Journals
-
(2024): Resource-efficient regeneration by generating a digital component image based on different NDT techniques, e-Journal of Nondestructive Testing, 2024
DOI: 10.58286/30035 -
(2024): Investigating mechanical deformation’s role in cochlear implant durability, PLOS ONE, 19, 2024, 0306613
DOI: 10.1371/journal.pone.0306613 -
(2024): Machine learning assisted design of novel refractory high entropy alloys with enhanced mechanical properties, Computational Materials Science, 231, 2024, 112612
DOI: 10.1016/j.commatsci.2023.112612 -
(2024): A process‑reliable tailoring of subsurface properties during cryogenic turning using dynamic process control, Production Engineering, (2024), 18, 233-251
DOI: 10.1007/s11740-023-01244-0 -
(2024): Development of Material Sensors Made of Metastable Austenitic Stainless Steel for Load Monitoring, J. of Materi Eng and Perform, 2024
DOI: 10.1007/s11665-024-09910-9 -
(2024): Qualification of Austenitic Stainless Steels for the Development of Load-Sensitive Material Sensors, J. of Materi Eng and Perform, 2024
DOI: 10.1007/s11665-024-09287-9 -
(2024): An approach to interpreting metastable austenitic material sensors for fatigue analysis, Smart Mater. Struct. 2024, 33, 1-12
DOI: 10.1088/1361-665X/ad4f38 -
(2024): Operational performance and metal droplet formation in pulsed-shielded metal arc underwater welding, Arch. Civ. Mech. Eng, 24, 94, 2024
DOI: 10.1007/s43452-024-00916-7 -
(2024): Machine Learning – informed Development of High Entropy Alloys with Enhanced Corrosion Resistance, Electrochim. Acta, 2024, 476, 143722
DOI: 10.1016/j.electacta.2023.14372 -
(2024): Novel Alloying Strategy to Improve Brazing Properties on Nickel Based Superalloys for Aircrafts, In: Volume 9: Manufacturing Materials and Metallurgy; Microturbines, Turbochargers, and Small Turbomachines; Oil & Gas Applications; Steam Turbine. London, United Kingdom. 24.06.2024 - 28.06.2024. American Society of Mechanical Engineers, 2024
DOI: 10.1115/GT2024-121186 -
(2024): Influence of High Current Impulses on Element Distribution in Creep-Deformed Single-Crystal Ni-Based Superalloys, J. Mater. Eng. Perform., 2024
DOI: 10.1007/s11665-024-10054-z -
(2024): Co-extrusion of Nb–1Zr Powder for the Production of a Biocompatible High-Strength Material for Dental Implants, Adv. Eng. Mater., 2024, 2401436
DOI: 10.1002/adem.202401436 -
(2024): Corrosion behavior of austenitic stainless steel and nickel-based welded joints in underwater wet welding, npj Mater. Degrad., 8, 51, 2024
DOI: 10.1038/s41529-024-00471-9 -
(2024): Abnormal Grain Growth and Pseudoelasticity of Industrially Processed Fe–Mn–Al–Ni Shape Memory Alloy Joined by Metal Inert Gas Welding, Metall. Mater. Trans. A, 2024
DOI: 10.1007/s11661-024-07304-z -
(2024): High temperature and high strain rate properties of brazed honeycomb liner material Haynes 214, WEAR, 2024, 205427
DOI: https://doi.org/10.1016/j.wear.2024.205427 -
(2024): Corrosion fatigue behavior of nanoparticle modified iron processed by electron powder bed fusion, npj Mater Degrad 8, 2024 (1)
DOI: 10.1038/s41529-024-00470-w -
(2024): Detection of diffusible hydrogen during laser beam welding under water, Procedia CIRP, 124, 2024, 544-548
DOI: 10.1016/j.procir.2024.08.171 -
(2024): Assessment of hydrogen-induced material degradation using electromagnetic testing technology, e-Journal of Nondestructive Testing, 2024
DOI: 10.58286/30036 -
(2023): A novel way to reduce the critical deformation for cold roll bonding, Manufacturing Letters 36, 2023, 9-12
DOI: 10.1016/j.mfglet.2022.12.006 -
(2023): Werkstoffschädigung durch Hochtemperaturkorrosion zuverlässig zerstörungsfrei erfassen und charakterisieren, ZfP-Zeitung, 187, 2023
-
(2023): Reliable non-destructive detection and characterization of material degradation caused by high-temperature corrosion, ReJNDT 1, 2023 (1)
DOI: 10.58286/28070 -
(2023): Structural and superelastic properties of Fe-Mn-Al-Ni shape memory alloy sheets produced on industrial process routes by hot rolling, Journal of Materials Research and Technology, 2023
DOI: 10.1016/j.jmrt.2023.04.260 -
(2023): Partial resistance tempering of hot-stamped components made of 22MnB5 for subsequent bending, IOP Conf. Ser.: Mater. Sci. Eng. 1284, 2023 (1), 12039
DOI: 10.1088/1757-899X/1284/1/012039 -
(2023): Influence of the grain orientation and δ-ferrite on the cyclic deformation behavior of an austenitic CrNi steel manufactured by wire and arc additive manufacturing, Materials Science and Engineering: A 44, 2023, 144612
DOI: 10.1016/j.msea.2023.144612 -
(2023): Electrografting of BTSE, Journal of Advanced Joining Processes 7, 2023 (2), 100137
DOI: doi.org/10.1016/j.jajp.2022.100137 -
(2023): Combined influence of cooling strategies and depth of cut on the deformation-induced martensitic transformation turning AISI 304, Journal of Materials Processing Technology 312, 2023 (1), 117861
DOI: 10.1016/j.jmatprotec.2023.117861 -
(2023): Patterning of Surfaces for Subsequent Roll Bonding in a Low-Oxygen Environment Using Deformable Mesh Inlays, JMMP 7, 2023 (5), 158
DOI: 10.3390/jmmp7050158 -
(2023): An X-ray Microscopy Study of the Microstructural Effects on Thermal Conductivity in Cast Aluminum-Copper Compounds, Metals 13, 2023 (4), 671
DOI: 10.3390/met13040671 -
(2023): Identification of overloads on splined shafts by means of eddy current testing technology, Proceedings of the 13th European Conference on Non-Destructive Testing, 2023, 1-6
DOI: 10.58286/28069 -
(2023): Detection and Characterization of Fatigue Cracks in Butt Welds of Offshore Structures Using the Eddy Current Method, Diagnostics and Prognostics of Engineering Systems 6, 2023 (2), 56
DOI: 10.1115/1.4056313 -
(2023): Entwicklung hybrider, magnetischer Werkstoffsysteme durch Implementierung ferromagnetischer Materialien in eine Al-Matrix, Tagungsband 5. Symposium Materialtechnik. Clausthal-Zellerfeld, 2023
DOI: 10.21268/20231006-0 -
(2023): Fracture Resistance of Repaired 5Y-PSZ Zirconia Crowns after Endodontic Access, Dentistry Journal 11, 2023 (3), 76
DOI: 10.3390/dj11030076 -
(2023): Induction Melting a cold crucible Furnace applied to innovative high-melting Temperature Metals, Magnetohydrodynamics 58, 2023 (4), 523-532
DOI: 10.22364/mhd.58.4.17 -
(2023): Lastsensitive Zahnwelle mit sensorischem Werkstoff als sensorintegriertes Maschinenelement, DFG SPP 2305, 2023, 101-106
DOI: 10.21268/20230425-9 -
(2023): Electroplasticity Mechanisms in hcp Materials, Adv. Eng. Mater., 2023
DOI: https://doi.org/10.1002/adem.202201912 -
(2023): Development and evaluation of a closed-loop z-axis control strategy for wire-and-arc-additive manufacturing using the process signal, Int J Adv Manuf Technol, 2023
DOI: 10.1007/s00170-023-12012-w -
(2023): Plasma Welding of Aluminum in an Oxygen-Free Argon Atmosphere, Advances In Materials Science 23, 2023 (1), 5-18
DOI: 10.2478/adms-2023-0001 -
(2023): Untersuchung und Optimierung der Prozessparameter und Werkzeuge zum Unterwasserkleben von Halterungssystemen, DVS Media – Schweissen und Schneiden, 2023 (3), 144-151
-
(2023): Investigation and optimization of process parameters and tools for underwater bonding of brackets, Welding and Cutting, 2023 (2), 50-55
DOI: https://doi.org/10.53192/WAC20230250 -
(2023): Increasing thermal conductivity in aluminium-copper compound castings: modelling and experiments, Materials Science and Technology 22, 2023, 1-11
DOI: 10.1080/02670836.2023.2184591 -
(2023): Determination of thermal conductivity of eutectic Al–Cu compounds utilizing experiments, molecular dynamics simulations and machine learning, Modelling Simul. Mater. Sci. Eng. 31, 2023 (4), 45001
DOI: 10.1088/1361-651X/acc960 -
(2023): Understanding the enhanced corrosion performance of two novel Ti-based biomedical high entropy alloys, Journal of Alloys and Compounds 956, 2023, 170343
DOI: 10.1016/j.jallcom.2023.170343 -
(2023): Energy Harvesting in rotierenden Maschinenelementen, Mitteilungen aus dem Institut für Maschinenwesen der Technischen Universität Clausthal, 2023, 48, 89-94
-
(2023): Material-based model for the simulation of underwater welding, Welding and Cutting 23, 2023 (1), 24-29
DOI: 10.53192/WAC20230124 -
(2023): Accelerated coarsening behavior of the γ´-phase in CMSX-4 during non-isothermal heat treatment, Materials Today Communications 36, 2023, 106703
DOI: 10.1016/j.mtcomm.2023.106703 -
(2023): Implications of ageing effects on thermal and mechanical properties of PMMA-based bone cement for THA revision surgery, Journal of the Mechanical Behavior of Biomedical Materials, 148, 2023, 106218
DOI: 10.1016/j.jmbbm.2023.106218 -
(2023): Thermal spraying in oxygen-free environment: Meltoff and atomisation behaviour of twin-wire arc spraying processes in silane-doped inert gases, Thermal Spray Bulletin, 16, 1, 2023, 24-30
DOI: 10.53192/TSB20230124 -
(2023): Development of EN AW-6082 Metal Foams and Stochastic Foam Modeling for the Individualization of Extruded Profiles, Journal of Materials Engineering and Performance, 2023
DOI: 10.1007/s11665-023-09031-9 -
(2023): Investigations on fatigue strength of wet welded structural steels, Welding and Cutting, 2023, (2), 44-49
DOI: 10.53192/WAC20230244 -
(2023): A Composite of Polyether Ether Ketone and Silica‐Coated Copper Particles for Creating Tailored Conductive Tracks via Laser Printing, Macro Materials & Eng, 2023
DOI: 10.1002/mame.202300264 -
(2023): Implementation of Pulsed - Shielded Metal Arc Underwater Welding (P-SMAUW), DVS Berichte 2023, 81-92
-
(2023): Correlating Ultrasonic Velocity in DC04 with Microstructure for Quantification of Ductile Damage, JMMP 7, 2023 (4), 142
DOI: 10.3390/jmmp7040142 -
(2023): Oxygen‐Free Production—From Vision to Application, Adv. Eng. Mater., 2023, 2201819
DOI: 10.1002/adem.202201819 -
(2023): Untersuchungen zur Ermüdungsfestigkeit von nass geschweißten Offshore-Stählen, Schweißen und Schneiden 75, 2023 (8), 548-553
-
(2023): Aspects of a Sustainability Focused Comparison of the Wire Arc Additive Manufacturing (WAAM) and the Laser Powder Bed Fusion (LPBF) Process, In: Scholz, S.G., Howlett, R.J., Setchi, R. (eds) Sustainable Design and Manufacturing. SDM 2022. Smart Innovation, Systems and Technologies, vol 338. Springer, Singapore, 2023
DOI: 10.1007/978-981-19-9205-6_9 -
(2022): In-Situ Characterization of Microstructural Changes in Alloy 718 during High-Temperature Low-Cycle Fatigue, Metals 12, 2022 (11), 1871
DOI: 10.3390/met12111871 -
(2022): Challenges in communicating the future of high-level radioactive waste disposal, TATuP 31, 2022 (3), 18-23
DOI: 10.14512/tatup.31.3.18 -
(2022): Pressure-compacted and spider silk-reinforced fibrin demonstrates sufficient biomechanical stability as cardiac patch in vitro, Journal of biomaterials applications 36, 2022 (6), 1126-1136
DOI: 10.1177/08853282211046800 -
(2022): CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior, Journal of Vacuum Science & Technology A 40, 2022 (1), 13414
DOI: 10.1116/6.0001462 -
(2022): Induction Heating in Underwater Wet Welding—Thermal Input, Microstructure and Diffusible Hydrogen Content, Materials (Basel, Switzerland) 15, 2022 (4), 1417
DOI: 10.3390/ma15041417 -
(2022): Investigation of the influence of the forming process and finishing processes on the properties of the surface and subsurface of hybrid components, Int J Adv Manuf Technol 119, 2022 1-2, 119-136
DOI: 10.1007/s00170-021-08066-3 -
(2022): Material dependent surface and subsurface properties of hybrid components, Prod. Eng. Res. Devel. 16, 2022 (5), 647-659
DOI: 10.1007/s11740-022-01128-9 -
(2022): Investigations on Additively Manufactured Stainless Bearings, Investigations on Additively Manufactured Stainless Bearings. Coatings 12, 2022 (11), 1699
DOI: 10.3390/coatings12111699 -
(2022): Influence of the atmosphere and temperature on the properties of the oxygen-affine bonding system titanium-diamond during sintering, Int J Adv Manuf Technol 120, 2022 11-12, 7187-7196
DOI: 10.1007/s00170-022-09171-7 -
(2022): Setting of deformation-induced martensite content in cryogenic external longitudinal turning, Procedia CIRP 108, 2022 (5), 170-175
DOI: 10.1016/j.procir.2022.03.030 -
(2022): Funktionsorientierte Stellgrößenauslegung beim Drehen, wt Werkstattstechnik online 11, 2022, 767-772
DOI: 10.37544/1436–4980–2022–11–12–41 -
(2022): High Strain Rate and Stress-State-Dependent Martensite Transformation in AISI 304 at Low Temperatures, Metals 12, 2022 (5), 747
DOI: 10.3390/met12050747 -
(2022): Characterization of deformation-induced martensite by cryogenic turning using eddy current testing, Procedia CIRP 108, 2022 (0), 49-54
DOI: 10.1016/j.procir.2022.03.014 -
(2022): Non-destructive, Contactless and Real-Time Capable Determination of the α’-Martensite Content in Modified Subsurfaces of AISI 304, J Nondestruct Eval 41, 2022 (4), 123
DOI: 10.1007/s10921-022-00905-x -
(2022): Non-destructive Evaluation of Workpiece Properties along the Hybrid Bearing Bushing Process Chain, J. of Materi Eng and Perform 11, 2022 (2), 5725
DOI: 10.1007/s11665-022-07598-3 -
(2022): Oxygen-Free Compound Casting of Aluminum and Copper in a Silane-Doped Inert Gas Atmosphere, Inter Metalcast 20, 2022 (1), 1701027
DOI: 10.1007/s40962-022-00910-w -
(2022): Oxidfreier Verbundguss - Optimale Wärmeleitung zwischen artfremden Verbundpartnern, Giesserei Special 109, 2022, 32-40
-
(2022): From corrosion behavior to radiation response, Intermetallics 149, 2022, 107680
DOI: 10.1016/j.intermet.2022.107680 -
(2022): Investigation of the mechanical properties and corrosion behaviour of hybrid L 80 Type 1 and duplex steel joints produced by magnetically impelled arc butt welding, Journal of Advanced Joining Processes 5, 2022 (9), 100109
DOI: 10.1016/j.jajp.2022.100109 -
(2022): Lastsensitive Zahnwelle mit sensorischem Werkstoff, VDI-Bericht 2408 – 9. VDI-Fachtagung Welle-Nabe-Verbindungen 2022, 2022, 253-257
-
(2022): Detection of the contact tube to working distance in wire and arc additive manufacturing, Int J Adv Manuf Technol 120, 2022, 989-999
DOI: 10.1007/s00170-022-08805-0 -
(2022): Influence of hydrogel coatings on corrosion and fatigue of iron in simulated body fluid, Materials & Corrosion, 2022, 599
DOI: 10.1002/maco.202112841 -
(2022): Investigations into Flux-Free Plasma Brazing of Aluminum in a Local XHV-Atmosphere, Materials (Basel, Switzerland) 15, 2022 (23), 8292
DOI: 10.3390/ma15238292 -
(2022): Functionality Investigations of Dry-Lubricated Molybdenum Trioxide Cylindrical Roller Thrust Bearings, Coatings, 2022, 12, 591
DOI: 10.3390/coatings12050591 -
(2022): Herstellung und Untersuchung von Doppelmantel- Fülldrähten für das kontinuierliche nasse Unterwasserschweißen, Schweißen und Schneiden 74 7-8, 438-445
-
(2022): Manufacture and investigation of two chamber flux-cored wires for continuous wet underwater welding, Welding and Cutting, 2022 (4), 296-302
DOI: 10.53192/WAC202204296 -
(2022): An Experimental and Numerical Study of Damage Due to Particle Impact on Sapphire Orifices Used in High-Pressure Water Jet Cutting, Machines 10, 2022 (9), 756
DOI: 10.3390/machines10090756 -
(2022): A sharp-interface model for diffusional evolution of precipitates in visco-plastic materials, Computer Methods in Applied Mechanics and Engineering 391, 2022, 114440
DOI: 10.1016/j.cma.2021.114440 -
(2022): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin 14 (2), 120-127
-
(2022): Young’s Modulus and Residual Stresses of Oxide-Free Wire Arc Sprayed Copper Coatings, Coatings, 12, 10, 2022, 1482
DOI: 10.3390/coatings12101482 -
(2022): Oxide Free Wire Arc Sprayed Coatings—An Avenue to Enhanced Adhesive Tensile Strength, Metals 12, 2022 (4), 684
DOI: 10.3390/met12040684 -
(2022): Electron beam welding and brazing in atmosphere with reduced accelerating voltage on aluminium alloys susceptible to hot cracking, Welding and Cutting, 2022 (4), 272-281
DOI: https://doi.org/10.53192/WAC202204272 -
(2022): Creation of a Knowledge Space by Semantically Linking Data Repository and Knowledge Management System - a Use Case from Production Engineering, IFAC-PapersOnLine 55, 2022 (10), 2030-2035
-
(2022): Creep of Directionally Solidified Eutectics Ni/Ni3 Al–NbC under Thermal Cycling, Inorganic Materials: Applied Research 13, 2022 (4), 1099-1108
DOI: 10.1134/S2075113322040347 -
(2022): Characterization of the Interface between Aluminum and Iron in Co-Extruded Semi-Finished Products, Materials (Basel, Switzerland) 15, 2022 (5), 1692
DOI: 10.3390/ma15051692 -
(2022): Microstructural Investigation of a FeMnAlNi Shape Memory Alloy Processed by Tungsten Inert Gas Wire and Arc Additive Manufacturing, Metals 12, 2022 (10), 1731
DOI: 10.3390/met12101731 -
(2022): Corrosion fatigue behavior of electron beam melted iron in simulated body fluid, npj Mater Degrad 6, 2022 (1), 1917
DOI: 10.1038/s41529-022-00226-4 -
(2022): Cu-Ni-Based Alloys from Nanopowders as Potent Thermoelectric Materials for High-Power Output Applications, Alloys 1, 2022 (1), 3-14
DOI: 10.3390/alloys1010002 -
(2021): The effect of nitrogen alloying on hydrogen-assisted plastic deformation and fracture in FeMnNiCoCr high-entropy alloys, Scripta Materialia 194, 2021, 113642
DOI: 10.1016/j.scriptamat.2020.113642 -
(2021): Influence of Pre-strain on Very-Low-Cycle Stress–Strain Response and Springback Behavior, J. of Materi Eng and Perform 5, 2021 (3), 4353
DOI: 10.1007/s11665-020-05399-0 -
(2021): Microstructural degradation in the subsurface layer of the nickel base alloy 718 upon high-temperature oxidation, Materials at High Temperatures 33, 2021 (4), 1-11
DOI: 10.1080/09603409.2021.1895541 -
(2021): Increasing the energy absorption of monolithic manganese boron steels in oxygen-free environment, IOP Conference Series: Materials Science and Engineering 1157, 2021, 12021
-
(2021): Challenges in the Forging of Steel-Aluminum Bearing Bushings, Materials 14, 2021 (4), 803
DOI: 10.3390/ma14040803 -
(2021): Contact Geometry Modification of Friction-Welded Semi-Finished Products to Improve the Bonding of Hybrid Components, Metals 11, 2021 (1), 115
DOI: 10.3390/met11010115 -
(2021): Influence of residual stresses in hard tool coatings on the cutting performance, Journal of Manufacturing Processes 69, 2021, 340-350
DOI: 10.1016/j.jmapro.2021.08.011 -
(2021): In Situ X‐Ray Diffraction Analysis of Microstructure Evolution during Deep Cryogenic Treatment and Tempering of Tool Steels, Steel research int 409, 2021, 2100076
DOI: 10.1002/srin.202100076 -
(2021): Changes in Mechanical and Microstructural Properties of Magnesium Alloys Resulting from Superimposed High Current Density Pulses, Materials Science Forum (THERMEC 2021) 1016, 2021, 385-391
ISSN: 1662-9752 -
(2021): Effects on the deformation-induced martensitic transformation in AISI 304 in external longitudinal turning, Advances in Industrial and Manufacturing Engineering 2, 2021 (1), 100044
DOI: 10.1016/j.aime.2021.100044 -
(2021): Control of Heat Treatment of Case-Hardening Steel 18CrNiMo7-6 by Determining the Penetration Depth of Eddy Currents, Met Sci Heat Treat 321, 2021 (23), 3878
DOI: 10.1007/s11041-021-00627-3 -
(2021): Deformation-induced martensitic transformation in AISI304 by cryogenic machining, Materials Letters, 2021, 129090
DOI: 10.1016/j.matlet.2020.129090 -
(2021): Characterization of Graded Subsurface Zones in Industrial Case-Hardening Using a Non-Destructive Testing System, HTM 76, 2021 (3), 237-245
DOI: 10.1515/htm-2021-0006 -
(2021): Hot forming of shape memory alloys in steel shells, Prod. Eng. Res. Devel. 481–482, 2021 (3), 266
DOI: 10.1007/s11740-021-01024-8 -
(2021): Investigating the Influence of Process Parameters on the Mechanical Properties of Extruded Aluminum Tubes by Cyclic Indentation Tests, Metals 11, 2021 (5), 744
DOI: 10.3390/met11050744 -
(2021): Fracture behavior of novel biomedical Ti-based high entropy alloys under impact loading, Materials Science and Engineering: A 803, 2021, 140456
DOI: 10.1016/j.msea.2020.140456 -
(2021): Functional Analysis of Components Manufactured by a Sheet-Bulk Metal Forming Process, JMMP 5, 2021 (2), 49
DOI: 10.3390/jmmp5020049 -
(2021): Fringe Projection Profilometry in Production Metrology, Sensors 21, 2021 (7), 2389
DOI: 10.3390/s21072389 -
(2021): Entwicklung von Kupfer-Aluminium-Verbundloten zur In-situ-Bildung von CuAl-Lotlegierungen beim Ofenlöten von CrNi-Stählen, Schweißen und Schneiden 73, 2021 (5), 284-293
-
(2021): Cold Roll Bonding of Tin-Coated Steel Sheets with Subsequent Heat Treatment, Metals 11, 2021 (6), 917
DOI: 10.3390/met11060917 -
(2021): Heat Transfers Coefficients of Directly and Indirectly Cooled Component Areas during Air-Water Spray Cooling, HTM 76, 2021 (1), 64-75
DOI: 10.1515/htm-2020-0005 -
(2021): Processing, Structure, and Properties of Additively Manufactured Titanium Scaffolds with Gyroid-Sheet Architecture, Additive Manufacturing 19, 2021 (12), 101916
DOI: 10.1016/j.addma.2021.101916 -
(2021): Induction heating as practical preheating and post weld heat treatment to improve the quality in underwater wet welding of fine grain structural steels with high carbon equivalents, Welding and Cutting 20, 2021 (3), 228-234
-
(2021): Induktionswärmetechnik als praxisrelevantes Vor- und Nachbehandlungsverfahren zur Verbesserung der Schweißnahtqualität beim Unterwasserschweißen von Feinkornstählen mit erhöhtem Kohlenstoffäquivalent, Schweißen und Schneiden 73, 2021 (10), 718-725
-
(2021): Nitrierbehandlung eines zyklisch selbsthärtenden Warmarbeitsstahls, massivUMFORMUNG, 2021 (1), 68-73
-
(2021): Combination of optical metrology and non-destructive testing technology for the regeneration of aero engine components, tm - Technisches Messen 0, 2021 (0)
DOI: 10.1515/teme-2020-0093 -
(2021): Hydrogen-assisted Crack Propagation in Pre-strained Twinning-induced Plasticity Steel: From Initiation at a Small Defect to Failure, ISIJ Int. 61, 2021 (4), 1278-1286
DOI: 10.2355/isijinternational.ISIJINT-2019-510 -
(2021): Effect of off-stoichiometric compositions on microstructures and phase transformation behavior in Ni-Cu-Pd-Ti-Zr-Hf high entropy shape memory alloys, Journal of Alloys and Compounds 857, 2021, 157467
DOI: 10.1016/j.jallcom.2020.157467 -
(2021): Einfluss von Silan-dotierten Umgebungsatmosphären auf tribologischen Eigenschaften von Titan, T+S (Tribologie und Schmierungstechnik) 68, 2021 (1), 5-13
DOI: 10.24053/TuS-2021-0002 -
(2021): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin, 14, 2, 2021, 120-127
ISSN: 1866–6248 -
(2021): Development of an Aluminum-Based Hybrid Billet Material for the Process-Integrated Foaming of Hollow Co-Extrusions, Metals 11, 2021 (9), 1382
DOI: 10.3390/met11091382 -
(2021): Crack initiation of an industrial 7XXX aluminum alloy in humid air analyzed via slow strain rate testing and constant displacement testing, Materials Science and Engineering: A 804, 2021 (10), 140776
DOI: 10.1016/j.msea.2021.140776 -
(2021): Elektronenstrahlschweißen und -löten an Atmosphäre mit reduzierter Beschleunigungsspannung an heißrissanfälligen Aluminiumlegierungen, Schweissen und Schneiden 73, 2021 (8), 516-526
-
(2021): Process chain for the manufacture of hybrid bearing bushings, Prod. Eng. Res. Devel. (Production Engineering)
DOI: 10.1007/s11740-021-01028-4 -
(2021): On the Microstructural and Cyclic Mechanical Properties of Pure Iron Processed by Electron Beam Melting, Adv. Eng. Mater. 327, 2021, 2100018
DOI: 10.1002/adem.202100018 -
(2020): Improving the accuracy of FE simulations of induction tempering towards a microstructure-dependent electromagnetic model, IEEE Trans. Magn. 56, 2020 (10), 1-9
DOI: 10.1109/TMAG.2020.3013562 -
(2020): Ion Beam Processing for Sample Preparation of Hybrid Materials with Strongly Differing Mechanical Properties, Metallogr. Microstruct. Anal. 9, 2020 (1), 54-60
DOI: 10.1007/s13632-019-00605-5 -
(2020): Microstructural Evolution and Mechanical Properties of Hybrid Bevel Gears Manufactured by Tailored Forming, Metals 10, 2020 (10), 1365
DOI: 10.3390/met10101365 -
(2020): New Multistage Sheet-Bulk Metal Forming Process Using Oscillating Tools, Metals 10, 2020 (5), 617
DOI: 10.3390/met10050617 -
(2020): Characterization and Modeling of Intermetallic Phase Formation during the Joining of Aluminum and Steel in Analogy to Co-Extrusion, Metals 10, 2020 (12), 1582
DOI: 10.3390/met10121582 -
(2020): Influence of degree of deformation on welding pore reduction in high-carbon steels, Influence of degree of deformation on welding pore reduction in high-carbon steels. Prod. Eng. Res. Devel. 15, 2021 (2), 161-168
DOI: 10.1007/s11740-020-01009-z -
(2020): Numerical investigations regarding a novel process chain for the production of a hybrid bearing bushing, Prod. Eng. Res. Devel. 14, 2020 5-6, 569-581
DOI: 10.1007/s11740-020-00992-7 -
(2020): Investigation of the temporal rearrangement of zirconium hydride precipitates in cladding material for the interim and final storage period, Kerntechnik 85, 2020 (6), 433-439
DOI: 10.3139/124.200070 -
(2020): Investigations on Tailored Forming of AISI 52100 as Rolling Bearing Raceway, Metals 10, 2020 (10), 1363
DOI: 10.3390/met10101363 -
(2020): Simulation assisted process chain design for the manufacturing of bulk hybrid shafts with tailored properties, Int J Adv Manuf Technol 108, 2020 7-8, 2409-2417
DOI: 10.1007/s00170-020-05532-2 -
(2020): Influence of nitrogen in process atmospheres on the corrosion and the fatigue behavior of brazed stainless steel joints, Welding and Cutting 19, 2020 (4), 312-317
-
(2020): Eddy Current Detection of the Martensitic Transformation in AISI304 Induced upon Cryogenic Cutting, Steel Research Int. 2, 2020, 2000299
DOI: 10.1002/srin.202000299 -
(2020): Prozessbegleitende Erfassung der Gefügeumwandlung im Randbereich bainitischer Schmiedeteile bei der Abkühlung im Warmbad, massivUMFORMUNG, 2020 (2), 58-63
-
(2020): Investigation of degraded bone substitutes made of magnesium alloy using scanning electron microscope and nanoindentation, Journal of the Mechanical Behavior of Biomedical Materials 109, 2020, 103825
DOI: 10.1016/j.jmbbm.2020.103825 -
(2020): A simulation model for the degradation of magnesium-based bone implants, Journal of the Mechanical Behavior of Biomedical Materials 101, 2020, 103411
DOI: 10.1016/j.jmbbm.2019.103411 -
(2020): Plasma nitriding Ti-6Al-4V with the aid non-transmitted plasma-arc using different protection atmosphere, Materials Today: Proceedings, Volume 30, Part 3, 2020, Pages 694-699, ISSN 2214-7853,
DOI: https://doi.org/10.1016/j.matpr.2020.01.524 -
(2020): Properties and anisotropy behaviour of a nickel base alloy material produced by robot-based wire and arc additive manufacturing, Weld World 64, 1921–1931, 2020
DOI: https://doi.org/10.1007/s40194-020-00971-7 -
(2020): Pattern-forming nanoprecipitates in NiTi-related high entropy shape memory alloys, Scripta Materialia 186, 2020, 132-135
DOI: 10.1016/j.scriptamat.2020.05.007 -
(2020): The Effect of Increasing Chemical Complexity on the Mechanical and Functional Behavior of NiTi-Related Shape Memory Alloys, Shap. Mem. Superelasticity 122, 2020, 106792
DOI: 10.1007/s40830-020-00284-0 -
(2020): Influence of stick electrode coating’s moisture content on the diffusible hydrogen in underwater wet shielded metal arc welding, Advances In Materials Science 20, 2020 4 (66), 27-37
DOI: 10.2478/adms-2020-0020 -
(2020): Reducing the risk of hydrogen-induced cold cracks in hyperbaric wet welding of high strength steels by using austenitic welding consumables, Welding and Cutting, 2020 (1), 54-60
-
(2020): Effect of the water depth on the hydrogen content in SMAW wet welded joints, Springer Nature Applied Sciences 2, 2020 (7), 25
DOI: 10.1007/s42452-020-3066-8 -
(2020): Control of the diffusible hydrogen content in different steel phases through the targeted use of different welding consumables in underwater wet welding, Materials and Corrosion 8, 2020 (3), 11
DOI: 10.1002/maco.202011963 -
(2020): The Applicability of the Standard DIN EN ISO 3690 for the Analysis of Diffusible Hydrogen Content in Underwater Wet Welding, Materials 13, 2020 (17), 3750
DOI: 10.3390/ma13173750 -
(2020): Order and Temperatures of Magnetic Transitions in a Ni₅₁.₉Mn₂₇.₀Ga₂₁.₁ Alloy, IEEE Trans. Magn. 56, 2020 (7), 1-5
DOI: 10.1109/TMAG.2020.2991317 -
(2020): Influence of incorporated nanoparticles on superelastic behavior of shape memory alloys, Materials Science and Engineering: A 776, 2020, 139025
DOI: 10.1016/j.msea.2020.139025 -
(2020): Towards Dry Machining of Titanium-Based Alloys: A New Approach Using an Oxygen-Free Environment, Metals 10, 2020 (9), 1161
DOI: 10.3390/met10091161 -
(2020): Magnesium Alloys for Open-Pored Bioresorbable Implants, JOM 72, 2020 (5), 1859-1869
DOI: 10.1007/s11837-020-04078-8 -
(2020): Application of a titanium filler metal by cold gas dynamic spraying, Thermal Spray Bulletin 13, 2020 (2), 108-113
-
(2020): Fracture Behavior of Ultrafine-Grained Titanium Under Tension at Elevated Temperatures, Journal of Engineering Materials and Technology 142, 2020 (4), 041009
DOI: 10.1115/1.4047747 -
(2020): A multiscale study of hot-extruded CoNiGa ferromagnetic shape-memory alloys, Materials & Design 196, 2020, 109118
DOI: 10.1016/j.matdes.2020.109118 -
(2020): Numerical Simulation of the Abrasive Wear Behavior of Selectively Oxidized α-Fe2O3 Oxide Layers on Tool Steel Surfaces, JOM 72, 2020 (7), 2536-2547
DOI: 10.1007/s11837-020-04172-x -
(2020): Characterization of Molybdenum Based Coatings on 100Cr6 Bearing Steel Surfaces, Tribology Online 15, 2020 (3), 181-185
DOI: 10.2474/trol.15.181 -
(2020): Effects of Cryogenic Treatment on the Microstructure and Mechanical Properties of High-alloyed Tool Steels, HTM 75, 2020 (5), 287-307
DOI: 10.3139/105.110422 -
(2020): Lateral Angular Co-Extrusion: Geometrical and Mechanical Properties of Compound Profiles, Metals 10, 2020, 1162
DOI: 10.3390/met10091162 -
(2020): The effects of severe plastic deformation on the mechanical and corrosion characteristics of a bioresorbable Mg-ZKQX6000 alloy, Materials Science and Engineering: C 115, 2020, 111130
DOI: 10.1016/j.msec.2020.111130 -
(2020): Strain path dependency in incremental sheet-bulk metal forming, Int J Mater Form 90, 2020 (7), 3585
DOI: 10.1007/s12289-020-01537-0 -
(2019): Preparation Methods for Scanning Electron Microscope Characterization of Nano-Carbides in Cold Work Steel X153CrMoV12, Pract. Metallogr. 56, 2019 (5), 303-316
DOI: 10.3139/147.110555 -
(2019): Influence of Alternating Short-Cycle Bending on the Mechanical Properties of Copper, α-Titanium and the Mild Steel DC01, J. of Materi Eng and Perform 28, 2019 (11), 7165-7170
DOI: 10.1007/s11665-019-04458-5 -
(2019): Simulation-Aided Process Chain Design for the Manufacturing of Hybrid Shafts, HTM 74, 2019 (2), 115-135
DOI: 10.3139/105.110378 -
(2019): Manufacturing and Evaluation of Multi-Material Axial-Bearing Washers by Tailored Forming, Metals 9, 2019 (2), 232
DOI: 10.3390/met9020232 -
(2019): Optimierung des Tragverhaltens unter Wasser gefügter Bolzenschweißverbindungen großer Dimensionen für Reparatur- und Instandhaltungsmaßnahmen, Schweißen und Schneiden 71, 2019 (5), 278-284
-
(2019): Hubzündungsbolzenschweißen großer Dimensionen unter Wasser Qualifiziert bis 50 m Wassertiefe, Der Praktiker, 2019 1-2, 26-31
-
(2019): Compressive response of high-strength [001]-oriented single crystals of a Co35Ni35Al30 shape memory alloy, Journal of Alloys and Compounds 787, 2019, 963-971
DOI: 10.1016/j.jallcom.2019.02.185 -
(2019): Untersuchungen zum Einfluss von Stickstoff in der Lötatmosphäre auf die Lebensdauerfestigkeit Ni-Basis-gelöteter CrNi-Stahl-Verbindungen unter korrosiver Belastung, Schweißen und Schneiden 71, 2019 (4), 230-237
-
(2019): Anomalous twinning in AZ 31 magnesium alloy during electrically assisted forming, Materials Letters 255, 2019, 126516
DOI: 10.1016/j.matlet.2019.126516 -
(2019): Brazing in SiH4-Doped Inert Gases - A New Approach to an Environment Friendly Production Process, Int. J. of Precis. Eng. and Manuf.-Green Tech. 495, 2019 (1), 187
DOI: 10.1007/s40684-019-00109-1 -
(2019): Investigation of the Prediction Accuracy of a Finite Element Analysis Model for the Coating Thickness in Cross-Wedge Rolled Coaxial Hybrid Parts, Materials 12, 2019 (18), 2969
DOI: 10.3390/ma12182969 -
(2019): Assessing printability maps in additive manufacturing of metal alloys, Acta Materialia 176, 2019, 199-210
DOI: 10.1016/j.actamat.2019.07.005 -
(2019): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2019): Tailoring the Microstructure in Polycrystalline Co–Ni–Ga High-Temperature Shape Memory Alloys by Hot Extrusion, Shap. Mem. Superelasticity 5, 2019 (1), 84-94
DOI: 10.1007/s40830-019-00208-7 -
(2019): Fatigue behavior of As-built selective laser melted titanium scaffolds with sheet-based gyroid microarchitecture for bone tissue engineering, Acta Biomaterialia 94, 2019, 610-626
DOI: 10.1016/j.actbio.2019.05.046 -
(2019): Comparison of degradation behaviour and osseointegration of the two magnesium scaffolds, LAE442 and La2, in vivo, Materialia 8, 2019, 100436
DOI: 10.1016/j.mtla.2019.100436 -
(2019): Verminderung des Risikos wasserstoffinduzierter Kaltrisse durch den Einsatz austenitischer Schweißzusatzwerkstoffe beim hyperbar nassen Schweißen höherfester Baustähle, Schweißen und Schneiden 71, 2019 (9), 588-594
-
(2019): Giant reversible stress-induced change of resistivity in Ni-Mn-In-Co alloys, Journal of Applied Physics 125, 2019 (19), 195103
DOI: 10.1063/1.5088233 -
(2019): Microstructure Formation in Cast TiZrHfCoNiCu and CoNiCuAlGaIn High Entropy Shape Memory Alloys: A Comparison, Materials 12, 2019 (24)
DOI: 10.3390/ma12244227 -
(2019): Impact of Heating–Cooling Rates on the Functional Properties of Ti–20Ta–5Al High-Temperature Shape Memory Alloys, Shap. Mem. Superelasticity 5, 2019 (1), 95-105
DOI: 10.1007/s40830-019-00207-8 -
(2019): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2019): Development of a tool concept with selectively oxidised inserts for dry deep drawing, Dry Met. Forming OAJ FMT 5, 2019, 46-49
-
(2019): Compressive shape memory actuation response of stress-induced martensite aged Ni51Fe18Ga27Co4 single crystals, Materials Science and Engineering: A 746, 2019, 448-455
DOI: 10.1016/j.msea.2019.01.004 -
(2019): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2019): Werkstofftechnisch basiertes Modell für die Simulation des Unterwasserschweißens, Schweißen und Schneiden 71, 2019 (8), 513-519
-
(2019): Visualization and Observation of Morphological Peculiarities of Twin Formation in Mg-Based Samples After Electrically Assisted Forming, Metallogr. Microstruct. Anal. 8, 2019 (6), 806-814
DOI: 10.1007/s13632-019-00589-2 -
(2019): Automatisierung der Verbindungsvorbereitung von Stahlseilfördergurten - Einsatz von Wasserstrahlverfahren, Schüttgut 25, 2019 (2), 84-88
-
(2019): Cyclic deformation response of ultra-fine grained titanium at elevated temperatures, International Journal of Fatigue 122, 2019, 228-239
DOI: 10.1016/j.ijfatigue.2019.01.021 -
(2019): Joining of blanks by cold pressure welding: Incremental rolling and strategies for surface activation and heat treatment, Materialwiss. Werkstofftech. 50, 2019 (8), 924-939
DOI: 10.1002/mawe.201900031 -
(2019): Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfaces, Wear 426-427, 2019, 1603-1615
DOI: 10.1016/j.wear.2019.01.009 -
(2019): Evolution of surface characteristics of two industrial 7xxx aluminium alloys exposed to humidity at moderate temperature, Surface and Interface Analysis 51, 2019 (19), 5775
DOI: 10.1002/sia.6652 -
(2019): Generating Ultrabroadband Deep-UV Radiation and Sub-10 nm Gap by Hybrid-Morphology Gold Antennas, Nano letters 19, 2019 (7), 4779-4786
DOI: 10.1021/acs.nanolett.9b02100 -
(2019): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2019): Material models for the thermoplastic material behaviour of a dual-phase steel on a microscopic and a macroscopic length scale, Journal of the Mechanics and Physics of Solids 129, 2019, 205-228
DOI: 10.1016/j.jmps.2019.04.012 -
(2018): Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt Coatings, Adv. Eng. Mater. 20, 2018 (9), 1800102
DOI: 10.1002/adem.201800102 -
(2018): Decommissioning of Nuclear Facilities: An Interdisciplinary Task for Junior Staff, atw - International Journal for Nuclear Power 63, 2018 (11/12), 601-604
-
(2018): On the Utility of Crystal Plasticity Modeling to Uncover the Individual Roles of Microdeformation Mechanisms on the Work Hardening Response of Fe-23Mn-0.5C TWIP Steel in the Presence of Hydrogen, J. Eng. Mater. Technol 140, 2018 (3), 31002
DOI: 10.1115/1.4038801 -
(2018): A Numerical Study on Co-Extrusion to Produce Coaxial Aluminum-Steel Compounds with Longitudinal Weld Seams, Metals 8, 2018 (9), 717
DOI: 10.3390/met8090717 -
(2018): Shaping single atomic junctions in ultra-thin Ag structures by electromigration, Appl. Phys. Lett. 113, 2018 (1), 13106
DOI: 10.1063/1.5040405 -
(2018): Manufacturing of High-Performance Bi-Metal Bevel Gears by Combined Deposition Welding and Forging, Metals 8, 2018 (11), 898
DOI: 10.3390/met8110898 -
(2018): Influence of High Current-Density Impulses on the Stress-Strain Response and Microstructural Evolution of the Single Crystal Superalloy CMSX-4, Materials Research 21, 2018 (6), 1063
DOI: 10.1590/1980-5373-MR-2018-0428 -
(2018): Effect of Electrical Pulses on the Mechanical Behavior of Single Crystals of Nickel-Based CMSX-4 Superalloy and the Mobility of Low-Angle Grain Boundary in Aluminum Bicrystals, Bulletin of the Russian Academy of Sciences: Physics 82, 2018 (9), 1079-1085
DOI: 10.3103/S106287381809006X -
(2018): The Influence of Alternating Low-Cycle Bending Loads on Sheet Properties Having an Hcp Crystal Lattice, J. of Materi Eng and Perform 27, 2018 (2), 541-549
DOI: 10.1007/s11665-018-3123-2 -
(2018): Surface integrity of turned laser-welded hybrid shafts, Prod. Eng. Res. Devel., 2018
DOI: 10.1007/s11740-018-0862-8 -
(2018): Technology-based re-contouring of blade integrated disks after weld repair, J. Eng. Gas Turbines Power, 2018
DOI: 10.1115/1.4040738 -
(2018): Investigation of the γ′-Strengthened Quaternary Co-Based Alloys Co-Al-W-Ta, Metall and Mat Trans A 49, 2018 (9), 4042-4057
DOI: 10.1007/s11661-018-4756-3 -
(2018): Development of B2 Shape Memory Intermetallics Beyond NiAl, CoNiAl and CoNiGa, Shap. Mem. Superelasticity 4, 2018 (3), 360-368
DOI: 10.1007/s40830-018-0180-1 -
(2018): Magnetic pulse controlled microstructure development in Co 49 Ni 21 Ga 30 single crystals, Materials Science and Technology 34, 2018 (16), 1954-1964
DOI: 10.1080/02670836.2018.1497129 -
(2018): Internal pressure as a key thermodynamic factor to obtain high-temperature superelasticity of shape memory alloys, Materials Letters 210, 2018, 252-254
DOI: 10.1016/j.matlet.2017.09.034 -
(2018): Direct Observation of Nano-dimensional Internal Structure of Ferromagnetic Domains in the Ferromagnetic Shape Memory Alloy Co-Ni-Ga, Journal of Magnetism and Magnetic Materials, 2018
DOI: 10.1016/j.jmmm.2018.06.066 -
(2018): Kontinuierliches Unterwasserschweißen mit Massivdrahtelektroden, Schweißen und Schneiden 70, 2018 (10), 720-726
-
(2018): Strategies for the Heat Treatment of Steel-Aluminium Hybrid Components, HTM 73, 2018 (5), 268-282
DOI: 10.3139/105.110368 -
(2018): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2018): Crystallographic Structure Analysis of a Ti-Ta Thin Film Materials Library Fabricated by Combinatorial Magnetron Sputtering, ACS combinatorial science 20, 2018 (3), 137-150
DOI: 10.1021/acscombsci.7b00135 -
(2018): Thermal Properties of Intermetallic Phases at the Interface of Aluminum-Copper Compound Castings, Adv. Eng. Mater. 20, 2018 (6), 1701027
DOI: 10.1002/adem.201701027 -
(2018): The Effect of SiC Addition on Microstructure and Mechanical Properties of Gas Tungsten Arc-Welded Ti-6Al-4V Alloy, J. of Materi Eng and Perform 27, 2018 (1), 253-260
DOI: 10.1007/s11665-017-3091-y -
(2018): Herstellungsprozess und Wälzfestigkeit von hybriden Hochleistungsbauteilen, Konstruktion 70, 2018 (9), 84-89 More info
-
(2018): Hydrogen-assisted failure in a bimodal twinning-induced plasticity steel: Delamination events and damage evolution, International Journal of Hydrogen Energy 43, 2018 (4), 2492-2502
DOI: 10.1016/j.ijhydene.2017.11.177 -
(2018): Future regeneration processes for high-pressure turbine blades, CEAS Aeronaut J 9, 2018 (1), 85-92
DOI: 10.1007/s13272-017-0277-9 -
(2018): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2018): Laser welding of dissimilar low-alloyed steel-steel butt joints and the effects of beam position and ultrasound excitation on the microstructure, Journal of Laser Applications 30, 2018 (3), 32417
-
(2018): Two-way shape memory effect and thermal cycling stability in Co 35 Ni 35 Al 30 single crystals by low-temperature martensite ageing, Scripta Materialia 150, 2018, 18-21
DOI: 10.1016/j.scriptamat.2018.02.013 -
(2018): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2018): Spiky Nickel Electrodes for Electrochemical Oxygen Evolution Catalysis by Femtosecond Laser Structuring, International Journal of Electrochemistry, 2018 (12), 1-12
DOI: 10.1155/2018/9875438 -
(2018): Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatings, Thermal Spray Bulletin 70, 2018 (2), 104-111
-
(2018): Inductive heat treatment as an alternative tempering method for the selective oxidation of 1.2379 tool steel surfaces, Dry Met. Forming OAJ FMT 4, 2018, 13-17
-
(2018): Resonant-Plasmon-Assisted Subwavelength Ablation by a Femtosecond Oscillator, Phys. Rev. Applied 9, 2018 (2), 024001-10
DOI: 10.1103/PhysRevApplied.9.024001 -
(2018): Impact of Plasmon-Induced Atoms Migration in Harmonic Generation, ACS Photonics 5, 2018 (4), 1208-1214
DOI: 10.1021/acsphotonics.7b01560 -
(2018): Modelling of the fatigue crack growth of a coated single crystalline nickel-based superalloy under thermal mechanical loading, International Journal of Fatigue 116, 2018, 268-274
DOI: 10.1016/j.ijfatigue.2018.06.015 -
(2018): The effect of temperature gradients in thermo-mechanical fatigue testing, Materials at High Temperatures 36, 2018 (2), 97-103
DOI: 10.1080/09603409.2018.1466500 -
(2018): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2018): Effects of microstructural mechanisms on the localized oxidation behavior of NiTi shape memory alloys in simulated body fluid, J Mater Sci 53, 2018 (2), 948-958
DOI: 10.1007/s10853-017-1586-4 -
(2018): Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-Beschichtungen, Unter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
-
(2018): Effect of Different Intercritical Annealing Treatments without and with Overaging on the Mechanical Material Behavior, Steel Research Int. 89, 2018 (10), 1800196
DOI: 10.1002/srin.201800196 -
(2018): Ion polishing as a method of imaging the magnetic structures in CoNiGa monocrystal, Results in Physics 10, 2018, 277-280
DOI: 10.1016/j.rinp.2018.06.020 -
(2017): How dry is dry? - A critical analysis of surface conditions used in dry metal forming, Dry Met. Forming OAJ FMT 3, 2017, 90-94
-
(2017): Hydrogen-enhanced Orientation Dependence of Stress Relaxation and Strain-aging in Hadfield Steel Single Crystals, Scripta Materialia 136, 2017, 101-105
DOI: 10.1016/j.scriptamat.2017.04.028 -
(2017): The Influence of the Thermomechanical Processing Regime on the Structural Evolution of Mo-Nb-Ti-V Microalloyed Steel Subjected to High-Pressure Torsion, Metall and Mat Trans A 48, 2017 (7), 3400-3409
DOI: 10.1007/s11661-017-4085-y -
(2017): Application of mechanical surface finishing processes for roughness reduction and fatigue improvement of additively manufactured Ti-6Al-4V parts, International Journal of Fatigue 102, 2017, 135-142
DOI: 10.1016/j.ijfatigue.2017.05.008 -
(2017): Influences on the formability and mechanical properties of 7000-aluminum alloys in hot and warm forming, J. Phys.: Conf. Ser. 896, 2017, 12004
DOI: 10.1088/1742-6596/896/1/012004 -
(2017): Investigation of the coating thickness of plasma-transferred arc deposition welded and cross wedge rolled hybrid parts, Prod. Eng. Res. Devel. 11, 2017 (3), 255-263
DOI: 10.1007/s11740-017-0734-7 -
(2017): Influence of High-Current-Density Impulses on the Compression Behavior: Experiments with Iron and a Nickel-Based Alloy, Journal of Materials Engineering and Performance 26, 2017 (1), 177-184
DOI: 10.1007/s11665-016-2457-x -
(2017): Residual stress formation after re-contouring of micro-plasma welded Ti−6Al−4 V parts by means of ball end milling, Mat.-wiss. u. Werkstofftech. 48, 2017 (11), 1034-1039
DOI: 10.1002/mawe.201600743 -
(2017): Rückbau von Stahlstrukturen unter Wasser mittels Laserstrahlschneiden, Schiff und Hafen 69, 2017 (11), 40-44
-
(2017): Formation and growth of voids in dual-phase steel at microscale and nanoscale levels, Journal of Materials Science 52, 2017 (8), 4234-4243
DOI: 10.1007/s10853-016-0678-x -
(2017): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics 26, 2016 (8), 1147-1169
DOI: 10.1177/1056789516650245 -
(2017): Microstructural characterization and simulation of damage for geared sheet components, J. Phys.: Conf. Ser. 896, 2017, 12076
DOI: 10.1088/1742-6596/896/1/012076 -
(2017): Pulsed magnetic field-induced changes in the meso- and nanostructure of Co49Ni21Ga30 martensite, Funct. Mater. Lett. 10, 2017 (04), 1750044
DOI: 10.1142/S1793604717500448 -
(2017): Manuelles und halbautomatisches Elektrokontakttrennen von Spundwänden unter Wasser, Schweißen und Schneiden 69, 2017 (5), 244-251
-
(2017): Die Sonnenscheibe aus Moordorf - Bronzezeit oder Fälschung, DGM-Jahresmagazin - Materialographie/Metallographie 2017, 44-46
-
(2017): Microstructure and Mechanical Properties of Friction Welded Steel-Aluminum Hybrid Components after T6 Heat Treatment, Materials Science and Engineering: A 696, 2017, 33-41
DOI: 10.1016/j.msea.2017.04.052 -
(2017): Method for Semi-Automated Measurement and Statistical Evaluation of Iron Aluminum Intermetallic Compound Layer Thickness and Morphology, Metallogr. Microstruct. Anal. 6, 2017 (5), 367-374
DOI: 10.1007/s13632-017-0378-1 -
(2017): Influence of martensitic transformation on the magnetic transition in Ni-Mn-Ga, Journal of Magnetism and Magnetic Materials 432, 2017, 266-270
DOI: 10.1016/j.jmmm.2017.02.008 -
(2017): Laserstrahlschneiden unter Wasser für höhere Produktivität, Schweißen und Schneiden 69, 2017 (11), 774-780
-
(2017): Microstructural evolution and functional fatigue of a Ti–25Ta high-temperature shape memory alloy, J. Mater. Res. 32, 2017 (23), 4287-4295
DOI: 10.1557/jmr.2017.319 -
(2017): Influence of Cross Wedge Rolling on the Coating Quality of Plasma-Transferred Arc Deposition Welded Hybrid Steel Parts, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (7), 1-7
-
(2017): Influence of silicon on the structure and weldability of steel-aluminium joints processed by non-vacuum electron beam welding, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (9), 348-356
-
(2017): A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/Al, J Therm Spray Tech 26, 2017 (7), 1659-1668
DOI: 10.1007/s11666-017-0612-z -
(2017): Surface modification of an austenitic stainless steel wire by a multi-pulse treatment with a high-power electric current, Journal of Materials Science 52, 2017 (13), 8007-8015
DOI: 10.1007/s10853-017-1003-z -
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten Druckgussbauteilen, Giesserei Special, 2017 (1), 74-89 More info
-
(2017): Two-way shape memory effect under multi-cycles in [001]-oriented Ni 49 Fe 18 Ga 27 Co 6 single crystal, Materials Science and Engineering: A 706, 2017, 95-103
DOI: 10.1016/j.msea.2017.08.108 -
(2017): An EBSD Evaluation of the Microstructure of Crept Nimonic 101 for the Validation of a Polycrystal–Plasticity Model, J. of Materi Eng and Perform 26, 2017 (12), 6087-6098
DOI: 10.1007/s11665-017-3046-3 -
(2017): Einschluss oder Zugriff, Tiefenlagerung ohne oder mit Vorkehrungen zur Rückholbarkeit, GAiA Ökologische Perspektiven für Wissenschaft und Gesellschaft, 2017 (2), 114-117
DOI: 10.14512/gaia.26.2.13 -
(2017): Engineering of biodegradable magnesium alloy scaffolds to stabilize biological myocardial grafts, Biomedizinische Technik. Biomedical engineering 62, 2017 (5), 493-504
DOI: 10.1515/bmt-2016-0205 -
(2017): Investigating the origin of third harmonic generation from diabolo optical antennas, Appl. Phys. Lett. 111, 2017 (17), 173102
DOI: 10.1063/1.5001005 -
(2017): Self-optimization of plasmonic nanoantennas in strong femtosecond fields, Optica 4, 2017 (9), 1038-1043
DOI: 10.1364/OPTICA.4.001038 -
(2017): Robotic guided waterjet cutting technique for high tibial dome osteotomy: A pilot study, The international journal of medical robotics + computer assisted surgery MRCAS 4, 2017 (2), 174-179
DOI: 10.1002/rcs.1825 -
(2017): Mechanical Properties of Co-Extruded Aluminium-Steel Compounds, Key Engineering Materials 742, 2017, 512-519
DOI: 10.4028/www.scientific.net/KEM.742.512 -
(2017): Peculiarities of high-temperature superelasticity in Ni–Fe–Ga single crystals in compression, Tech. Phys. Lett. 43, 2017 (3), 320-323
DOI: 10.1134/S1063785017030245 -
(2017): 1-Step “Quenching and Partitioning” of the Press-Hardening Steel 22MnB5, Steel Research Int. 88, 2017 (6), 1600307
DOI: 10.1002/srin.201600307 -
(2017): The Effect of Intercritical Annealing on the Microstructure and Mechanical Properties of Ferritic-Martensitic Two-Phase Steels, Steel Research Int. 88, 2017 (2), 271-280
DOI: 10.1002/srin.201600107 -
(2017): Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal forming, Wear 376-377, 2017, 1789-1803
DOI: 10.1016/j.wear.2017.01.084 -
(2017): Wear Testing of Thermally Oxidised Tool Steel Specimens with α-Fe2O3 Layers, Dry Met. Forming OAJ FMT 3, 2017, 45-49
-
(2017): Automatable Splicing Method for Steel Cord Conveyor Belts – Evaluation of Water Jetting as a Preparation Process, Journal of Mechanical Engineering 63, 2017 (10), 590-596
DOI: 10.5545/sv-jme.2017.4363 -
(2017): Zn-Li alloy after extrusion and drawing: Structural, mechanical characterization, and biodegradation in abdominal aorta of rat, Materials Science and Engineering: C 76, 2017, 301-312
DOI: 10.1016/j.msec.2017.02.167 -
(2016): Effect of strain rate on hydrogen embrittlement susceptibility of twinning-induced plasticity steel pre-charged with high-pressure hydrogen gas, International Journal of Hydrogen Energy 41, 2016 (34), 15362-15372
DOI: 10.1016/j.ijhydene.2016.06.259 -
(2016): Process Integrated Heat Treatment of a Microalloyed Medium Carbon Steel: Microstructure and Mechanical Properties, J. of Materi Eng and Perform 25, 2016 (4), 1453-1462
DOI: 10.1007/s11665-016-2004-9 -
(2016): Role of nanotwins on fatigue crack growth resistance – Experiments and theory, International Journal of Fatigue 84, 2016, 28-39
DOI: 10.1016/j.ijfatigue.2015.11.012 -
(2016): Biocompatibility and degradation of LAE442-based magnesium alloys after implantation of up to 3.5years in a rabbit model, Acta Biomaterialia 44, 2016, 355-365
DOI: 10.1016/j.actbio.2016.08.002 -
(2016): Umformtechnische Herstellung hybrider Lagerbuchsen, wt Werkstattstechnik online 106, 2016 (10), 743-748
-
(2016): Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf Titanbasis, Forsch. Ingenieurwes. 81, 2017 (1), 1-12
DOI: 10.1007/s10010-016-0209-6 -
(2016): Qualifying Electrically Conductive Cold Embedding-Media for Scanning Electron Microscopy, Metallogr. Microstruct. Anal. 5, 2016 (4), 332-341
DOI: 10.1007/s13632-016-0286-9 -
(2016): Induction heat treatment of sheet-bulk metal-formed parts assisted by water-air spray cooling, Steel Research Int. 87, 2016 (9), 1220-1227
DOI: 10.1002/srin.201500404 -
(2016): Ion Beam Processing in the Sample Preparation for the Analysis of Ductile Damage in Deep Drawing Steels, Prakt. Metallogr. 53, 2016 (4), 221-236
DOI: 10.3139/147.110377 -
(2016): Specimen Preparation by Ion Beam Slope Cutting for Characterization of Ductile Damage by Scanning Electron Microscopy, Microsc. Res. Tech. 79, 2016 (4), 321-327
DOI: 10.1002/jemt.22633 -
(2016): Ductile Damage and Fatigue Behavior of Semi-Finished Tailored Blanks for Sheet-Bulk Metal Forming Processes, Journal of Materials Engineering and Performance 25, 2016 (3), 1136-1142
DOI: 10.1007/s11665-016-1908-8 -
(2016): Modelling the Plasma Jet in Multi-Arc Plasma Spraying, J Therm Spray Tech 25, 2016 (6), 1111-1126
DOI: 10.1007/s11666-016-0438-0 -
(2016): Impact of intraprosthetic drilling on the strength of the femoral stem in periprosthetic fractures: A finite element investigation, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Engineering in Medicine 230, 2016 (7), 675-681
DOI: 10.1177/0954411916647078 -
(2016): Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling process, Mat.-wiss. u. Werkstofftech 47, 2016 (8), 780-788
DOI: 10.1002/mawe.201600612 -
(2016): Effect of Deformation Texture on the Anisotropy of Elasticity and Damage of Two Phase Steel Sheets, The Physics of Metals and Metallography 117, 2016 (7), 719-724
DOI: 10.1134/S0031918X16050033 -
(2016): MgNd2 alloy in contact with nasal mucosa: an in vivo and in vitro approach, J Mater Sci: Mater Med 27, 2016 (2), 25
DOI: 10.1007/s10856-015-5636-7 -
(2016): Thermal Stability of the Structure of a Heat-Resistant Cobalt Alloy Hardened with Intermetallic γ'-Phase Precipitates, Russian Metallurgy, 2016 (4), 286-291
-
(2016): The effect of texture in modeling deformation processes of bcc steel sheets, Materials Letters 164, 2016, 356-359
DOI: 10.1016/j.matlet.2015.11.007 -
(2016): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics, 2016
DOI: 10.1177/1056789516650245 -
(2016): Cutting and Welding of High-Strength Steels Using Non-Vacuum Electron Beam as a Universal Tool for Material Processing, WJET 04, 2016 (04), 598-607
DOI: 10.4236/wjet.2016.44056 -
(2016): Holistic consideration of grain growth behavior of tempering steel 34CrNiMo6 during heating processes, Journal of Materials Processing Technology 229, 2016, 61-71
DOI: 10.1016/j.jmatprotec.2015.09.015 -
(2016): Determination of heat transfer coefficients for complex spray cooling arrangements, International Journal of Microstructure and Materials Properties 11, 2016 3/4, 229-246
DOI: 10.1504/IJMMP.2016.079149 -
(2016): Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter Prozessgase, Schweißen und Schneiden 68, 2016 (5)
-
(2016): Influence of the Surface and Heat Treatment on the Bond Strength of Galvanized Steel/Aluminum Composites Joined by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (8), 1371-1380
DOI: 10.1002/adem.201600085 -
(2016): Molecular Engineering of Aluminum-Copper Interfaces for Joining by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (6), 1066-1074
DOI: 10.1002/adem.201500501 -
(2016): Effect of Pre-Rolling Heat Treatments on the Bond Strength of Cladded Galvanized Steels in a Cold Roll Bonding Process, Steel Research Int. 87, 2016 (12), 1619-1626
DOI: 10.1002/srin.201600021 -
(2016): Evaluation of Void Nucleation and Development during Plastic Deformation of Dual-Phase Steel DP600, Steel Research Int. 87, 2016 (12), 1583-1591
DOI: 10.1002/srin.201500483 -
(2016): Investigations of ductile damage in DP600 and DC04 deep drawing steel sheets during punching, Procedia Structural Integrity 2, 2016, 673-680
DOI: 10.1016/j.prostr.2016.06.087 -
(2016): Investigations of ductile damage during the process chains of toothed functional components manufactured by sheet-bulk metal forming, Production Engineering 10, 2016 (1), 5-15
DOI: 10.1007/s11740-016-0656-9 -
(2016): Experimental and numerical investigation of increased formability in combined quasi-static and high-speed forming processes, Journal of Materials Processing Technology 237, 2016, 254-269
DOI: 10.1016/j.jmatprotec.2016.06.007 -
(2016): Corrosion behavior, biocompatibility and biomechanical stability of a prototype magnesium-based biodegradable intramedullary nailing system, Materials Science and Engineering: C 59, 129-135
DOI: 10.1016/j.msec.2015.10.006 -
(2016): Cyclic Degradation of Co49Ni21Ga30 High-Temperature Shape Memory Alloy: On the Roles of Dislocation Activity and Chemical Order, Shap. Mem. Superelasticity 2, 2016 (1), 37-49
DOI: 10.1007/s40830-015-0049-5 -
(2016): 57Fe Mössbauer, SEM/EDX, p-XRF and μ-XRF studies on a Dutch painting, Hyperfine Interact 237, 2016 (1)
DOI: 10.1007/s10751-016-1296-3 -
(2016): Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging Die, Advanced Materials Research 1140, 2016, 91-98
DOI: 10.4028/www.scientific.net/AMR.1140.91 -
(2016): Ex-situ and in-situ investigations of thermal anti-oxidation treatments of stainless steels by reflection mode EXAFS, J. Phys.: Conf. Ser. 712, 2016, 12047
DOI: 10.1088/1742-6596/712/1/012047 -
(2016): Analysis of Microstructure and Damage Evolution in Ultra-Thin Wires of the Magnesium Alloy MgCa0.8 at Multipass Drawing, JOM 68, 2016 (12), 3063-3069
DOI: 10.1007/s11837-016-2127-3 -
(2016): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, Thermal Spray Bulletin 68, 2016 (1), 54-59
-
(2016): Micro-Scale Cyclic Bending Response of NiTi Shape Memory Alloy, Materials Transactions 57, 2016 (3), 472-475
DOI: 10.2320/matertrans.M2015423 -
(2016): Intelligente Schmiedewerkzeuge – Effizienter Verschleißschutz durch zyklische Randschichthärtung?, massivUMFORMUNG, 2016 (3), 44-48
-
(2016): Phosphate conversion coating reduces the degradation rate and suppresses side effects of metallic magnesium implants in an animal model, J. Biomed. Mater. Res., 2016
DOI: 10.1002/jbm.b.33704 -
(2016): Turbine blade wear and damage – An overview of advanced characterization techniques, Materials Testing 58, 2016 (5), 389-394
DOI: 10.3139/120.110872 -
(2016): Influence of surface pre-treatments on the high-cycle fatigue behavior of Ti–6Al–4V – From anodizing to laser-assisted techniques, International Journal of Fatigue 91, 2016, 195-203
DOI: 10.1016/j.ijfatigue.2016.06.010 -
(2016): An exploration of plastic deformation dependence of cell viability and adhesion in metallic implant materials, Journal of the Mechanical Behavior of Biomedical Materials 60, 2016, 177-186
DOI: 10.1016/j.jmbbm.2016.01.001 -
(2016): Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und Festwalzen, Werkstoffe in der Fertigung, 2016 (4), 27-28
-
(2016): New Specimen Design for Wear Investigations in Dry Sheet Metal Forming, Dry Met. Forming OAJ FMT 2, 2016, 62-66
-
(2015): Numerical Modelling of the Tribology of a Selective Oxidised 1.2379 Tool Steel Surface Developed for Dry Metal Forming , Dry Met. Forming OAJ FMT 1, 2015; 91-95
-
(2015): Testing of pipe sections, Materials Testing 57, 2015 (7-8); 643-648.
DOI: 10.3139/120.110759 -
(2015): On the micro-deformation mechanisms active in high-manganese austenitic steels under impact loading, Materials Science and Engineering: A, 632; 29-34
DOI: 10.1016/j.msea.2015.02.054 -
(2015): The influence of storage and heat treatment on a magnesium-based implant material: an in vitro and in vivo study, BioMedical Engineering OnLine 14 (1), 1680
-
(2015): In-situ-Erfassung der Werkstoffumwandlung und Gefügeausbildung von Schmiedebauteilen im Abkühlpfad, HTM Journal of Heat Treatment and Materials 70 (3), 2015; S. 150-161
DOI: 10.3139/105.110259 -
(2015): Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatment, La Metallurgia Italiana - International Journal of the Italian Association for Metallurgy 2015 (11/12), 29-37
-
(2015): Mechanical response of low stacking fault energy Co–Ni alloys – Continuum, mesoscopic and atomic level treatments, International Journal of Plasticity 71, 2015; 32-61
-
(2015): Biodegradable nasal stents (MgF 2 -coated Mg-2 wt %Nd alloy)-A long-term in vivo study, Journal of Biomedical Materials Research Part B: Applied Biomaterials
DOI: 10.1002/jbm.b.33559 -
(2015): A novel biodegradable frontal sinus stent (MgNd2): a long-term animal study, European Archives of Oto-Rhino-Laryngology
DOI: 10.1007/s00405-015-3774-7 -
(2015): Verbundguss von Aluminium und Kupfer für Anwendungen als Hochleistungskühlkörper, Giesserei Praxis 66 (10); 459-462
-
(2015): Characterization of the Microstructure Evolution in IF-Steel and AA6016 during Plane-Strain Tension and Simple Shear, Materials 8; 285-301
DOI: 10.3390/ma8010285 -
(2015): Extrusion of the bimetallic aluminum-magnesium rods and tubes, Forsch Ingenieurwes 79, 2015 (1-2); 17–27
DOI: 10.1007/s10010-015-0184-3 -
(2015): Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-Coatings, Applied Mechanics and Materials 788, 2015, 143-150
DOI: 10.4028/www.scientific.net/AMM.788.143 -
(2015): The effectiveness of spheroidization pearlitic steel with regard to the degree of plastic deformation, Interdisciplinary Journal of Engineering Sciences, 3, 2015 (1); 6-9
-
(2015): Twinning activities in high-Mn austenitic steels under high-velocity compressive loading, Materials Science and Engineering: A 648; 104-112.
DOI: dx.doi.org/10.1016/j.msea.2015.09.045 -
(2015): Systematic investigation into wet arc welding under water with covered stick electrodes, Welding and Cutting 14, 2015 (1), 48-53
-
(2015): Kraftschlüssiger Spaltausgleich an imperfekten Flanschverbindungen, Schiff und Hafen 10, 2015; 40-42.
-
(2015): Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steel, Welding and Cutting, 14, 2015 (5), 280-288
-
(2015): Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-Stahl, Schweißen und Schneiden, 67, 2015 (4), 174-182
-
(2015): Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating, Acta Biomaterialia 11, S. 488–493
DOI: 10.1016/j.actbio.2014.09.042 -
(2015): Martensite stabilization in shape memory alloys – Experimental evidence for short-range ordering, Materials Letters 159, 2015; S. 16-19.
DOI: 10.1016/j.matlet.2015.06.048 -
(2015): Microstructure and transformation related behaviors of a Ni45.3Ti29.7Hf20Cu5 high temperature shape memory alloy, Materials Science and Engineering: A 627, S. 82–94
DOI: 10.1016/j.msea.2014.12.111 -
(2015): Finite element analysis of combined forming processes by means of rate dependent ductile damage modelling, International Journal of Material Forming, 2015
DOI: 10.1007/s12289-015-1278-z -
(2015): Friction-locked gap compensation in imperfect flange connections, Ship & Offshore 6, 2015, 36 - 38.
-
(2015): Transplantation von thermisch gespritzten Schichten, Thermal Spray Bulletin 8, 2015 (1), 50-55.
-
(2015): Stress-induced resistivity changes in a Ni-Mn-In alloy, Applied Physics Letters, 2015, 106; 131908.
DOI: 10.1063/1.4917016 -
(2015): Functional Fatigue and Tension–Compression Asymmetry in [001]-Oriented Co49Ni21Ga30 High-Temperature Shape Memory Alloy Single Crystals, Shape Memory and Superelasticity 1 (1), 2015; 6-17.
DOI: 10.1007/s40830-015-0003-6 -
(2015): Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine blades, Thermal Spray Bulletin, 2015, 8; S. 56-61.
-
(2015): Martensite aging – Avenue to new high temperature shape memory alloys, Acta Materialia 89, S. 298-304
DOI: 10.1016/j.actamat.2015.01.042 -
(2015): Cyclic degradation of titanium–tantalum high-temperature shape memory alloys — the role of dislocation activity and chemical decomposition, Functional Materials Letters 8, 2015; S. 1550062-1 - 1550062-5
DOI: 10.1142/S1793604715500629 -
(2015): Superelasticity in high-strength heterophase single crystals of Ni51.0Ti36.5Hf12.5 alloy, Technical Physics Letters 41 (8), 2015; 797-800.
DOI: 10.1134/S1063785015080283 -
(2015): A Single-Crystal Co-Base Superalloy Strengthened by γ′ Precipitates: Structure and Mechanical Properties, Advanced Engineering Materials 17 (6) 2015, 755-760
DOI: 10.1002/adem.201500088 -
(2015): Alkalization is responsible for antibacterial effects of corroding magnesium, Journal of Biomedical Materials Research Part A, 2015
DOI: 10.1002/jbm.a.35503 -
(2015): In vitro and in vivo corrosion of the novel magnesium alloy Mg–La–Nd–Zr: influence of the measurement technique and in vivo implant location, Biomedical Materials 10 (4) 2015, 045021
DOI: 10.1088/1748-6041/10/4/045021 -
(2015): Neue Anwendungsbereiche numerischer Simulation beim induktiven Randschichthärten mit Feldkonzentratoren, HTM Journal of Heat Treatment and Materials 70 (1), S. 40-49
DOI: 10.3139/105.110250 -
(2015): Investigation of cold pressure welding: cohesion coefficient of copper, Key Engineering Materials 651-653 (2015), S. 1421-1426
DOI: 10.4028/www.scientific.net/KEM.651-653.1421 -
(2015): Herstellung, biomechanische Prüfung und Integrationsverhalten biologischer Interferenzschrauben aus ossärem Material, Fuß & Sprunggelenk 13, 2015, 182–191
DOI: 10.1016/j.fuspru.2015.06.001 -
(2015): Processing of New Materials by Additive Manufacturing: Iron-Based Alloys Containing Silver for Biomedical Applications, Metall. Mater. Trans. A 46, 2015; S. 2829-2833
DOI: 10.1007/s11661-015-2932-2 -
(2015): One-way and two-way shape memory effect in ferromagnetic NiFeGaCo single crystals, Materials Science and Engineering: A 640, 2015; 465-470
DOI: 10.1016/j.msea.2015.06.024 -
(2015): Influence of the Gap Width on the Geometry of the Welded Joint in Hybrid Laser-Arc Welding, Physics Procedia 78, 2015, 14-23
DOI: 10.1016/j.phpro.2015.11.013 -
(2015): Damage Evolution in Pseudoelastic Polycrystalline Co-Ni-Ga High-temperature Shape Memory Alloys, Journal of Alloys and Compounds 633, 2015; 288-295.
DOI: 10.1016/j.jallcom.2015.01.282 -
(2015): Biocompatibility of MgF2-coated MgNd2 specimens in contact with mucosa of the nasal sinus – A long term study, Acta Biomaterialia 18, 2015; 249-261
DOI: 10.1016/j.actbio.2015.03.003 -
(2015): Magnesium-containing layered double hydroxides as orthopaedic implant coating materials-An in vitro and in vivo study, J. Biomed. Mater. Res. (Journal of Biomedical Materials Research Part B: Applied Biomaterials) 04/2015
DOI: DOI: 10.1002/jbm.b.33422 -
(2015): Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal Forming, Dry Met. Forming OAJ FMT 1, 2015, 72-78
-
(2014): Twin Nucleation in Fe-based BCC Alloys - Modeling and Experiments, Modell. Sim. Mater. Sci. Eng., 22, S. 075010-1 - 075010-21
DOI: 10.1088/0965-0393/22/7/075010 -
(2014): Microstructure and mechanical response of single-crystalline high-manganese austenitic steels under high-pressure torsion: The effect of stacking-fault energy, Materials Science and Engineering A., (604), S. 166-175
DOI: 10.1016/j.msea.2014.03.029 -
(2014): Non-vacuum electron-beam carburizing and surface hardening of mild steel, Applied Surface Science 322; S. 6-14
DOI: 10.1016/j.apsusc.2014.09.137 -
(2014): Metalle, die sich erinnern: Mit Formgedächtnis immer in der richtigen Fassung, Unimagazin 01/02 2014, S. 30-33
-
(2014): A method to detect the level and direction of mechanical forces with the aid of load-induced martensitic phase transformation, Prod. Eng. Res. Devel., vol 8, 63-72
-
(2014): Verbundbohrwerkzeug vereint Eigenschaftsvorteile der Fügepartner, Forum Schneidwerkzeug- und Schleiftechnik, Forum Schneidwerkzeug- und Schleiftechnik, 2014, 102-109
-
(2014): Active brazed ceramic cemented carbide compound drills for machining lamellar graphite cast iron, Prod. Eng. Res. Devel. (Production Engineering), 2014, vol. 8, 3
DOI: 10.1007/s11740-014-0547-x -
(2014): Texture and Mechanical Properties of AZ31 Magnesium Alloy Sheets Rolled of Blanks, Technology of Metals 2, S. 12-18
-
(2014): Mechanical Properties of AZ31 Alloy Sheets Deformed by Low-Cycle Reverse Bending, The Physics of Metals and Metallography 115 (1), S. 98-105
DOI: 10.1134/S0031918X14010037 -
(2014): EcoForge – Ressourceneffiziente Prozessketten für Hochleistungsbauteile , Schmiede Journal (2), S. 22-27
-
(2014): Analyse der Biofilmbildung auf kieferorthopädischen Apparaturen, ZWR - Das Deutsche Zahnärzteblatt 123, 2014 (05), 192-199
DOI: 10.1055/s-0034-1383514 -
(2014): Kurzer Prozess – Umformen und Härten, Technologie-Informationen, Innovation Niedersachsen, 2/2014, S. 7 More info
-
(2014): Microstructural evolution in the bonding zones of co-extruded aluminium/titanium, J Mater Sci, 2014, vol. 49, 2442-2455
DOI: 10.1007/s10853-013-7912-6 -
(2014): Joining with electrochemical support (ECUF): Cold pressure welding of copper, Journal of Materials Processing Technology, 2014, vol. 214, 2179–2187
DOI: http://dx.doi.org/10.1016/j.jmatprotec.2014.04.015 -
(2014): Non-destructive detection of weld seams in extruded aluminium profiles, In: Key Engineering Materials 585, S. 103–110.
-
(2014): EcoForge Energieeffiziente Prozesskette zur Herstellung von Hochleistungs-Schmiedebauteilen, HTM Journal of Heat Treatment and Materials, 69 (4), S. 209-219
DOI: 10.3139/105.110220 -
(2014): Interfacial adhesion of zirconia/veneer bilayers with different thermal characteristics, Dent. Mater. J. 33 (5), S. 583–590.
DOI: 10.4012/dmj.2013-181 -
(2014): Structural Evolution of Thin Lamellar Cementite during Cold Drawing of Eutectoid Steels, Procedia Engineering 2014 (81), S. 694–699
DOI: 10.1016/j.proeng.2014.10.062 -
(2014): Characterization of the interface of co-extruded asymmetric aluminum-titanium composite profiles, Materialwissenschaft und Werkstofftechnik, 2014, 45; S. 1054-1060
DOI: 10.1002/mawe.201400353 -
(2014): Formation and Properties of Mixed Ferritic-Martensitic Microstructures in the Air-Hardening Steel LH800, steel research int. 85 (9), S. 1340-1347
DOI: 10.1002/srin.201300420 -
(2014): Suitable Impact Parameters for High-Speed Joining and Influence on the Bonding Zone Microstructure, Journal of Materials Engineering and Performance 23 (3), S. 944-953
DOI: 10.1007/s11665-013-0845-z -
(2014): Digital image correlation at high temperatures for fatigue and phase transformation studies, The Journal of Strain Analysis for Engineering Design (49), S. 204-211
DOI: 10.1177/0309324713498737 -
(2014): Effect of thermal cycling on the martensitic transformation in Ni-Mn-In alloys, Journal of Applied Physics, 116; S. 103515
DOI: 10.1063/1.4895585 -
(2014): Thermal Cycling Behavior of an Aged FeNiCoAlTa Single-crystal Shape Memory Alloy, Scripta Materialia (81), S. 28–31
DOI: 10.1016/j.scriptamat.2014.02.020 -
(2014): Microstructural and Tribological Characterization of Atmospheric Plasma-Nitrided HS6-5-2C Tool Steel, Applied Mechanics and Materials, 2014, 698; S. 345-350
DOI: 10.4028/www.scientific.net/AMM.698.345 -
(2014): Thermal anti-oxidation treatment of CrNi-steels as studied by EXAFS in reflection mode: the influence of monosilane additions in the gas atmosphere of a continuous annealing furnace, Journal of Material Science, 49, 2014, 5454-5461
DOI: 10.1007/s10853-014-8257-5 -
(2014): Geometric adaption of biodegradable magnesium alloy scaffolds to stabilise bio-logical myocardial grafts. Part I, Journal of Materials Science: Materials in Medicine (Springer Verlag), Volume 25, S. 909-916 More info
DOI: 10.1007/s10856-013-5100-5 -
(2014): Sandwich rolling of twin-roll cast aluminium-steel clad strips, Procedia Engineering 2014 (81) S. 1541-1546
DOI: 10.1016/j.proeng.2014.10.187 -
(2014): Setting Discrete Yield-stress Sensors for Recording Early Component Loading Using Eddy-current Array Technology and Induction Thermography, Procedia Technology (15), S. 484–493
DOI: 10.1016/j.protcy.2014.09.008 -
(2014): Characterisation of electron beams generated by a plasma cathode gun, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 242-248, ISSN: 0861-4717
-
(2014): On the functional degradation of binary titanium–tantalum high-temperature shape memory alloys — A new concept for fatigue life extension, Funct. Mater. Lett.; 2014
DOI: 10.1142/S1793604714500428 -
(2014): Functional and structural fatigue of titanium tantalum high temperature shape memory alloys (HT SMAs), Materials Science and Engineering: A (620), S. 359-366
DOI: 10.1016/j.msea.2014.10.038 -
(2014): Spray cooling of extruded EN AW-6082 aluminium alloy sheets: spatial heat transfer coefficients, Forsch Ingenieurwes 78 (1-2), S. 1-7
DOI: 10.1007/s10010-014-0181-y -
(2014): Twin Migration in Fe-based BCC Crystals: Theory and Experiments, Philosophical Magazine, 2014, vol. 94:16, 1816-1840
DOI: http://dx.doi.org/10.1080/14786435.2014.898123 -
(2014): Cyclic Degradation Mechanisms in Aged FeNiCoAlTa Shape Memory Single Crystals, Acta Materialia 79, S. 126-137
DOI: http://dx.doi.org/10.1016/j.actamat.2014.06.019 -
(2014): Two-way Shape Memory Effect in Ferromagnetic Co₃₅Ni₃₅Al₃₀ Single Crystals Aged Under Stress, Scripta Materialia, 2014, Vol. 90-91, S. 10-13
DOI: 10.1016/j.scriptamat.2014.06.034 -
(2014): Complex Investigations of the Influence of Low Cycle Sign-Variable Bending on the Mechanical Properties of Magnesium Alloy AZ31 Sheet , Plastic Deformation of Metals 1, S. 23-27
-
(2014): Joining with electrochemical support: cold pressure welding of copper – weld formation and characterization, Advanced Materials Research, 2014, vol. 966-967, 453-460
DOI: 10.4028/www.scientific.net/AMR.966-967.453 -
(2014): In vivo degradation effects of alloy MgNd2 in contact with mucous tissue, Journal of biomedical materials research. Part A.
DOI: 10.1002/jbm.a.35382 -
(2014): Effect of Reverse Bending on Texture, Structure and Mechanical Properties of Sheets of Magnesium Alloys with Zinc and Zirconium, The Physics of Metals and Metallography 115 (6), S. 609-616
DOI: 10.1134/S0031918X1406012X -
(2014): Composite wires for flux-free arc brazing, WIRE – English edition of the magazine for the spring, wire and cable industry, 64 (1), S. 62-64
-
(2014): Zusatzwerkstoffe zum Lichtbogen-Hartlöten, DRAHT – Deutsche Ausgabe der Zeitschrift für die Feder-, Draht- und Kabelindustrie 65 (2), S. 72-74
-
(2014): Non-vacuum electron beam cutting - A new high performance process, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 303-309, ISSN: 0861-4717
-
(2014): Systematische Untersuchung zum nassen Lichtbogenschweißen unter Wasser mit umhüllten Stabelektroden, Schweißen und Schneiden, 2014, vol. 66, 05, 250-256 More info
-
(2014): On the Role of Slip - Twin Interactions on the Impact Behavior of High-Manganese Austenitic Steels, Mater. Sci. Eng. A., vol. 593, 120–126.
-
(2014): New design and construction of expandable casing tubes, Forschung im Ingenieurwesen 78 (3-4), S. 145-149 More info
-
(2014): Dislocation slip stress prediction in shape memory alloys, International Journal of Plasticity 54, S. 247–266
DOI: 10.1016/j.ijplas.2013.08.017 -
(2014): Novel magnesium alloy Mg-2La caused no cytotoxic effects on cells in physiological conditions, Materials science & engineering. C, Materials for biological applications 41, S. 267–273
DOI: 10.1016/j.msec.2014.04.063 -
(2014): The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloys, IJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
DOI: 10.3139/146.111022 -
(2013): Fatigue crack initiation in Hastelloy X - the role of boundaries, Fatigue & Fracture of Engineering Materials & Structures, 2013, 36 (8); 809-826.
DOI: 10.1111/ffe.12048 -
(2013): Increased accumulation of magnetic nanoparticles by magnetizable implant materials for the treatment of implant-associated complications, Journal of nanobiotechnology 11, S. 34
DOI: 10.1186/1477-3155-11-34 -
(2013): Magnesium‐based bone implants: Immunohistochemical analysis of peri‐implant osteogenesis by evaluation of osteopontin and osteocalcin expression, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.34828/full.
-
(2013): Influence of Heat Treatment on the Degradation Behaviour of Degradable Magnesium Based Implants, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4057/bmt-2013-4057.xml.
-
(2013): Die Qualität im Blick: Der Bainitsensor ermöglicht Einblicke in die Werkstoffumwandlung, phi - Produktionstechnik Hannover informiert, S. 6-7
-
(2013): Modeling Fatigue Crack Growth Resistance of Nanocrystalline Alloys, In: Acta Materialia 61, S. 2531–2547
-
(2013): Experimental characterization of microstructure development during loading path changes in bcc sheet steels, In: Journal of Materials Science 48 (2), S. 674–689
-
(2013): Biocompatibility of fluoride-coated magnesiumcalcium alloys with optimized degradation kinetics in a subcutaneous mouse model, In: J Biomed Mater Res Part A 101A, S. 33–43
-
(2013): The Biodegradable Magnesium Stent as an Alternative Treatment in Cases of chronic Ventilation Disorders of the Paranasal Sinuses, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4049/bmt-2013-4049.xml.
-
(2013): Laserbeschriftung von Hartferritmagneten zur Kennzeichnung von Druckgussteilen, In: Forschung im Ingenieurwesen 77 (1), S. 39–47. Online verfügbar unter http://link.springer.com/content/pdf/10.1007%2Fs10010-013-0161-7.pdf
-
(2013): Twin-roll casting of aluminum–steel clad strips, In: Journal of Manufacturing Processes 15 (4), S. 501–507.
-
(2013): Influence of Hot Deformation on Mechanical Properties and Microstructure of a Twin-Roll Cast Aluminium Alloy EN AW-6082, Journal of Materials Engineering and Performance 23 (3), S. 937-943 More info
DOI: 10.1007/s11665-013-0816-4 -
(2013): Evaluation of the biocompatibility of two magnesium alloys as degradable implant materials in comparison to titanium as non‐resorbable material in the rabbit, In: Materials Science and Engineering: C 33 (1), S. 317–326. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0928493112004237#.
-
(2013): Economical joining of tubular steel towers for wind turbines employing non-vacuum electron beam welding for high-strength steels in comarsion with sub-merged arc welding, In: Welding in the World. Online verfügbar unter http://www.springerlink.com/openurl.asp?genre=article&id=doi:10.1007/s40194-013-0050-6.
-
(2013): Nonvacuum electron beam cutting and welding—two partnering processes for fast and highly efficient metal working, In: Welding in the World 57 (3), S. 315–322. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs40194-013-0032-8.
-
(2013): Topographieoptimierende Präparation metallischer Werkstoffverbunde, In: Praktische Metallographie / Practical Metallography 50 (7), S. 491–500. Online verfügbar unter http://www.practical-metallography.com/PM110242.
-
(2013): Distribution of Microdefects in Sheets of St1.03-12 Low-Carbon Steel in Tension at Different Rates, Materials Science, Vol. 49, Nr. 2, S. 199–205
DOI: 10.1007/s11003-013-9599-x -
(2013): Korrosionsverhalten binärer Magnesium-Zink-Legierungen in salzhaltigen Medien, In: Materialwissenschaft und Werkstofftechnik 44 (1), S. 84–93.
-
(2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und Verschleißbeanspruchungen, In: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract
-
(2013): Verbund-Gießschmieden hybrider Aluminiumbauteile, Mat.-wiss. u. Werkstofftech. (Materialwissenschaft und Werkstofftechnik), S. 819-824
DOI: 10.1002/mawe.201300125 -
(2013): Inconel 939 Processed by Selective Laser Melting: Effect of Microstructure and Temperature on the Mechanical Properties Under Static and Cyclic Loading, In: Materials Science and Engineering A 588, S. 188–195.
-
(2013): Effects of Nanoprecipitation on the Shape Memory and Material Properties of an Ni-rich NiTiHf High Temperature Shape Memory Alloy, In: Acta Materialia 61, S. 7422–7431.
-
(2013): Influence of Cobalt on the Properties of Load-Sensitive Magnesium Alloys, In: Sensors 13, S. 106–118. Online verfügbar unter http://www.mdpi.com/1424-8220/13/1/106/.
-
(2013): Strong and tough magnesium wire reinforced phosphate cement composites for load-bearing bone replacement, In: Journal of the Mechanical Behavior of Biomedical Materials 20, S. 36–44.
-
(2013): Laser Induced Surface Nano-structuring of Ti-6Al-4V for Adhesive Bonding, In: Int. J. Adhesion & Adhesives 45, S. 112–117.
-
(2013): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: J Mater Sci: Mater Med 24, S. 417–436
-
(2013): Texture development and formability prediction for pre-textured cold rolled body-centred cubic steel, In: International Journal of Engineering Science 68 (July 2013), S. 24–37
DOI: 10.1016/j.ijengsci.2013.03.003 -
(2013): Annealing Behavior of Ultrafine Grained Structure in Low-carbon Steel Produced by Equal Channel Angular Pressing, In: Mater. Sci. Eng. A 581, S. 104–107
-
(2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von Turbinenschaufeln, In: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
-
(2013): Water-Air Spray Cooling of Extruded Profiles: Process Integrated Heat Treatment of the Alloy EN AW-6082, Journal of Materials Engineering and Performance 22, 2013 (9), 2580-2587
-
(2013): Polymer-bioceramic composite coatings on magnesium for biomaterial applications, In: Surface and Coatings Technology 236 (15), S. 420–428. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0257897213009638.
-
(2013): A numerical investigation of the interplay between cohesive cracking and plasticity in polycrystalline materials, In: Computational Materials Science 77, S. 81–92.
-
(2013): Creep Deformation and Mechanisms in Haynes 230 at 800 °C and 900 °C, In: J Nuclear Materials 443, S. 484–490.
-
(2013): Slip transmission in bcc FeCr polycrystal, Materials Science & Engineering A, 588 (2013); 308–317.
DOI: 10.1016/j.msea.2013.08.050 -
(2013): Degrading magnesium screws ZEK100: biomechanical testing, degradation analysis and soft-tissue biocompatibility in a rabbit model, In: Biomedical Materials 8 (4).
-
(2013): Assessment of cellular reactions to magnesium as implant material in comparison to titanium and to glyconate using the mouse tail model, In: JABFM 11 (2), S. 89–94.
-
(2013): Non-destructive determination of local damage and material condition in high-performance components, HTM (HTM Journal of Heat Treatment and Materials), S. 59-67
DOI: 10.3139/105.110176 -
(2013): Modeling of Spray Cooling during Induction Hardening of Spur Gearwheels Made from 42CrMo4 Hardening and Tempering Steel, Steel Research Int. 85 (5), S. 741-755
DOI: 10.1002/srin.201300201 -
(2013): Tempering Induction Hardened 42CrMo4 Steel Helical Gearwheels from Residual Heat Using Spray Cooling, steel research int. 85 (3), S. 415-425
DOI: 10.1002/srin.201300133 -
(2013): Microstructure evolution of the air-hardening steel LH800 due to heat treatment, In: Journal of Heat Treatment and Materials 68 (1), S. 42–48
-
(2013): In vivo degradation of magnesium alloy LA63 scaffolds for temporary stabilisation of biological myocardial grafts in a swine model, In: Biomedical Engineering/Biomedizinische Technik 58 (5), S. 407–416.
-
(2013): Partial Joining of Blanks with Electrochemical Support (ECUF), In: Key Engineering Materials 554-557, S. 1091–1095.
-
(2013): Magnesium Degradation Products: Effects on Tissue and Human Metabolism, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.35023/full.
-
(2013): MgNd2 : A Future Resorbable Magnesium-Based Implant Material?, In: Emerging Materials Research 2 (5), S. 239–247. Online verfügbar unter http://www.icevirtuallibrary.com/content/article/10.1680/emr.13.00034.
-
(2013): The effects of handling and storage on magnesium based implants — First results, In: Materials Science and Engineering: C 33 (5), S. 3010–3017.
-
(2013): Influence of the grain size on the in vivo degradation behaviour of the magnesium alloy LAE442, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Enginee-ring in Medicine 227 (3), S. 317–326.
-
(2013): Biodegradable magnesium implants for orthopedic applications, In: Journal of Materials Science 48 (1), S. 39–50. Online verfügbar unter http://www.springerlink.com/content/n33l6487g9388578/.
DOI: 10.1007/s10853-012-6572-2 -
(2013): Comparative in vitro study and biomechanical testing of two different magnesium alloys, Journal of Biomedical Applications 28, 2013 (8), 1264-1273
DOI: 10.1177/0885328213506758 -
(2013): Applicability of Degradable Magnesium LAE442 Alloy Plate-Screw-Systems in a Rabbit Model, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4059/bmt-2013-4059.xml.
-
(2013): Grain refining of aluminium alloys and silicon by means of boron-nitride particles, International Journal of Material Research (IJMR), S. 266-274
DOI: 10.3139/146.110866 -
(2012): Oberflächenveredelung durch Metall-Kapillardruckgießen, In: Mikroproduktion 2012/03, S. 62–67
-
(2012): Numerische Berechnung einer integrierten Wärmebehandlung für präzisionsge-schmiedete Bauteile, In: Journal of Heat Treatment and Materials 67, S. 337–343. Online verfügbar unter http://www.htm-journal.de/HT110156.
-
(2012): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK. Ein Überblick zum Abschluss des Projektes, Atw. Internationale Zeitschrift für Kernenergie 57, 2012 (4), 250-254
-
(2012): Effect of reversed bending on texture, structure and mechanical properties of low-carbon steels, In: Technologija Metallov (Technology of metals) (11), S. 19–24.
-
(2012): Long Term In Vivo Degradation Behaviour and Biocompatibility of the Magnesium Alloy ZEK100 for Use as Biodegradable Bone Implant, In: Acta Biomaterialia. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112004047
DOI: 10.1016/j.actbio.2012.08.028 -
(2012): Extrusion of hybrid sheet metals, Journal of Materials Processing Tech. 212 (2012), pp. 1030-1038 (Final version published online 18. Feb 2012)
DOI: 10.1016/j.jmatprotec.2011.12.013
ISBN: 0924-0136 -
(2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma Spraying, Journal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/
-
(2012): Preparation Routine for In Situ Strain Analysis of deep drawing Steel DC04 by Means of Transmission Electron Microscopy, In: Praktische Metallographie 2012 (9), S. 577–587
-
(2012): Investigation of ductile damage development in ferritic steel subject to uniaxial deformation, In: Fatigue & Fracture of Engineering Materials & Structures 35 (10), S. 936–942. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1111/j.1460-2695.2012.01679.x/full.
-
(2012): Analiz parametrov vodo-vozdušnogo sprejernogo ohlaždeniâ metalla v integrirovannyh tehnologičeskih processah, Metallurgičeskaja i gornorudnaja promyšlennost' 7, 2012, 208-212
-
(2012): Analiz izmeneniya temperatury metalla pri osevom vodovozdushnom spreyernom okhlazhdenii stalnykh tsilindricheskikh obraztsov, Metallurgičeskaja i gornorudnaja promyšlennost' 6, 2012, 33-39
-
(2012): Features of austenitic steels’ microstructure following plastic deformation, Materialwissenschaft und Werkstofftechnik, 43, (2012), No. 3
-
(2012): Increase the deformability of NiCo single crystals using of electrical pulse-like currents, Key Engineering Materials, 504-506, 143
DOI: 10.4028/www.scientific.net/KEM.504-506.143 -
(2012): Investigation of the Water-Air Cooling Process of the Thick-Walled Extruded Profile Made of Alloy AW-6060 on the Output Table, Metallurgical and mining industry 4 (2), S. 66–74
-
(2012): Issledovanie processa vodo-vozdušnogo ohlaždeniâ tolstostennogo pressovannogo profilâ iz splava EN AW-6060 na vyhodnom stole, In: Metallurgičeskaja i gornorudnaja promyšlennost' (2), S. 33–38
-
(2012): Influence of Cold Forming and Heat Treatment on the Microstructure and Mechani-cal Properties of an Air-Hardening Steel, In: Steel Research International 83 (11), S. 1020–1028. More info
-
(2012): Research on the Biocompatibility of the New Magnesium Alloy LANd442—An In Vivo Study in the Rabbit Tibia over 26 Weeks, Adv. Eng. Mater.; 14; pp. B28–B37
-
(2012): Sensorkontrolliertes Bainitisieren im Spraydüsenfeld, GWI Gaswärme International, 3, pp. 77-85
-
(2012): Influence of Aluminium on the Corrosion Behaviour of Binary Magnesium-Aluminium Alloys in Saline Solutions, Materials and Corrosion, DOI: 10.1002/maco.201206531
-
(2012): Einfluss der Oberflächenbehandlung auf das Korrosionsverhalten von Magnesiumlegierungen, In: Materialwissenschaft und Werkstofftechnik 43 (12), S. 1067–1073
-
(2012): In vivo assessment of the host reactions to the biodegra-dation of the two novel magnesium alloys ZEK100 and AX30 in an animal model, BioMedical Engineering OnLine; Vol.11 Iss. 14
-
(2012): Experimental and Numerical Investigations on Metal Flow during Direct Extrusion of EN AW-6082, Key Engineering Materials Vol. 491 (2012) pp 137-144
-
(2012): On the Improvement of Formability and the Prediction of Forming Limit Diagrams at Fracture by Means of Constitutive Modelling, KEM (Key Engineering Materials), S. 29-34
DOI: 10.4028/www.scientific.net/KEM.504-506.29 -
(2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing Processes, In: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.
-
(2012): Ressourceneffizienz bei der Herstellung von dichtereduzierten Stählen mit dem Bandgießverfahren, In: Chemie Ingenieur Technik 84 (10), S. 1740–1748. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/cite.201200061/abstract.
-
(2012): Magnetic Magnesium Alloys Based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 14, 1-2 S. 28-34
-
(2012): Mit magnetischen Legierungen werden ganze Bauteile zu Sensoren, In: Maschinenmarkt (39), S. 62–65. Online verfügbar unter http://www.maschinenmarkt.vogel.de/themenkanaele/konstruktion/werkstoffe/articles/379106/.
-
(2012): Casting Process and Comparison of the Properties of Adapted Load-Sensitive Magnesium Alloys, In: Production Engineering Research & Development. Online verfügbar unter http://link.springer.com/article/10.1007/s11740-012-0413-7.
-
(2012): Low-temperature degradation of different zirconia ceramics for dental applications , In: Acta Biomaterialia 8 (3), S. 1213–1220. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706111005034.
-
(2012): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: Journal of Materials Science: Materials in Medicine. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs10856-012-4812-2?LI=true.
-
(2012): Material Model Identification for DC04 Based on the Numerical Modelling of the Polycrystalline Microstructure and Experimental Data, Key Engineering Materials 504-506 pp.993–998
-
(2012): A Comparative Study of the Cytotoxicity and Corrosion Resistance of Nickel--titanium and Titanium-niobium Shape Memory Alloys, In: Acta Biomaterialia 8, S. 2863–2870
-
(2012): Numerical investigation of in situ TEM tensile tests, In: Metallurgical and mining industry 4 (4), S. 37–44
-
(2012): Investigation of the surface residual stresses in spray cooled induction hardened gearwheels, International Journal of Materials Research, Vol. 103, Nr. 1, pp. 73-79
DOI: 10.3139/146.110622 -
(2012): Stahlerzeugung am laufenden Band: Ressourcensparendes Walzgießen, In: Phi – Produktionstechnik Hannover informiert 13 (2), S. 16–17.
-
(2012): Neue Nickelhartlote für den Schutzgasdurchlaufofen, Schweissen und Schneiden 6 (64), S. 326–330
-
(2012): Application of a Bioactive Coating on Resorbable, Neodymium Containing Magnesium Alloys, and Analyses of their Effects on the In Vitro Degradation Behavior in a Simulated Body Fluid, Advanced Engineering Materials; DOI: 10.1002/adem.201180078; http://onlinelibrary.wiley.com/doi/10.1002/adem.201180078/full
-
(2012): Characterization of MgNd2 alloy for potential applications in bioresorbable implantable devices, In: Acta Biomaterialia 8 (10), S. 3852–3864. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112002371
-
(2012): Reverse Bending Effect on the Texture, Structure, and Mechanical Properties of Sheet Copper, In: The Physics of Metals and Metallography 112 (8), S. 810–816.
-
(2012): An investigation of the blanking process of the quenchable boron alloyed steel 22MnB5 before and after hot stamping process, Journal of Materials Processing Technology 212 (2012), 437– 449
DOI: 10.1016/j.jmatprotec.2011.10.006 -
(2012): Vlijanie bokovyh ogranichitelei na formirovanie tonkih polos pri valkovoi razlivke-prokatke, In: Metallurgiceskaja i gornorudnaja promyvlennost' 277 (5), S. 32–36
-
(2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von Aluminiumlegierungen, In: Schweißen und Schneiden 64 (8), S. 490–496.
-
(2012): Influence of reversed bending on texture, strcture and mechanical properties of α-titanium sheets, In: Deformation and Fracture of Materials (Deformatsiya I Razrushenie materialov) (9), S. 32–37.
-
(2012): Grain refining of aluminium alloys and silicon by means of boron nitride particles, In: International Journal of Material Research (IJMR). Online verfügbar unter http://www.ijmr.de/web/o_archiv.asp?ps=MK110866&task=03&o_id=25112811648-50.
-
(2012): Modeling the relationship between hardness and spray cooling parameters for pinion shafts using a neuro-fuzzy model strategy, In: Journal of Heat Treatment and Materials 67 (1), S. 39–47.
-
(2012): Repair Preparation of Fiber-Reinforced Plastics by the Machining of a Stepped Peripheral Zone, In: Journal of Mechanical Engineering 58 (10), S. 571–577.
-
(2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnaces, International Journal of Materials Research 2011/08, pp. 964-971
DOI: 10.3139/146.110549 -
(2011): Process Principle for the Production of Sintered Dynamic Component-inherent Data Storage, Production Engineering Vol. 5, Nr. 3, S. 233-240, 2011. More info
DOI: 10.1007/s11740-010-0290-x -
(2011): Acoustic Process Monitoring during Transient Precision Forging of High Strength Components., Metallurgical and mining industry 3 (7), S. 91–97.
-
(2011): Phenomenological modeling of anisotropy induced by evolution of the dislocation structure on the macroscopic and microscopic scale, International Journal of Material Forming, 2011.
DOI: 10.1007/s12289-010-1017-4 -
(2011): Prozessoptimiertes Presshärten mittels Sprühkühlung – prozessintegrierte Wärme-behandlung von Blechen des Werkstoffes 22MnB5, In: HTM - Journal of Heat Treatment and Materials 2011 (6), S. 316–322. Online verfügbar unter http://www.htm-journal.de/HT110118
-
(2011): Comparative analysis of supra- and subgingival biofilm formation on polytetrafluorethylene and titanium surfaces of implant abutments., Int J. Prosthodontics (24), S. 373–375.
-
(2011): Mikrostrukturelle Pressschweißnahtcharakterisierung im strangpressten Zustand für Al-Mg-Si-Legierungen: Microstructural weld seam characterisation in the as extruded condition for Al-Mg-Si-alloys, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 531-541, 2011.
-
(2011): Das Institut für Werkstoffkunde der Leibniz Universität Hannover stellt seinen Bereich FORTIS vor, Thermal Spray Bulletin, Nr. 4/11, S. 14-19, 2011.
-
(2011): Präparations- und Analysestrategie zur Untersuchung verformungsinduzierter Poren in kaltverfomtem Stahl, Praktische Metallographie Vol. 48, Nr. 5, S. 232-238, 2011.
-
(2011): Correlation of temperature-speed extrusion parameters; tool design and quality of profiles of magnesium alloys, Metallurgical and mining industry 3, 2011 (7), 23-31
-
(2011): Mit Spraykühlung Ressourcen schonen , Phi – Produktionstechnik Hannover informiert 2/2011, S. 12-13
-
(2011): Economic surface hardening by spray cooling, HTM - Journal of Heat Treatment and Materials 66 (5), S. 290–296.
-
(2011): Modification of the mechanical anisotropy in extrudet AZ31 sheets, Key Engineering Materials Vol. 473, S. 490-497, 2011.
-
(2011): Twin-roll casting of high-strength age-hardened aluminium alloys., Metallurgical and mining industry 7 (3), S. 7–16.
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell, Biomaterialien; 12; 1-4; S. 51
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell., Biomaterialien 12 (1-4), S. 51.
-
(2011): Structure and properties of beaded welds created under water by power wire, Obrabotka Metallov 50 (1), S. 31–37
-
(2011): Investigation of the influence of low cycle bending on the properties of thin sheets, International Aluminium Journal Vol. 87, Nr. 7-8, S. 60-62, 2011.
-
(2011): Investigation of the influence of low cycle alternating bending loads on the properties of thin sheets possessing different crystal lattice structures, Metallurgical and mining industry 3 (7), S. 69–73
-
(2011): Einsatz innovativer Fügetechnologien und korrosionsschutzgerechter Designs an 200-l-Gebinden zur sicheren Lagerung schwach- und mittelradioaktiver Abfälle, atw-International Journal for Nuclear Power 56 (10), S. 553–558
-
(2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structures, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
-
(2011): Novel Repair Concept for Composite Materials by Repetitive Geometrical Interlock Elements, Materials 2011, 4; pp. 2219-2230.
-
(2011): Magnetic Magnesium Alloys based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 13, S. 1-7
DOI: 10.1002/adem.201100197 -
(2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die Druckindustrie, In: Thermal Spray Bulletin 4 (2), S. 114–120.
-
(2011): Comparative analysis of long-term biofilm formation on metal and ceramic brackets , Angle Orthodontist, 81-5, S. 907-914
-
(2011): Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2, Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
-
(2011): The multi-scale physical and numerical modeling of fracture phenomena in the MgCa0.8 alloy, Computers & Structures 89, S. 1038–1049
-
(2011): The development with help of boundary element method, calibration and verifica-tion of the model of fracture of special magnesium alloys in microscale, In: Rudy i metale niezelazne 56 (11), S. 581–587
-
(2011): Schneiden und Schweißen von Kupfer mit dem Elektronenstrahl, Metall - Internationalle Fachzeitschrift für Metallurgie 65 (11), S. 507–511
-
(2011): Microstructural Behaviour of Tempering Steels during Precision Forging and Quenching from Hot-forming Temperatures, Metallurgical and Mining Industry, 2011, Vol. 3, No. 7, S. 79-86
-
(2011): Process Design for the Manufacturing of Magnetic Pulse Welded Joints, Key Engineering Materials Vol. 473, S. 243-250, 2011.
DOI: 10.4028/www.scientific.net/KEM.473.243 -
(2011): Orts- und temperaturabhängige Wärmeübergangskoeffizienten bei der Sprühkühlung von AlSi10Mg-Gussplatten, Forschung im Ingenieurwesen Vol. 75, Nr. 1, S. 25-34, 2011.
DOI: 10.1007/s10010-011-0131x -
(2011): Induction hardening of spur gearwheels made from 42CrMo4 hardening and tempering steel by employing spray cooling, Steel Research International Vol. 82, Nr. 4, S. 329-336, 2011.
DOI: 10.1002/srin.201000218 -
(2011): Sheet-bulk Metal Forming a New Process for the Production of Sheet Metal Parts with Functional Components, In: Metallurgical and mining industry 3 (7), S. 53–58.
-
(2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und Schneidwerkzeugen, Info-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
-
(2011): Ex vivo examination of the biocompatibility of biodegradable magnesium via microdialysis in the isolated perfused bovine udder model, Int. J. Artif. Organs Vol. 34, Nr. 1, S. 34-43, 2011.
-
(2011): Front Cover Advanced Materials 12/2011, Advanced Engineering Materials; Vol. 13; Iss. 12; http://onlinelibrary.wiley.com/doi/10.1002/adem.201190032/abstract; doi: 10.1002/adem.201190032
-
(2011): The Effect of Different Sterilization Methods on the Mechanical Strength of Magnesium Based Implant Materials, Advanced Engineering Materials.
DOI: 10.1002/adem.201100074 -
(2011): Comparison of the Corrosion Behavior of Coated and Uncoated Magnesium Alloys in an In Vitro Corrosion Environment, Advanced Engineering Materials
DOI: 10.1002/adem.201080144 -
(2011): Designentwicklung für einen resorbierbaren Magnesiumstent für die Nasennebenhöhlen, Biomaterialien 12 (1-4), S. 183
-
(2011): The manufacture of resorbable suture material from magnesium - drawning and stranding of thin wires, Advanced Engineering Materials 13, 2011, S. 1087-1095
DOI: 10.1002/adem.201100152 -
(2011): An Experimental and Numerical Assessment of Sheet-Bulk Formability of Mild Steel DC04, Journal of Manufacturing Science and Engineering 133 (6). Online verfügbar unter http://link.aip.org/link/?MAE/133/061008 More info
-
(2011): Influence of reactive process gases on zinc solders on aluminium and steel, Welding and Cutting 10 (5), S. 314–317
-
(2011): In Vivo Degradation Behavoir of the Magnesium Alloy LAN442 in Rabbit Tibiae, Materials, 4; 12; P. 2197
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, Uni Magazin (01|02 2011), S. 48–51
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, AlumniCampus (6), S. 32–35
-
(2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloy, Journal of Materials Science, Doi: 10.1007/s10853-011-5785-0
-
(2010): Friction and Temperature Development in the Hot Roll Cladding Process, Steel Research International Vol. 81, Nr. 1, S. 48-54, 2010.
-
(2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnaces, Key Engineering Materials, Nr. 438, S. 73-80, 2010.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn, Schweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
-
(2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfaces, Key Engineering Materials, Nr. 438, S. 123-129, 2010.
-
(2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus Leichtmetalllegierungen, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
-
(2010): Computation of isothermal transformation diagrams of 42CrMo4 steel from dilatometer measurements with continuous cooling., International Heat Treatment and Surface Engineering Vol. 4, Nr. 4, S. 171-175, 2010.
-
(2010): In vitro und in vivo Modelle zur molekularen Evaluierung der zellulären Reaktionen auf Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 19-21. Berlin: Walter de Gruyter, 2010.
-
(2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-Schneidstempelinlays, UTF science, Nr. III, S. 1-12, 2010.
-
(2010): Influence of hydrothermal and mechanical conditions on the strength of zirconia, Acta Biomaterialia Vol. 2010, Nr. 6, S. 4547-4552, 2010.
-
(2010): Anisotropy of Mechanical Properties of Magnesium Alloy AZ31 Sheets as a Result of Sign-Variable Bending Deformation, Metallurgical and Mining Industry. Vol. 2, Nr. 3, S. 215-219, 2010.
-
(2010): Vlijanie deformacii znakoperemennym izgibom na teksturu i anizotropiju uprugich svojstv listov nizkouglerodistoj stali, Materialovedenie Vol. 163, Nr. 10, S. 33-38, 2010.
-
(2010): Vlijanie cholodnoj pravki na teksturu i anizotropiju svojstv listov magnievogo splava AZ31, Deformacija i razruvenie, Nr. 8, S. 34-41, 2010.
-
(2010): Extrusion and Air-Water Cooling of AlSi1MgMn Alloy Extruded Profiles, Metallurgical and mining industry 2, 2010 (5), 355-362
-
(2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Galvanotechnik, Nr. 11, S. 2646-2650, 2010.
-
(2010): Reduction of biofilm on orthodontic brackets by use of a polytetrafluorethylene (PTFE) coating, European Journal of Orthodontics, Nr. 32, S. 414-418, 2010.
-
(2010): Setting of Gradient Material Properties and Quality Control of High Tension 3D NVEB-Weld Joints, Advanced Materials Research, Nr. 137, S. 375-411, 2010.
-
(2010): Development and biocompatibility of a novel corrodible fluoride-coated magnesium-calcium alloy with improved degradation kinetics and adequate mechanical properties for cardiovascular applications., Journal of Biomedical Materials Research Part A 93A (2), S. 763–775.
-
(2010): Suspension Plasma Spraying of triboactive coatings for high temperature applications, Key Engineering Materials, Nr. 438, S. 139-146, 2010.
-
(2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying process, Materialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
-
(2010): Mittendrin statt nur dabei: Die Werkstoffkunde, elementare Säule der Ingenieurwissenschaften, Phi Vol. 11, Nr. 2, S. 8-9, 2010.
-
(2010): The Possible Mechanism of Slip Band Formation, Sistemnye Technologii Vol. 70, Nr. 5, S. 162-166, 2010.
-
(2010): Untersuchung der mikrostrukturellen Werkstoffcharakteristik des Stahls DC06 bei der plastischen Umformung: Analysis on the micro structural material characteristic of the DC06 steel by the plastic deformation, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 10, S. 844-852, 2010.
-
(2010): Zerstörungsfreie Messmethoden zur Bestimmung des Warmauslagerungszustandes von Aluminiumlegierungen am Beispiel der Legierung EN AW-6082, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 8, S. 646-651, 2010.
-
(2010): Experimental twin-roll casting equipment for production of thin strips, Metallurgical and Mining Industry. Vol. 2, Nr. 5, S. 348-354, 2010.
-
(2010): Non-destructive, high-resolution 3D visualization of a cardiac defect in the chick embryo resembling complex heart defect in humans using Micro-Computed Tomography. Double outlet right ventricle (DORV) with left juxtaposition of atrial appendages (LJAA)., Circulation Vol. 122, Nr. 22, S. 561-564, 2010. More info
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, In: Key Engineering Materials 438, S. 147–154.
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, Key Engineering Materials Vol. 2010, Nr. 438, S. 147-154, 2010.
-
(2010): Einfluss einer alternierenden Biegebeanspruchung auf die mechanischen Eigenschaften der Magnesiumlegierung AZ31, Aluminium, Nr. 5, S. 55-58, 2010.
-
(2010): Comparison of the In Vivo Degradation Progress of Solid Magnesium Alloy Cylinders and Screw-Shaped Magnesium Alloy Cylinders in a Rabbit Model, Materials Science Forum, Nr. 638-642, S. 742-747, 2010.
-
(2010): The effect of two point mutations in GDF-5 on ectopic bone formation in a γ-tricalciumphosphate scaffold, Biomaterials Vol. 31, Nr. 14, S. 3878-3884, 2010.
-
(2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels Tomographie, Thermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
-
(2010): Kontrolliertes Bainitisieren trumpft in puncto Wirtschaftlichkeit auf, Maschinenmarkt, Nr. 24, S. 58-61, 2010.
-
(2010): Wirtschaftlich Bainitisieren mit neuem Wirbelstrom-Messsystem, Gaswärme International Vol. 59, Nr. 6, S. 472, 2010.
-
(2010): Degradation behaviour and mechanical properties of magnesium implants in rabbit tibiae., Journal of Materials Science (45), S. 624–632.
-
(2010): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach einer induktiven Hochgeschwindigkeitsaustenitisierung mit anschließendem Abschrecken, Journal of Heat Treatment and Materials Vol. 65, Nr. 2, S. 96-101, 2010.
-
(2010): Multi scale physical and numerical modelling of MgCa0,8 alloy tensile test in micro tensile/compression stage for a SEM, Computer Methods in Materials Science Vol. 10, Nr. 2, S. 61-68, 2010.
-
(2010): A model of ductility phenomena of MgCa0,8 alloy in cold forming process, Rudy i metale niezelazne Vol. 55, Nr. 4, S. 200-208, 2010.
-
(2010): Microstructure transformations in tempering steels during continuous cooling from hot forging temperatures, Steel Research Vol. 81, Nr. 3, S. 224-233, 2010.
-
(2010): Investigations into manufacturing composite profiles having local magnesium-foam reinforcements, Advanced Materials Research, Nr. 137, S. 129-160, 2010.
-
(2010): Simulation of gas and spray quenching during extrusion of aluminium alloys, Key Engineering Materials., Nr. 424, S. 57-64, 2010.
-
(2010): Der Forschungsverbund "Geothermie und Hochleistungsbohrtechnik", Geothermische Energie - Mitteilungsblatt des GtV-Bundesverbandes Geothermie e.V. Vol. 19, Nr. 68, S. 21-23, 2010.
-
(2010): Phase diagram of PMMA/PVDF-blends and effect of mixture-intensity on crystallization behavior, Polym. Mater. Sci. Eng, Nr. 239, S. 5951-5952, 2010.
-
(2010): Primäre porcine Nasenepithelzellen als Modell zur Untersuchung der Biokompatibilität von Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 79-81. Berlin: Walter de Gruyter, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, AlumniCampus, Nr. 4, S. 44-46, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, Unimagazin, Nr. 1, S. 48-50, 2010.
-
(2010): The Manufacture of Resorbable Suture Material from Magnesium, Advanced Engineering Materials Vol. 12, Nr. 11, S. 1099-1105, 2010.
-
(2010): Comparison of the Cross Sectional Area, the Loss in Volume and the Mechanical Properties of LAE442 and MgCa0.8 as Resorbable Magnesium Alloy Implants after 12 Months Implantation Duration, Materials Science Forum, Nr. 638-642, S. 675-680, 2010.
-
(2010): Development and application of magnetic magnesium for data storage in gentelligent products, Journal of Magnetism and Magnetic Materials Vol. 322, Nr. 9-12, S. 1134-1136, 2010.
-
(2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen Diamanten, Schweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
-
(2010): Izmenenie mechaniceskich svojstv lista iz splava AZ31 v rezul'tate rolikovoj pravki, Rolling, Nr. 1, S. 3-6, 2010.
-
(2009): Crystallization of supercooled silicon droplets initiated through small silicon nitride particles, Journal of Crystal Growth Vol. 311, Nr. 5, S. 1250-1255, 2009.
-
(2009): Nonvacuum electron beam welding of structural steels, The Paton Welding Journal, Vol. 2009, Nr. 5, pages 22-26.
-
(2009): Entfestigung von Blechen aus der Mg-Legierung AZ31 beim alternierenden Biegen, Deformation & Fracture of Materials, Nr. 5, 2009.
-
(2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im Schutzgasdurchlaufofen, INFO-SERVICE, Nr. 20, S. 16-19, 2009.
-
(2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im Schutzgasofen, INFO-SERVICE, Nr. 20, S. 6-11, 2009.
-
(2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle, Schweißen und Schneiden, Nr. 7, S. 358-368, 2009.
-
(2009): Gießformen mit Kapillareffekt, Gießerei-Erfahrungsaustausch, Nr. 3, S. 22-23. Düsseldorf: Gießerei-Verlag GmbH, 2009.
-
(2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und Korrosionsschutz, Thermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
-
(2009): Manufacturing of Reinforced High Precision Forging Dies, Steel Research International, Nr. 12, S. 878-886, 2009.
-
(2009): New Developments in Non-destructive Testing for Quality Assurance in Component Manufacturing, Steel research int Vol. 80, Nr. 12, S. 916-928, 2009.
-
(2009): Kleine Poren - große Wirkung: Magnesiumschwämme als bioresorbierbare Implantate, Orthopädie im Profil, Nr. 1, S. 14-15, 2009.
-
(2009): Analysis of supra- and subgingival long-term biofilm formation on orthodontic bands, European Journal of Orthodontics, Nr. 31, S. 202-206, 2009.
-
(2009): Surface Hardening Spline Geometries of Heat-Treatable Steel Cf53 using Water-Air Spray Cooling, Materials Working by Pressure - Collection of science papers Vol. 20, Nr. 1, S. 270-275, 2009.
-
(2009): Experimental research of pressing strips made of Mg-Al-Zn-Mn system alloy through precombustion chamber matrixes, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 255, Nr. 3, S. 88-91, 2009.
-
(2009): Das Zwei-in-einem-Prinzip. Integrierte Wärmebehandlung präzisionsgeschmiedeter Bauteile, Technologie-Informationen, Innovation Niedersachsen, Nr. 2, S. 10, 2009.
-
(2009): Manufacturing Surface Hardened Components of 42CrMo4 by Water-Air Spray Cooling, Steel Research International Vol. 80, Nr. 12, S. 906-915, 2009.
-
(2009): Verbundstrangpressen von Titan-Aluminium-Verbindungen, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 12, S. 901-906, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Magnesium-based Resorbable Implants on the Degradation Behaviour in Rabbits, Advanced Engineering Materials Vol. 11, Nr. 5, S. B47-B54, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Resorbable Magnesium Alloy Implants on Degradation: EDX-Analysis and Histology Results, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 88-93, 2009.
-
(2009): Im Fertigungsprozess lassen sich Bauteile spezifisch optimieren, Maschinenmarkt Vol. 44, S. 26-29, 2009.
-
(2009): In-situ high temperature microstructural analysis during tempering of 42CrMo4 using transmission electron microscopy, International Journal of Materials Research Vol. 2009, Nr. 7, S. 991-1000, 2009.
-
(2009): Multiscale modeling and interpretation of tensile test of magnesium alloy in microchamber for the SEM, Computer Methods in Materials Science Vol. 9, Nr. 2, S. 207-214, 2009.
-
(2009): Isothermal Microstructural Transformations of the Heat-treatable Steel 42CrMo4 during Heat-treatment following Hot-forming, Steel Research International Vol. 80, Nr. 12, S. 892-898, 2009.
-
(2009): Simulation of Integrated Heat-treatment of Precision Forged Components, Steel Research International Vol. 80, Nr. 12, S. 899-905, 2009.
-
(2009): Spray cooling of aluminium chassis frames, Sucasni problemy metalurhii Vol. 12, S. 92-99, 2009.
-
(2009): Prediction of continuous cooling diagrams for the precision forged tempering steel 50CrMo4 by means of artificial neural networks, Advances in Materials Science and Engineering, 2009.
-
(2009): Legierungsentwicklung zur Verschleißreduzierung von Schmiedegesenken -Einfluss von Mangan auf die Absenkung der Ac1b-Temperatur, HTM - Journal of Heat Treatment and Materials Vol. 64, Nr. 5, S. 291-296, 2009.
-
(2009): Eddy current technology - a new procedure for the detection of zero-gap grooves during laser welding, Welding and Cutting Vol. 8, Nr. 6, S. 359-364, 2009.
-
(2009): Experimentelle Untersuchungen der Mikrostrukturentwicklung und mechanischen Eigenschaften von Metallen mittels Zug/Druck/Biegemodul im Rasterelektronen-mikroskop, In: Praktische Metallographie 41 (Sonderband zur 43. Metallographie-Tagung), S. 139–144.
-
(2009): In Vitro Testing of Biodegradable Implants, Journal of Veterinary Pharmacology and Therapeutics Vol. 32, Nr. s1, S. 264-265, 2009.
-
(2009): In-Vitro Biocompatibility Testing of Degradable Magnesium-Based Alloys on Murine Fibroblasts L929, Naunyn-Schmiedeberg's Archives of Pharmacology Vol. 379, Nr. Suppl.1, S. 70, 2009.
-
(2009): Structure investigation of austenitic steel after cold rolling deformation, Sucasni problemy metalurhii Vol. 12, S. 107-113, 2009.
-
(2009): Wirbelstromtechnik - ein neues Verfahren zur Detektion von Nullspaltfugen bei Laserstrahlschweißen, Schweissen und Schneiden Vol. 61, Nr. 9, S. 520-527, 2009.
-
(2009): Scale-dependent hierarchy of structural elements in the microstructure of thermomechanical treated ferritic steels with residual austenite, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 9, S. 704-712, 2009.
-
(2009): Comparison of the resorbable magnesium alloys LAE442 und MgCa0.8 concerning their mechanical properties, their progress of degradation and the bone-implant-contact after 12 months implantation duration in a rabbit model, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 82-87, 2009.
-
(2009): Influence of a magnesium-fluoride coating of magnesium-based implants (MgCa0.8) on degradation in a rabbit model, Journal of Biomedical Materials Research, 2009.
-
(2009): Nanopartikel als Kornfeiner: Jahresbericht Produktionstechnisches Zentrum Hannover 2008, , S. 74, 2009.
-
(2009): Thermographic analysis of AlSi12 during crystallization as a function of cooling rate, International Journal of Materials Research Vol. 100, Nr. 1, S. 97-103, 2009.
-
(2009): Effect of alternating bending on the structure and properties of strips from AZ31 magnesium alloy, Metallovendenie Vol. 646, Nr. 4, S. 20-25, 2009.
-
(2008): Hybrides Walzen am Beispiel von Titan-Aluminium-Verbunden, Materialwissenschaft und Werkstofftechnik Vol. 39, Nr. 9, S. 588-593, 2008.
-
(2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Schweißen und Schneiden, Nr. 4, S. 192-199, 2008.
-
(2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
-
(2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten Pulvern, Schweißen und Schneiden, Nr. 11, S. 625-631, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
-
(2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal spraying, Thermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
-
(2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von Aluminiumwerkstoffen, Materialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
-
(2008): Verfahren zur Einbringung und Wiedergabe von Daten in Sinterbauteilen, Metall - Internationalle Fachzeitschrift für Metallurgie Vol. 62, Nr. 5, S. 298-301, 2008.
-
(2008): Investigation of Load Adapted Gears and Shafts Manufactured by Compound-Forging, Journal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
-
(2008): Analyse der Besonderheiten beim Strangpressen von bimetallischen Aluminium-Magnesium-Verbunden, Theorie und Praxis der Metallurgie, Nr. 5-6, S. 46-50, 2008.
-
(2008): Efficient Modelling and Simulation of Process Chains in Sheet Metal Forming and Processing, Steel Research International Vol. 79, Nr. 10, S. 731-737, 2008.
-
(2008): Supra- and subgingival biofilm formation on implant abutments with different surface characteristics, International Journal of Oral & Maxillofacial Implants Vol. 23, Nr. 2, S. 327-334, 2008.
-
(2008): Influence of the die geometry parameters on the quality of the aluminum thick -wall extruded strips, Herald of the DSEA, Nr. 3E (14), S. 27-39, 2008.
-
(2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Schweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
-
(2008): Analyse der initialen Biofilmbildung auf oberflächenmodifizierten Healing-Abutments, Deutsche Zahnärztliche Zeitschrift Vol. 63, Nr. 9, S. 632-638, 2008.
-
(2008): Einfluss verschiedener Implantate aus Magnesiumlegierungen auf den periostalen Knochenzuwachs in der Kaninchentibia, Biomaterialien Vol. 9, Nr. 1/2, S. 66, 2008.
-
(2008): Bainite Sensor - A new tool for process and quality control of the bainite transformation, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 3, S. 174-180, 2008.
-
(2008): Resorbierbare Marknägel auf Magnesiumbasis, Schweizer Maschinenmarkt, Nr. 1/2, S. 94-99, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Spraykühlung, HMT - Journal of Heat Treatment and Materials - Zeitschrift für Werkstoffe, Wärmebehandlung, Fertigung Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Sprühkühlung., HTM, Härterei-Technische Mitteilungen Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Wärmeübergangs- und Tropfencharakteristik für eine Spraykühlung im Temperaturbereich von 900 °C bis 100 °C, Forschung im Ingenieurwesen Vol. 72, Nr. 3, S. 163-173, 2008.
-
(2008): Herstellung von offenporigen Magnesium-Keramik-Implantaten, Biomaterialien Vol. 9, Nr. 3/4, S. 110, 2008.
-
(2008): Are resorbable implants about to become a reality? , Cardiology in the Young (16), S. 107–116.
-
(2008): The Manufacture and Characterisation of Reinforced Magnesium Foams, Steel Research International Vol. 79, Nr. 3, S. 185-190, 2008.
-
(2008): High Strength 3D Non-Vacuum Electron Beam Weld Joints - Setting of Gradient Material Properties and Testing of Weld Quality, Steel research int Vol. 79, Nr. 3, 2008.
-
(2008): Nachweis von Anrissen in der Randzone von Hochleistungsbauteilen mit Wirbelstromtechnik und induktiv angeregter Thermographie, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 5, S. 284-297, 2008.
-
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, Schweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
-
(2008): Einfluss einer Magnesiumfluoridbeschichtung auf die Degradation von MgCa0,8-Implantaten in vivo, Biomaterialien Vol. 9, Nr. 3/4, S. 99, 2008.
-
(2008): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, Schweissen und Schneiden Vol. 60, Nr. 4, S. 205-210, 2008.
-
(2007): Magnesium sponges as a bioabsorbable Material: Attributes and Challenges, Zeitschrift für Metallkunde: International Journal of Materials Research Vol. 98, Nr. 7, S. 609-612, 2007.
-
(2007): Developments for the Production of Locel Foamed Hollow Sections, Advanced Engineering Materials, Nr. 22, S. 37-47, 2007.
-
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folien, Schweißen und Schneiden, Nr. 2, S. 78-83, 2007.
-
(2007): Schneid- und Dekontiminationstechnologien für den kostengünstigen Rückbau kerntechnischer Anlagen, awt Vol. 52, Nr. 4, S. 256-262, 2007.
-
(2007): The FEM simulation of a magnesium alloy wire drawing for chirurgical applications, Hutnik - Polish Journal of Metallurgy Vol. 74, Nr. 1-2, S. 8-11, 2007.
-
(2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit Kupfer, Materialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
-
(2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal Composites, The Welding Journal, Nr. 86, S. 373-378, 2007.
-
(2007): Zerstörungsfreie Bestimmung von Härtekennwerten zur Qualitätssicherung von Hochleis-tungsbauteilen in der Fertigung, HTM - Journal of Heat Treatment and Materials Vol. 62, Nr. 6, S. 265-273, 2007.
-
(2007):