropfencharakteristik für eine Spraykühlung im Temperaturbereich von 900 °C bis 100 °CForschung im Ingenieurwesen Vol. 72, Nr. 3, S. 163-173, 2008.
  • Kucharski, R.; Bormann, D.; Bach, Fr.-W.; Jendras, M.; Hauser, M.; Müller, P. P.; Reifenrath, J.; Meyer-Lindenberg, A. (2008) Herstellung von offenporigen Magnesium-Keramik-ImplantatenBiomaterialien Vol. 9, Nr. 3/4, S. 110, 2008.
  • Peuster, M.; Beerbaum, P.; Bach, Fr.-W. (2008) Are resorbable implants about to become a reality? Cardiology in the Young (16), S. 107–116.
  • Plorin, T.; Bormann, D.; Bach, Fr.-W. (2008) The Manufacture and Characterisation of Reinforced Magnesium FoamsSteel Research International Vol. 79, Nr. 3, S. 185-190, 2008.
  • Reimche, W.; Bach, Fr.-W.; Mroz, G.; Duhm, R.; Bernard, M.; Diebel, M. (2008) High Strength 3D Non-Vacuum Electron Beam Weld Joints - Setting of Gradient Material Properties and Testing of Weld QualitySteel research int Vol. 79, Nr. 3, 2008.
  • Reimche, W.; Bernard, M.; Bombosch, S.; Scheer, C.; Bach, Fr.-W. (2008) Nachweis von Anrissen in der Randzone von Hochleistungsbauteilen mit Wirbelstromtechnik und induktiv angeregter ThermographieHTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 5, S. 284-297, 2008.
  • Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008) Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer WirbelstromsensorikSchweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
  • Thomann, M.; Hassel, T.; Bormann, D.; Höh, N. v. d.; Windhagen, H.; Meyer-Lindenberg, A. (2008) Einfluss einer Magnesiumfluoridbeschichtung auf die Degradation von MgCa0,8-Implantaten in vivoBiomaterialien Vol. 9, Nr. 3/4, S. 99, 2008.
  • Zwoch, S.; Reimche, W.; Klotz, J.; Bach, Fr.-W. (2008) Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von BolzenschweißverbindungenSchweissen und Schneiden Vol. 60, Nr. 4, S. 205-210, 2008.
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Meyer-Lindenberg, A. (2007) Magnesium sponges as a bioabsorbable Material: Attributes and ChallengesZeitschrift für Metallkunde: International Journal of Materials Research Vol. 98, Nr. 7, S. 609-612, 2007.
  • Bach, Fr.-W.; Bormann, D.; Plorin, T. (2007) Developments for the Production of Locel Foamed Hollow SectionsAdvanced Engineering Materials, Nr. 22, S. 37-47, 2007.
  • Bach, Fr.-W.; Holländer, U.; Möhwald, K.; Nicolaus, M. (2007) Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folienSchweißen und Schneiden, Nr. 2, S. 78-83, 2007.
  • Bach, Fr.-W.; Kremer, G.; Rümenapp, T.; Peter, D.; Brüggemann, P. (2007) Schneid- und Dekontiminationstechnologien für den kostengünstigen Rückbau kerntechnischer Anlagenawt Vol. 52, Nr. 4, S. 256-262, 2007.
  • Bach, Fr.-W.; Milenin, A.; Kucharski, R.; Bormann, D.; Kustra, P. (2007) The FEM simulation of a magnesium alloy wire drawing for chirurgical applicationsHutnik - Polish Journal of Metallurgy Vol. 74, Nr. 1-2, S. 8-11, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007) Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit KupferMaterialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M.; Deißer, T. A. (2007) A PVD Joining Hybrid Process for Manufacturing Complex Metal CompositesThe Welding Journal, Nr. 86, S. 373-378, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Roxlau, C.; Hartz, K. (2007) Gießen im MikromaßstabSchweizer Maschinenmarkt, Nr. 24, S. 119-121, 2007.
  • Bernard, M.; Reimche, W.; Bach, Fr.-W. (2007) Zerstörungsfreie Bestimmung von Härtekennwerten zur Qualitätssicherung von Hochleis-tungsbauteilen in der FertigungHTM - Journal of Heat Treatment and Materials Vol. 62, Nr. 6, S. 265-273, 2007.
  • Biskup, C. (2007) Wasserstrahl erstetzt die SägeKrankenhaus Technik + Management, Ausgabe 6, Juni 2007, S.40
    ISBN: ISSN 1619-4772 B 1494
  • Biskup, C.; Bach, Fr.-W.; Bormann, D.; Kremer, G. (2007) Wasserabrasivstrahlen als medizinisches WerkzeugSchweizer Maschinenmarkt, Ausgabe 14/15, 108. Jahrgang, Juli 2007, S. 62-63
  • Braun, M.; Krause, C.; Bormann, D.; Stahl, J.; Schwab, B.; Kietzmann, M.; Bach, Fr.-W.; Lenarz, T.; {et al.} (2007) Untersuchungen zur Biokompatibilität von Magnesiumlegierungen als degradable ImplantatwerkstoffeBiomaterialien Vol. 8, Nr. 3, S. 183, 2007.
  • Heidenblut, T.; Möhwald, K.;Deißer, T. A.; Bistron, M.;Behrens, B.-A.;Bach, Fr.-W. (2007) Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron MicroscopeMicroscopy and Microanalysis, S. 104-105, 2007.
  • Heuer, W.; Elter, C.; Demling, A.; Neumann, A.; Suerbaum, S.; Hannig, M.; Heidenblut, T.; Bach, Fr.-W.; Stiesch-Stolz, M. (2007) Analysis of early biofilm formation on oral implants in manJournal of Oral Rehabilitation Vol. 34, Nr. 5, S. 377-382, 2007.
  • Höh, N. v. d.; Rechenberg, B. v.; Bormann, D.; Lucas, A.; Witte, F.; Meyer-Lindenberg, A. (2007) Einfluss unterschiedlicher Oberflächenbearbeitung von resorbierbaren Magnesiumimplantaten: Histologische ErgebnisseBiomaterialien Vol. 8, Nr. 3, S. 213, 2007.
  • Kleiner, M.; Hermes, M.; Weber, M.; Olivier, H.; Gershteyn, G.; Bach, Fr.-W.; Brosius, A. (2007) Tube expansion by gas detonationProd. Eng. Res. Devel. Vol. 2007, Nr. 1, S. 9-17, 2007.
  • Kucharski, R.; Bach, Fr.-W.; Balzewicz, S.; Chlopek, J.; Bormann, D. (2007) Application of Ti-6Al-4V for Tissue EngineeringEngineering of Biomaterials, Nr. 69-72, S. 18-22, 2007.
  • Lindemeier, D.; Steiner, A.; Biskup, C.; Bormann, D.; Müller, P. P.; {et al.} (2007) Zellkulturmodelle zur Evaluierung von Magnesiumlegierungen als degradierbare ImplantatmaterialienBiomaterialien Vol. 8, Nr. 3, S. 189, 2007.
  • Louis, H.; Pude, F.; Rad, C. v.; Versemann, R. (2007) ABRASIVE WATER SUSPENSION JET TECHNOLOGY - FUNDAMENTALS; APPLICATION AND DEVELOPMENTSWelding in the World Vol. 51, Nr. 9/10, 2007.
  • Menneking, C.; Isemann, M.; Wissmann, G.; Klose, C.; Bormann, D.; Bach, Fr.-W.; Behrens, P. (2007) Neue poröse Chitosan-KompositmaterialienBiomaterialien Vol. 8, Nr. 3, S. 249.
  • Meyer-Lindenberg, A.; Krause, A.; Krause, C.; Bormann, D.; Windhagen, H. (2007) Entwicklung der mechanischen Eigenschaften von degradablen intramedullären Implantaten auf Magnesiumbasis nach unterschiedlicher ImplantationsdauerBiomaterialien Vol. 8, Nr. 3, S. 180, 2007.
  • Michaeli, W.; Kamps, T.; Schmachtenberg, E.; Lurz, A.; Vetter, K.; Schmiederer, D.; Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Piotter, V.; Prokop, J. (2007) Mit neuen Prozessketten zu wirtschaftlicher MikrofertigungMikroproduktion, Nr. 4, S. 18-22, 2007.
  • Reifenrath, J.; Willbold, E.; Meyer-Lindenberg, A.; Bormann, D.; {et al.} (2007) Der Einfluss von Subchondralen Magnesiumimplantaten auf das peri-implantäre GewebeBiomaterialien Vol. 8, Nr. 3, S. 188, 2007.
  • Reimche, W.; Bach, Fr.-W.; Mroz, G.; Duhm, R. (2007) Setting of gradient material properties and quality control of high tension 3D-weld jointsAdvanced Materials Research Vol. 22, S. 113-125, 2007.
  • Thomann, M.; Krause, C.; Bormann, D.; Höh, N. v. d.; Windhagen, H.; Meyer-Lindenberg, A. (2007) Vergleich der resorbierbaren MagnesiumlegierungenLAE442 und MGCa0,8 bezüglich der Degradation und Biokompatibilität im Zeitraum von 12 MonatenBiomaterialien Vol. 8, Nr. 3, S. 182, 2007.
  • Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Jendras, M.; Windhagen, H.; Hackenbroich, C.; Krause, A.; Meyer-Lindenberg, A. (2006) Resorbowalne, metaliczne implanty kostne/Resorbing Metallic Bone ImplantsOrthopedic Quarterly, Nr. 2, S. 105-110, 2006.
  • Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2006) Magnesium Compound Structures for the Treatment of Bone DefectsEngineering of Biomaterials, Nr. 56-57, S. 58-61, 2006.
  • Bach, Fr.-W.; Kucharski, R.; Bormann, D.; Besdo, D.; Besdo, S.; Hackenbroich, C.; Thorey, F.; Meyer-Lindenberg, A. (2006) Design and Resorption Properties of the Metal bone Implants: Application in-vivoEngineering of Biomaterials, Nr. 56-57, S. 54-58, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Drößler, B.; Hartz, K. (2006) Particle Image Velocimetry in Thermal SprayingAdvanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2006) Weiterentwicklung des Hochtemperaturlötens mit LedeburitlotenSchweißen und Schneiden, Nr. 2, S. 84-90, 2006.
  • Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Krause, C.; Broer, O. (2006) Simulation des Abschreckhärtens mittels Spraykühlung~- Wärmeübergang, Gefüge und HärteHTM Vol. 61, Nr. 3, S. 142-147, 2006.
  • Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Krause, C.; Grydin, O. (2006) Bestimmung der Streckgrenze und der Hall-Petch-Konstanten des Vergütungsstahles 42CrMo4 unterschiedlichen Gefügezustandes mittels EindruckprüfungenMaterialwissenschaft und Werkstofftechnik Vol. 37, Nr. 8, S. 668-673, 2006.
  • Biskup, C.; Krömer, S.; Höver, M.; Versemann, R.; Bach, Fr.-W.; Kirsch, L.; Andreae, A.; Pude, F.; Schmolke, S. (2006) Heat Generation During Abrasive Water-Jet Osteotomies Measured by ThermocouplesJournal of Mechanical Engineering, Vol. 52, No. 7-8, July/Aug.2006, S. 451-457
    ISBN: ISSN 0039-2480
  • Chlopek, J.; Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2006) New resorbable metal and polymer implants for bone surgeryMaterialy i Technologie, Nr. 4, S. 57-62, 2006.
  • Grydin, O.; Golovko, O.; Danchenko, O.; Nowak, M. (2006) The influence of direct extrusion process parameters on the temperature of profile of aluminium alloyMetallurgiceskaja i gornorudnaja promyvlennost', Nr. 6, S. 39-42, 2006.
  • Höh, N. v. d.; Krause, A.; Hackenbroich, C.; Bormann, D.; Lucas, A.; Meyer-Lindenberg, A. (2006) Einfluss der Oberflächenbearbeitung von resorbierbaren Implantaten wus verschiedenen Magnesium-Calciumlegierungen auf die Degradation: Erste Ergebnisse einer Pilotstudie am KaninchenmodellDeutsche tierärztliche Wochenschrift Vol. 113, Nr. 10, S. 439-446, 2006.
  • Höh, N. v. d.; Lucas, A.; Hackenbroich, C.; Bormann, D.; Meyer-Lindenberg, A. (2006) The Influence of the Surface Machining of Resorbable Implants made of Magnesium Alloys on Degradation in rabbitsBiomaterialien Vol. 7, Nr. 1, S. 122, 2006.
  • Krause, C.; Gretzki, T.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W. (2006) Messung der Spraycharakteristik zur Bestimmung des Wärmeübergangskoeffizienten bei der SpraykühlungForschung im Ingenieurwesen, Springer Verlag Vol. 70, Nr. 4, S. 237-242, 2006.
  • Krause, C.; Scheer, C.; Nürnberger, F.; Reimche, W.; Bach, Fr.-W. (2006) Annealing of the edge-layer of precision forged gears of 42CrMo4 by a two-phase spray coolingVestnik NTUU KPI, Nr. 48, S. 33-36, 2006.
  • Kremer, G.; Stanke, D.; Biena, H.; Loeb, A.; Thoma, M.; Eisenmann, B.; Prechtl, E.; Süßdorf, W.; Rümenapp, T. (2006) Contact-Arc-Metal-Cutting (CAMC) - Eine junge Schneidtechnologie ist den Kinderschuhen entwachstenawt Vol. 51, Nr. 3, S. 170-172, 2006.
  • Meyer-Lindenberg, A.; Krause, C.; Bormann, D.; Windhagen, H.; Hackenbroich, C.; Krause, A. (2006) Changes of the surfaces of different magnesium alloys as degradable implants during degradation in rabbit tibiaeBiomaterialien Vol. 7, Nr. 1, S. 92, 2006.
  • Nürnberger, F.; Broer, O.; Grydin, O.; Schäfer, M.; Schaper, M.; Behrens, B.-A. (2006) Simulation of the γ-grain size evolution during precision forging of helical gears made of tempering steel 42CrMo4Vestnik NTUU KPI, Nr. 48, S. 36-41, 2006.
  • Witte, F.; Reifenrath, J.; Müller, P. P.; Crostack, H.-A.; Nellsen, J.; Bach, Fr.-W.; Bormann, D.; Rudert, M. (2006) Cartilage repair on magnesium implants as scaffolds used as subchondral bone replacementMaterialwissenschaft und Werkstofftechnik Vol. 37, Nr. 6, S. 504-508, 2006.
  • Bach, Fr.-W.; Behrens, B.-A.; Rodman, M.; Rossberg, A.; Kurz, G. (2005) Macroscopic damage by the formation of shear bands during the rolling and deep drawing of magnesium sheetsJOM Journal of the Minerals, Metals and Materials Society 57 (5), S. 57–61.
  • Bach, Fr.-W.; Hassel, T.; Bormann, D.; Kucharski, R. (2005) Elektrochemisch induzierte Abscheidung von Calciumphosphat auf der Oberfläche von kompakten und zellularen Strukturen aus MagnesiumlegierungenR. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6)
  • Bach, Fr.-W.; Hassel, Th.; Golovko, O.; Hackenbroich, A.; Meyer-Lindenberg, A. (2005) Resorbierbare Implantate aus Magnesium durch Mikrolegieren mit Calcium, deren Verarbeitung und EigenschaftenR. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
  • Bach, Fr.-W.; Kremer, G.; Versemann, R.; Chlipik, J. (2005) Calculation of the flow field during contact arc metal cutting under waterWelding and Cutting Vol. 4, Nr. 4, 2005.
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Engl, L. (2005) Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter BeschichtungenMaterialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2005) Ultraschallassistiertes Flammlöten von AluminiumlegierungenSchweißen und Schneiden, Nr. 9, S. 482-487, 2005.
  • Bach, Fr.-W.; Nürnberger, F.; Broer, O.; Schaper, M.; Grydin, O. (2005) Simulation of the microstructure transformation in quenched gears after precision forging of the tempering steel 42CrMo4Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 232, Nr. 4, S. 48-51, 2005.
  • Bach, Fr.-W.; Nürnberger, F.; Krause, C. (2005) Außen hart und Innen weich - Randschichtvergüten durch Zweiphasensprayphi - Produktionstechnik Hannover informiert Vol. 6, Nr. 4, S. 10-11, 2005.
  • Bach, Fr.-W.; Nürnberger, F.; Philipp, K.; Schaper, M. (2005) Statistische Beschreibung der Tropfengrößenverteilung bei stationären Zerstäubungsprozessen.Forschung im Ingenieurwesen Vol. 69, Nr. 3, S. 181-186, 2005.
  • Fargas, M.; Busse, A. v.; Bunte, J.; Meier, O.; Biskup, C.; Louis, H.; Pude, F.; Schenk, A. (2005) Laserepulster Reinwasserstrahl zur Erhöhung der AbragsleistungLasermagazin, Nr. 5, 2005.
  • Fargas, M; von Busse, A.; Bunte, J.; Meier, O.; Biskup, C.; Louis; H.; Pude, F.; Schenk, A. (2005) Lasergepulster Reinwasserstrahl zur Erhöhung der AbtragsleistungLaser Magazin, Ausgabe 5, Okt. 2005, S. 9-12
  • Krause, A.; Hackenbroich, C.; Höh, N. v. d.; Wagner, S.; Bormann, D.; Hassel, T.; Windhagen, H.; Meyer-Lindenberg, A. (2005) Selten Erden-haltige Magnesiumlegierungen als degradable, intramedulläre Implantate in KanninchentibaeBiomaterialien Vol. 6, Nr. 3, S. 190, 2005.
  • Kuhlmann, C.; Pude, F.; Krömer, S.; Kirsch, L.; Andreae, A.; Wacker, K.; Biskup, C.; Schmolke, S. (2005) Evaluation verfahrensspezifischer Risikopotentiale der Wasserabrasivstrahl-Osteotomie in-vivoBiomedizinische Technik, Band 50, Heft 10, Okt. 2005, S. 337-342
    ISBN: ISSN 0013-5585
  • Peuster, M.; Hassel, Th.; Bormann, D.; Wilk, P.; Heinze, T.; Bach, Fr.-W. (2005) Ionen-Leakage aus Implantaten führt zu Materialversagen und Inflammation des peri-Implantat GewebesR. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
  • Peuster, M.; Hassel, Th.; Mueller, P.; Bormann, D.; Hauser, H.; Bach, Fr.-W. (2005) Korrosion kardiovaskulärer Implantate auf WolframbasisR. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
  • Bach, Fr.-W.; Beniyash, A.; Flade, K.; Versemann, R. (2004) Non-Vacuum-Electron-Beam-Welding - A BEAM PROCESS FOR WELDING ZINC COATED HIGH-STRENGTH STEELS AND STEEL-ALUMINIUM HYBRID STRUCTURESLaser Assisted Net Shape Engineering Vol. 4, 2004.
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2004) Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work stepWelding and Cutting, Nr. 2, 2004.
  • Bach, Fr.-W.; Kremer, G.; Versemann, R.; Redeker, C.; Lindemaier, J. (2004) Brechnung des Strömungsfelds beim Kontakt-Lichtbogen-Metallschneiden unter WasserWelding and Cutting Vol. 56, Nr. 11, S. 586-592, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2004) Precision brazing processes for MEMS technologyWelding and Cutting, Nr. 6, S. 340-342, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2004) Particle Image Velocimetry in Thermal SprayingMaterials Science and Engineering A, S. 146-152., 2004.
  • Müller, K.; Lass, J. F.; Böhm, R.; Grydin, O. (2004) Mathematical model for the decision of temperature task at production of types from magnesium alloysMetallurgiceskaja i gornorudnaja promyvlennost', Nr. 5, S. 37-40, 2004.
  • Wielage, B.; Lampke, T.; Lugscheider, E.; Ernst, F.; Janssen, H.; Bach, Fr.-W.; Schäpers, M.; Möhwald, K. (2004) Schutzschichten für Lötmaschinen zum bleifreien LötenSchweißen und Schneiden, Nr. 5, S. 244-248, 2004.
  • Bach, Fr.-W.; Beniyash, A.; Flade, K.; Szelagowski, A.; Versemann, R. (2003) Nonvakuum-Elektronenstrahlschweißen - Ein Hochleistungsverfahren zum Fügen von Magnesium- und AluminiumwerkstoffenMetall 57, 2003.
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2003) Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem ArbeitsschrittSchweißen und Schneiden, Nr. 10, S. 560-565, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T.; Formanek, B. (2003) Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide MatrixThermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Droessler, B.; Prehm, J.; Rothardt, T.; Copitzky, T. (2003) Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, inThermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003) Neue Entwicklungstendenzen zum Löten von AluminiumwerkstoffenJahrbuch Schweißtechnik 2003, S. 138-143, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2003) Präzisionslötverfahren für die MEMS-TechnikSchweißen und Schneiden, Nr. 12, S. 672-674, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003) Hartlöten dünner Bauteile aus Titanlegierungen mit partieller ErwärmungSchweißen und Schneiden, Nr. 8, S. 432-435, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003) Partial-heating brazing of thin components made of titanium alloysWelding and Cutting, Nr. 6, S. 340-342, 2003.
  • Bach, Fr.-W.; Schaper, M.; Jaschick, C. (2003) Influence of lithium on hcp magnesium alloysTrans Tech Publ Materials Science Forum (419-422), S. 1037–1042.
  • Wielage, B.; Lugscheider, E.; Bach, Fr.-W.; Möhwald, K. (2003) Oberflächentechnik für moderne Lötanlagen für bleifreie LoteDer Praktiker, Nr. 4, S. 116ff., 2003.
  • Haferkamp, H.; Bach, Fr.-W.; Bußmann, M.; Kaese, V.; Möhwald, K.; Niemeyer, M.; Schreckenberger, H.; Phan-tan, T. (2002) Magnesiumkorrosion - Prozesse, Schutz von Anode und KathodeMagnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.
  • Louis, H.; Rad, C. v.; Schenk, A. (2002) DECOATING WITH WATER JETS, 2002.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2001) Entwicklung einer neuen Metallgießtechnik für die MikromechanikZeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.
  • Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Weinert, K. (2001) Hartstoffschichten in der Spanenden FertigungSpanende Fertigung, S. 287-298, 2001.
  • Bach, Fr.-W.; Weinert, K.; Möhwald, K.; Nakhosteen, B.; Peters, C.; Schulte, M. (2001) Keramik-HM-Bohrer für kleine DurchmesserWerkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.
  • Bußmann, M.; Möhwald, K. (2000) Beschichtungen aus der Dampfphase, S. 199-222, 2000.
  • Niemeyer, M.; Bormann, D.; Haferkamp, H. (2000) Gießtechnisches Herstellverfahren für MagnesiumschäumeMaterialwissenschaft und Werkstofftechnik Vol. 31, Nr. 6, S. 419-421, 2000.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999) Löten - Verfahren zur Herstellung von VerbundwerkstoffenMetallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999) Gelötete Metall-Keramik-VerbundeMetallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Bußmann, M. (1999) Dünnschichttechnologie - Verfahren zur Herstellung von VerbundwerkstoffenMetallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Reusch, B.; Möhwald, K.; Fathi, M.; Hildebrandt, L. (1999) Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von ModellsystemenMetallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.

Patentschriften

  • Freytag, P.; Maier, H. J.; Rissing, L.; Klaas, D.; Wienecke, A. (2019) Konstruktionsbauteil eines technischen Gegenstands sowie Verfahren zur Herstellung des KonstruktionsbauteilsPatentschrift: DE 102015106002, 06.03.2019
  • Holländer, U.; Wulff, D.; Behrens, B.-A.; Yilkiran, D.; Maier, H.J. (2018) Verfahren zum Oberflächenbeschichten eines BauteilsPatentschrift: DE 10 2016 114 450 B4, 22.03.2018
  • Maier, H. J.; Möhwald, K.; Klose, C.; Holländer, U.; Nürnberger, F.; Hassel, T.; Reimche, W.; Rodman, D. (2018) Verfahren zur Herstellung eines BauteilsPatentschrift: DE 10 2016 121 656 B3, 08.02.2018
  • Engelhardt, M.; Grittner, N.; Klose, C.; Maier H.J. (2017) Verfahren zum Strangpressen, Strangpressvorrichtung sowie StrangpresswerkzeugPatentschrift: DE102015107308, 19.10.2017
  • Klose, C.; Hassel, T.; Nürnberger, F.; Maier, H.J.; (2017) Verfahren zur Herstellung eines Hybridzahnrads sowie HybridzahnradPatentschrift: DE102015102297, 31.08.2017
  • Klose, C; Maier H.J.; Grittner, N.; Engelhardt, M. (2017) Verfahren zur Herstellung eines metallischen Bauteils, metallisches Bauteil und Vorrichtung zur Herstellung eines metallischen BauteilsPatentschrift: DE 10 2014 109 764 B4, 20.07.2017
  • Bauer, M.; Pude, F.; Eiben, F.; Bach, Fr.-W. (2015) Wasserabrasiv-Suspensionsschneideeinrichtung, Verfahren zu dessen Steuerung und ComputerprogrammPatentschrift: DE 10 2014 100 839 B4, 30.07.2015
  • Eifler, R.; Seitz, J.-M.; Bach, F. W. (2014) Verfahren zur Herstellung eines Ziehprofils und Zugvorrichtung zur Herstellung eines Ziehprofils mittels eines ZiehprozessesPatentschrift, DE10 2013 104 281 B4, 25.06.2015
  • Bach, Fr.-W.; Beniyash, A.; Hassel, T.; Konya, R.; Murray, N.; Ruchay, W. (2011) Verfahren und Vorrichtung zum thermischen Bearbeiten von Werkstoffen mit einem Elektronenstrahl und Gas Veröffentlichungs-Nummer EP000002322309A1
  • Bach, Fr.-W.; Hassel, T.; Bierbaum, M.; Krink, V. (2011) Verfahren zur Bestimmung des Abstands zwischen einer autogenen Brennereinrichtung und einem Werkstück durch Erfassung einer Kerngrösse ohne eine eigene elektrische Energieversorgung Veröffentlichungs-Nummer DE102010033947B4
  • Bach, Fr.-W.; Hassel, T.; Pletsch, N.;Nietzold, A.; Kühne, U. (2011) Verfahren zur Reparatur einer GlockeVeröffentlichungs-Nummer: DE102010019120A1
  • Kerber, K.; Bach, Fr.-W.; Schaper, M. (2010) Verfahren zur Herstellung eines Gussteils Patentschrift, DE10 2007 062 436 B4, 11.11.2010
  • Wirth, C.-J.; Windhagen, H.; Witte, F.; Bach, Fr.-W. ; Kaese, V. (2010) Medizinische Implantate, Prothesen, Prothesenteile, medizinische Instrumente, Geräte und Hilfsmittel aus einem Halogenid-modifizierten MagnesiumwerkstoffVeröffentlichungs-Nummer: EP000001458426B1
  • Reimche, W.; Bach, Fr.-W.; Mroz, G. (2009) Bauteil, Verfahren zum Einbringen von Informationen in ein Bauteil und Verfahren zum Ermitteln einer Belastungshistorie eines Bauteils Veröffentlichungs-Nummer: DE102009056584B4
  • Weber, J.; Schaper, M.; Bach, Fr.-W. (2006) Schaumgiessverfahren sowie eine druckdicht verschliessbare Giessform zur Herstellung von Formteilen Veröffentlichungs-Nummer EP000001482062B1

Doktorarbeiten

  • Freytag, P. (2019) Aluminium-Kupfer-Verbundguss – Grenzflächenanalyse und gezielte Modifikation der Verbundzone zur Steigerung der elektrischen und thermischen LeitfähigkeitDissertation, Berichte aus dem IW 03/2019, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-333-9
  • Wolf, L. O. (2019) Wärmebehandlungsstrategien zur gezielten Mikrostruktureinstellung in höchstfesten niedriglegierten Stählen, Dissertation, Berichte aus dem IW 02/2019, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-320-9
  • Wulff, D. (2019) Prozessatmosphären-Werkstoff-Wechselwirkungen bei dem flussmittelfreien Löten von austenitischen Chrom-Nickel-StählenDissertation, Berichte aus dem IW 01/2019, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-245-5
  • Eifler, R. (2018) Einfluss der Rekristallisation auf die Mikrostrukturentwicklung der Magnesiumlegierung ZNdK100Dissertation, Berichte aus dem IW 01/2018, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-182-3
  • Herbst, S. (2018) Inverse Prozessauslegung der prozessintegrierten Wärmebehandlung von Großschmiedebauteilen mittels Luft-Wasser-SpraykühlungDissertation, Berichte aus dem IW 05/2018, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-237-0
  • Jakob, H. (2018) Evaluation thermischer Schneidverfahren zur Zerlegung von Bauteilen aus Zirkonium in unterschiedlichen UmgebungenDissertation, Berichte aus dem IW 03/2018, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-215-8
  • Reichelt, S. (2018) Einfluss chemischer Oberflächennachbehandlungen auf additiv gefertigtes Ti-6Al-4VDissertation, Berichte aus dem IW 04/2018, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-227-1
  • Wulf, E. (2018) Kornfeinung von siliziumhaltigen Aluminiumlegierungen mittels BornitridDissertation, Berichte aus dem IW 02/2018, Garbsen: TEWISS Verlag
    ISBN: 978-3-95900-211-0
  • Bauer, M. (2017) Entwicklung von resorbierbaren Stützstrukturen aus Magnesiumlegierungen für den kardiovaskulären Gewebeersatz im HochdrucksystemDissertation, Berichte aus dem IW 06/2017, Garbsen: PZH Verlag
  • Bruchwald, O. (2017) In-situ-Erfassung der Werkstoffumwandlung und Gefügeausbildung mittels WirbelstromtechnikDissertation, Berichte aus dem IW 02/2017, Garbsen: PZH Verlag
    ISBN: 978-3-95900-134-2
  • Engelhardt, M. (2017) Entstehung, Eigenschaften und Beeinflussung von Pressnähten in stranggepressten Profilen aus Aluminium- und MagnesiumlegierungenDissertation, Berichte aus dem IW 01/2017, Garbsen: PZH Verlag
    ISBN: 978-3-95900-124-3
  • Spachtholz, J. (2017) Rissfortschrittsverhalten und Lebensdauerprognose der beschichteten, einkristallinen Nickelbasis-Superlegierung PWA1484 unter thermo-mechanischer ErmüdungsbeanspruchungDissertation, Berichte aus dem IW 04/2017, Garbsen: PZH Verlag
    ISBN: 978-3-95900-161-8
  • Swider, M.A. (2017) Ternäre Verbunddrahtsysteme als Zusatzwerkstoffe zum flussmittelfreien Lichtbogenlöten von Aluminium- und TitanlegierungenDissertation, Berichte aus dem IW 03/2017, Garbsen: PZH Verlag
    ISBN: 978-3-95900-136-6
  • Zaremba, D. (2017) Reparaturstellenvorbereitung von multidirektionalen CFK-Gelegen durch WasserstrahlenBerichte aus dem IW 05/2017, Garbsen: PZH Verlag
    ISBN: 978-3-95900-162-5
  • Gontarenko, A. (2016) Wear Properties of Hard Carbide-Based Coatings Deposited by High-Velocity Oxygen Fuel SprayingDissertation, Berichte aus dem IW 04/2016, Garbsen: PZH Verlag
    ISBN: 978-3-95900-116-8
  • Hübsch, C. (2016) Verringerung der hydrothermalen Alterung von polykristallinem tetragonalem Zirkoniumdioxid für die dentale Prothetik durch die oberflächennahe Diffusion Dissertation, Berichte aus dem IW 02/2016, Garbsen: PZH Verlag
    ISBN: 978-3-95900-088-8
  • Klöpfer, E. (2016) Entmischungsverhalten von übereutektoiden hochmanganhaltigen Legierungen im Temperaturbereich um 600 °CDissertation, Berichte aus dem IW 03/2016, Garbsen: PZH Verlag
    ISBN: 978-3-95900-091-8
  • Lizunkova, Y. (2016) Lokales atmosphärisches Plasmanitrieren von Stählen zur Verbesserung der OberflächeneigenschaftenDissertation, Berichte aus dem IW 01/2016, Garbsen: PZH Verlag
    ISBN: 978-3-95900-077-2
  • Behrens, S. (2015) Untersuchungen von Korrosionsschutzschichten auf nicht ebenen dickwandigen BauteilenDissertation, Berichte aus dem IW 03/2015, Garbsen: PZH Verlag
    ISBN: 978-3-95900-021-5
  • Bosse, M. (2015) Strangpressen von Magnesiumlegierungen mit prozessintegrierter AbkühlungDissertation, Berichte aus dem IW 01/2015, Garbsen: PZH Verlag
    ISBN: 978-3-95900-018-5
  • Erne, M. (2015) Entwicklung von triboaktiven, reibungsmindernden thermisch gespritzten Schichten für HochtemperaturanwendungenDissertation, Berichte aus dem IW 04/2015, Garbsen: PZH Verlag
    ISBN: 978-3-95900-025-3
  • Konya, R. (2015) Beitrag zur Erweiterung der Einsatzgrenzen beim Nonvakuum-Elektronenstrahlschweißen von Fein- und DickblechenDissertation, Berichte aus dem IW 02/2015, Garbsen: PZH Verlag
    ISBN: 978-3-95900-020-8
  • Kussike, S. M. (2015) Hydrophobierung von Stabelektroden für das „nasse“ Lichtbogenhandschweißen unter WasserDissertation, Berichte aus dem IW 05/2015, Garbsen: PZH Verlag
  • Bierbaum, M. (2014) Beitrag zum fernhantierten Einsatz thermischer Trennverfahren in räumlich eingeschränkter UmgebungDissertation, Berichte aus dem IW 04/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-72-4
  • Dellinger, P. (2014) Untersuchung des neu entwickelten Verfahrens der PVD-SchichttransplantationDissertation, Berichte aus dem IW 05/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-83-0
  • Faßmann, D. (2014) Beitrag zur wechselseitigen Beeinflussung von Mikrostruktur und BlechmassivumformprozessenDissertation, Berichte aus dem IW 01/2014 Garbsen: PZH Verlag
    ISBN: 978-3-944586-48-9
  • Hoyer, K.-P. (2014) Korrosionsuntersuchungen an experimentellen und technisch relevanten MagnesiumlegierungenDissertation, Berichte aus dem IW 07/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-93-9
  • Nowak, M. (2014) Prozessintegrierte Abkühlung mittels Wasser-Luft-Spray-Kühlung beim Strangpressen der Aluminiumlegierungen EN AW-6082 und EN AW-7020Dissertation, Berichte aus dem IW 03/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-60-1
  • Prehm, J. (2014) Modellierung thermisch-physikalischer Vorgänge beim Thermischen SpritzenDissertation, Berichte aus dem IW 06/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-92-2
  • Schaper, M. (2014) Mikrostrukturelle Vorgänge bei der Verformung verschiedener höher- und höchstfester StahlblechwerkstoffeHabilitation, Berichte aus dem IW 02/2014. Garbsen: PZH Verlag
    ISBN: 978-3-944586-57-1
  • Böhm, V. (2013) Beitrag zur Beurteilung von transienten Präzisionsschmiedevorgängen mittels Körperschall- und SchallemissionsdiagnostikDissertation, Berichte aus dem IW, 3/2013. Garbsen: PZH Verlag
  • Hepke, M. (2013) Prozessübergreifende Betrachtung der Herstellung von MagnesiumflachproduktenDissertation, Berichte aus dem IW 2/2013. Garbsen: PZH Verlag
  • Klose, C. (2013) Entwicklung magnetischer Magnesiumlegierungen mit sensorischen EigenschaftenDissertation, Berichte aus dem IW 5/2013. Garbsen: PZH Verlag
    ISBN: 978-3-944586-30-4
  • Kujat, B. (2013) Untersuchung des Einflusses von Impfbehandlungen mit borhaltigen Partikeln auf die Kornfeinung von aluminiumhaltigen MagnesiumlegierungenDissertation, Berichte aus dem IW, 1/2013. Garbsen: PZH Verlag.
  • Mroz, G. (2013) Entwicklung von Techniken zur bauteilinhärenten Informationsspeicherung und Erfassung von BauteilbelastungenDissertation, Berichte aus dem IW 4/2013. Garbsen: PZH Verlag
  • Rodman, D. (2013) Induktives Randschichthärten von Zahnrädern des Vergütungsstahls 42CrMo4 mittels Wasser-Luft-SpraykühlungDissertation, Berichte aus dem IW 09/2013. Garbsen: PZH Verlag
    ISBN: 978-3-944586-43-4
  • Schaup, J. (2013) Entwicklung neuer Nickellote für das Hochtemperaturlöten von Edelstählen im SchutzgasdurchlaufofenDissertation, Berichte aus dem IW, 7/2013. Garbsen: PZH Verlag.
    ISBN: 978-3-944586-35-9
  • Seitz, J.-M. (2013) Entwicklung von Magnesiumlegierungen mit Seltenen Erden für medizintechnische AnwendungenDissertation, Berichte aus dem IW 08/2013. Garbsen: PZH Verlag
    ISBN: 978-3-944586-37-3
  • Yu, Z. (2013) Numerische und experimentelle Untersuchungen zur Vorhersage der integrierten Wärmebehandlung mittels SpraykühlungDissertation, Berichte aus dem IW 6/2013. Garbsen: PZH Verlag
  • Petersen, M. (2012) Beitrag zur Steigerung der Leistungsfähigkeit des Hot-Wire-Plasmaschneidens an Atmosphäre und unter WasserDissertation, Berichte aus dem IW, 2012. Garbsen: PZH Verlag
    ISBN: 978-3-943104-65-3
  • Biskup, C. (2011) Beitrag zur Bearbeitung von biologischem Hartmaterial mittels WasserabrasivstrahltechnikDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, Juni 2011
    ISBN: ISSN 1860-9287
  • Haverkamp, H. (2011) Analyse von Reibung, Temperaturentwicklung und Bindungsmechanismen beim Walzplattieren von Stahl und LeichtmetallenDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2011
  • Kerber, K. (2011) Verfahren zum Verbundguss der Leichtmetalle Aluminim und Magnesium durch den DruckgussDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2011
  • Klotz, J. (2011) Beitrag zur Fixierung von Osteosyntheseplatten an HüftendoprothesenDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2011
  • Plorin, T. (2011) Untersuchung zum lokalen Verstärken von Rollprofilen durch fertigungsintegriertes Ausschäumen mit MagnesiumschaumDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2011
  • Nürnberger, F. (2010) Vorhersage von Mikrostruktur und mechanischen Eigenschaften präzisionsgeschmiedeter Bauteile bei einer integrierten WärmebehandlungDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2010
  • Pfahl, A. (2010) Der Einfluss von Mangan auf die Verschleißbeständigkeit von Schmiedegesenken aus dem Warmarbeitsstahl 1.2365Dissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2010
  • Rafflenbeul, L. (2010) Untersuchung von Magnesiumgussknoten in der GroßserienkarosserieDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2010
  • Jäger, S. (2009) Nonvakuum-Elektronenstrahlschweißen mit gepulstem Strahlstrom und UltraschallanregungDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2009
  • Schenk, A. (2009) Schädigungsdatengestütztes Modell des Reinigens und Entschichtens mit dem ReinwasserstrahlDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2009
  • Hassel, T. (2008) Beitrag zur Entwicklung bioresorbierbarer Implantatmaterialien auf Magnesium-Basis Dissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2008
  • Krause, C. (2008) Randschichtvergüten verzahnter Bauteile mittels einer Wasser-Luft-SpraykühlungDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2008
  • Kremer, G. (2008) Weiterentwicklung von Verfahren zur Kontakt-Lichtbogen-Metall-BearbeitungDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2008
  • Krause, M. (2007) Mechanisches Werkstoffverhalten von Gusseisen mit Vermiculargraphit bei erhöhten TemperaturenDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2007
  • Peter, D. (2007) Untersuchungen zu Einsatzmöglichkeiten von Wasserabrasivstrahlen für RückbaumaßnahmenDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2007
  • Bormann, D. (2006) Herstellung und Charakterisierung von Schäumen und Schwämmen auf MagnesiumbasisDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2006
  • Deißer, T. A. (2006) Werkzeugkonzepte aus aktivgelöteten SI3N4_Metall-VerbundenDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2006
  • Lau, K. (2006) Nonvakuum-Elektronenstrahlfügen von beschichteten Stahfeinblechen und Stahl-Aluminium-MischverbindungenDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, PZH Verlag, 2006
  • Roßberg, A. (2006) Halbzeuge und Walzstrategie zur Herstellung tiefziehfähiger MagnesiumblecheDissertation, Berichte aus dem Institut für Werkstoffkunde, Leibniz Universität Hannover, PZH Verlag, 2006
  • Schaper, M. (2006) Der Einsatz des Magnetformverfahrens zu Vergießen von Magnesium und seinen LegierungenDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, PZH Verlag, 2006
  • Laß, J.-F. (2005) Untersuchungen zur Entwicklung einer magnesiumgerechten StrangpresstechnologieDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, 2005
  • Weber, J. (2005) Walzprozessanalyse und Betrachtung der Blechoberflächenqualität von MagnesiumlegierungenDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, PZH Verlag, 2005
  • Böhm, R. (2004) Entwicklung anwendungsorientierter Magnesiumknetlegierungen und ihre VerarbeitungDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, 2004
  • Schäperkötter, M. (2004) Werkstoffverhalten und Spanbildung bei der Hochgeschwindigkeitszerspanung von C45EDissertation, Berichte aus dem Institut für Werkstoffkunde, Universität Hannover, 2004

Verschiedenes

  • Westphal, R.; Zaremba, D.; Hassel, T.; Suero, E.; Nael, H.; Citak, M.; Krettek, C.; Bach, F.; Wahl; F. (2014) Robot Guided Water Jet Cutting to Assist Osteotomies of Human BonesVideo-Proceedings - IEEE, International Conference on Robotics and Automation, Hong Kong, May/June 2014, Video
  • Meschut, G.; Hahn, O.; Matzke, M.; Olfermann, T.; Reimche, W.; B., Christoph; Mroz, G.; Bach, F.-W.; Maier, H. J.; Drossel, W.-G.; Neugebauer, R.; Ahnert, M.; Broschwitz, E.; Kraus, C. (2013) Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von MischbaustrukturenProceedings to conference 3 Fügetechnisches 2013
  • Saalbach, Kai-Alexander; Freytag, Patrick; Kerber, Kai; Twiefel, Jens (2013) Bond quality investigation of ultrasonic assisted composite casting10th International Workshop on Piezoelectric Weitere Informationen
  • Badar, M.; Rittershaus, D.; Seitz, J.-M.; Bormann, D.; Bach, Fr.-W.; Hauser, H.; Meyer-Lindenberg, A.; Müller, P. P. (2010) In vitro und in vivo Modelle zur molekularen Evaluierung der zellulären Reaktionen auf MagnesiumBiomedizinische Technik / Biomedical Engineering 55, S. 19-21. Berlin: Walter de Gruyter, 2010.
  • Kramer, S.; Götz, F.; Seitz, J.-M.; Bach, Fr.-W.; Lenarz, T.; Schwab, B.; Deutsche Gesellschaft für Hals-Nasen-Ohren-Heilkunde, K.-u. H.-C. e. V. (Hrsg.) (2010) Tribrid-Stenting - eine neue operative Methode zur Erweiterung und Offenhaltung der NasennebenhöhlenHg. v. Kopf-und Hals-Chirurgie e. V. Deutsche Gesellschaft für Hals-Nasen-Ohren-Heilkunde. Wiesbaden, zuletzt aktualisiert am 22.04.2010.
  • Schumacher, S.; Stahl, J.; Seitz, J.-M.; Kietzmann, M. (2010) Primäre porcine Nasenepithelzellen als Modell zur Untersuchung der Biokompatibilität von MagnesiumBiomedizinische Technik / Biomedical Engineering 55, S. 79-81. Berlin: Walter de Gruyter, 2010.
  • Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005) Joining of steel-aluminium hybrid structures with electron beam on atmosphere, 2005.
  • Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005) Non Vacuum Electron Beam Welding of zinc coated high-strength steels, 2005.
  • Bach, Fr.-W.; Biena, H.; Rümenapp, T.; Versemann, R. (2004) Forschungs- und Entwicklungsarbeiten im Bereich der Schneid- und Abragetechnik, 2004.
  • Bach, Fr.-W.; Szelagowski, A.; Versemann, R.; Zelt, M. (2003) Non vacuum electron beam welding of light sheet metals and steel sheets, 2003.

[nicht kategorisiert]

  • Hinte, N.; Biskup, C.; Hassel, T.; Schilling, T.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2011) Stabilizing structures for the aorta replacement - Static and dynamic testingBMT 2011, Freiburg, 27.-30. September 2011
  • Haferkamp, H.; Bach, Fr.-W.; Goede, Martin; Versemann, R.; Bormann, D.; Szelagowski, A.; Zelt, M. (2002) Hochleistungsstrahlverfahren für das Fügen von FeinblechenDrittes Industriekolloquim SFB 362. DFG. Clausthal-Zellerfeld, 06.02.2002.