Journals
-
(2025): Advancing cold roll bonding efficiency by preceding XHV-adequate laser deoxidation, Manufacturing Letters, 2025, 44, 42-46
DOI: 10.1016/j.mfglet.2025.03.002 -
(2025): The influence of microstructure on the corrosion behavior of platinum used for cochlea implant electrodes, Corros. Sci. 246, 2025, 112745
DOI: 10.1016/j.corsci.2025.112745 -
(2025): Inverse determination of the thermal contact conductance for an interface between a Co28Cr6Mo hip stem and a PMMA-based bone cement, Scientific Reports, 2025, 15, 5328
DOI: 10.1038/s41598-025-89675-w -
(2025): Investigation of the influence of thermal overloads on mechanical properties of S500 high-strength structural steel using electromagnetic testing technology, Journal of Materials Research and Technology, 2025, 36, 4020–4030
DOI: 10.1016/j.jmrt.2025.04.121 -
(2025): Effect of heat treatment on nanoparticle reinforced Nb-18.7Si alloy, International Journal of Refractory Metals and Hard Materials, 130, 2025, 107170
DOI: 10.1016/j.ijrmhm.2025.107170 -
(2025): Low-cycle fatigue behavior and local deformation of friction welded and heat-treated steel-aluminum hybrid components, Journal of Materials Research and Technology 2025, 36, 8711–8723
DOI: 10.1016/j.jmrt.2025.05.119 -
(2025): Enhancing bearing lifespan with load‑adapted hybrid components via laser‑based directed energy deposition repair, Int. J. Adv. Manuf. Technol. 2025, 137, 11, 5521-5534
DOI: 10.1007/s00170-025-15480-4 -
(2025): Increasing the service life of electrodes for Contact Arc Metal Grinding using additively manufactured metal matrix composites, Wear, 2025, 578–579, 206150
DOI: 10.1016/j.wear.2025.206150 -
(2025): A preliminary assessment of the corrosion behavior of CoCrAlSi alloy as a potential orthopedic implant material, Journal of Materials Research, 2025
DOI: 10.1557/s43578-024-01514-2 -
(2025): Increasing the Corrosion Resistances of Arc-Sprayed Aluminium Coatings by Means of Oxygen-Free Process Control, Thermal Spray Bulletin, 2025, 1, 24-30
DOI: 10.53192/TSB20250124 -
(2025): Effects of severe ausforming on hierarchical microstructural development and mechanical performance in a martensitic high-strength steel, Materials Science and Engineering A, 2025, 939, 148337
DOI: 10.1016/j.msea.2025.148337 -
(2025): Detection of microstructural material changes due to hydrogen pressure atmosphere under cyclic load using eddy current testing, Nondestructive Testing and Evaluation, 2025, 1–16
DOI: 10.1080/10589759.2025.2483372 -
(2024): Corrosion Resistance and Fracture Toughness of Cryogenic-Treated X153CrMoV12 Tool Steel, HTM J. Heat Treatm. Mat., 79, 2024, 5, S. 230‒244
DOI: 10.1515/htm-2024-0023 -
(2024): Resource-efficient regeneration by generating a digital component image based on different NDT techniques, e-Journal of Nondestructive Testing, 2024
DOI: 10.58286/30035 -
(2024): Investigating mechanical deformation’s role in cochlear implant durability, PLOS ONE, 19, 2024, 0306613
DOI: 10.1371/journal.pone.0306613 -
(2024): Surface Roughness-Dependent Corrosion: Implications for Cochlear Implant Reliability, Current Directions in Biomedical Engineering, 2024, 10, 91-94
DOI: 10.1515/cdbme-2024-2022 -
(2024): Development of Ternary Magnesium Alloys for Laser Powder Bed Fusion: Optimizing Oxide Layer Thickness, Adv. Eng. Mater., 2024, 2401322
DOI: 10.1002/adem.202401322 -
(2024): Shear bond strength between dental adhesive systems and an experimental niobium-based implant material, J. Mater. Sci.: Mater. Med. 2024, 35, 65
-
(2024): Machine learning assisted design of novel refractory high entropy alloys with enhanced mechanical properties, Computational Materials Science, 231, 2024, 112612
DOI: 10.1016/j.commatsci.2023.112612 -
(2024): A process‑reliable tailoring of subsurface properties during cryogenic turning using dynamic process control, Production Engineering, (2024), 18, 233-251
DOI: 10.1007/s11740-023-01244-0 -
(2024): Target Alloys of Iron-Based Materials through CALPHAD Method, Materials Science Forum, 1133, 2024, 55-66
DOI: 10.4028/p-5bbeeB -
(2024): Repair of Damaged Bearings Raceways by Means of Deposition Welding, Tribology Online, 19, 4, 2024, 266-276
DOI: 10.2474/trol.19.266 -
(2024): Development of Material Sensors Made of Metastable Austenitic Stainless Steel for Load Monitoring, J. of Materi Eng and Perform, 2024
DOI: 10.1007/s11665-024-09910-9 -
(2024): Qualification of Austenitic Stainless Steels for the Development of Load-Sensitive Material Sensors, J. of Materi Eng and Perform, 2024
DOI: 10.1007/s11665-024-09287-9 -
(2024): An approach to interpreting metastable austenitic material sensors for fatigue analysis, Smart Mater. Struct. 2024, 33, 1-12
DOI: 10.1088/1361-665X/ad4f38 -
(2024): A comparative study on Arc‑ and vacuum induction‑melting for Ti16.6Zr16.6Hf16.6Co10Ni20Cu20 high entropy shape memory Alloy Production, Discov. Mater., 2024, 4, 84
DOI: 10.1007/s43939-024-00134-1 -
(2024): Enhanced mechanical properties of Nb-18.7Si alloy by addition of ceramic nano particles for microstructural control, Intermetallics, 176, 2025, 108577
DOI: 10.1016/j.intermet.2024.108577 -
(2024): Intermetallic Compound Layer Morphology and Distribution in Friction‐Welded Steel–Aluminum Components, Adv. Eng. Mater., 2024, 2401606
DOI: 10.1002/adem.202401606 -
(2024): Additiv gefertigte Schneidelektroden im kerntechnischen Rückbau, Phi-Produktionstechnik Hannover informiert
DOI: 10.48811/phi-24-016 -
(2024): Non-Destructive and Mechanical Characterization of the Bond Quality of Co-Extruded Titanium-Aluminum Profiles, Adv. Eng. Mater. 2024, 2401716
DOI: 10.1002/adem.202401716 -
(2024): Operational performance and metal droplet formation in pulsed-shielded metal arc underwater welding, Arch. Civ. Mech. Eng, 24, 94, 2024
DOI: 10.1007/s43452-024-00916-7 -
(2024): Machine Learning – informed Development of High Entropy Alloys with Enhanced Corrosion Resistance, Electrochim. Acta, 2024, 476, 143722
DOI: 10.1016/j.electacta.2023.14372 -
(2024): Novel Alloying Strategy to Improve Brazing Properties on Nickel Based Superalloys for Aircrafts, In: Volume 9: Manufacturing Materials and Metallurgy; Microturbines, Turbochargers, and Small Turbomachines; Oil & Gas Applications; Steam Turbine. London, United Kingdom. 24.06.2024 - 28.06.2024. American Society of Mechanical Engineers, 2024
DOI: 10.1115/GT2024-121186 -
(2024): Influence of High Current Impulses on Element Distribution in Creep-Deformed Single-Crystal Ni-Based Superalloys, J. Mater. Eng. Perform., 2024
DOI: 10.1007/s11665-024-10054-z -
(2024): Arc spraying in silane-doped argon: Widening the material spectrum in oxygen-free process zones, Thermal Spray Bulletin, 17, 1, 2024, 56-61
DOI: 10.53192/TSB20240156 -
(2024): Co-extrusion of Nb–1Zr Powder for the Production of a Biocompatible High-Strength Material for Dental Implants, Adv. Eng. Mater., 2024, 2401436
DOI: 10.1002/adem.202401436 -
(2024): Elektromagnetische Härteprüfung für die Wärmeeinflusszone von Schweißnähten unterhalb der Wasserlinie, Schweißen und Schneiden, 2024, 76, 12, 44-49
DOI: 10.53192/SUS20241244 -
(2024): Development of a carbon equivalent formula for underwater wet welding, Welding in the World, 2024, 68
DOI: 10.1007/s40194-024-01899-y -
(2024): Corrosion behavior of austenitic stainless steel and nickel-based welded joints in underwater wet welding, npj Mater. Degrad., 8, 51, 2024
DOI: 10.1038/s41529-024-00471-9 -
(2024): Abnormal Grain Growth and Pseudoelasticity of Industrially Processed Fe–Mn–Al–Ni Shape Memory Alloy Joined by Metal Inert Gas Welding, Metall. Mater. Trans. A, 2024
DOI: 10.1007/s11661-024-07304-z -
(2024): High temperature and high strain rate properties of brazed honeycomb liner material Haynes 214, WEAR, 2024, 205427
DOI: https://doi.org/10.1016/j.wear.2024.205427 -
(2024): Corrosion fatigue behavior of nanoparticle modified iron processed by electron powder bed fusion, npj Mater Degrad 8, 2024 (1)
DOI: 10.1038/s41529-024-00470-w -
(2024): Detection of diffusible hydrogen during laser beam welding under water, Procedia CIRP, 124, 2024, 544-548
DOI: 10.1016/j.procir.2024.08.171 -
(2024): Assessment of hydrogen-induced material degradation using electromagnetic testing technology, e-Journal of Nondestructive Testing, 2024
DOI: 10.58286/30036 -
(2023): A novel way to reduce the critical deformation for cold roll bonding, Manufacturing Letters 36, 2023, 9-12
DOI: 10.1016/j.mfglet.2022.12.006 -
(2023): Werkstoffschädigung durch Hochtemperaturkorrosion zuverlässig zerstörungsfrei erfassen und charakterisieren, ZfP-Zeitung, 187, 2023
-
(2023): Reliable non-destructive detection and characterization of material degradation caused by high-temperature corrosion, ReJNDT 1, 2023 (1)
DOI: 10.58286/28070 -
(2023): Structural and superelastic properties of Fe-Mn-Al-Ni shape memory alloy sheets produced on industrial process routes by hot rolling, Journal of Materials Research and Technology, 2023
DOI: 10.1016/j.jmrt.2023.04.260 -
(2023): Partial resistance tempering of hot-stamped components made of 22MnB5 for subsequent bending, IOP Conf. Ser.: Mater. Sci. Eng. 1284, 2023 (1), 12039
DOI: 10.1088/1757-899X/1284/1/012039 -
(2023): Influence of the grain orientation and δ-ferrite on the cyclic deformation behavior of an austenitic CrNi steel manufactured by wire and arc additive manufacturing, Materials Science and Engineering: A 44, 2023, 144612
DOI: 10.1016/j.msea.2023.144612 -
(2023): Electrografting of BTSE, Journal of Advanced Joining Processes 7, 2023 (2), 100137
DOI: doi.org/10.1016/j.jajp.2022.100137 -
(2023): Combined influence of cooling strategies and depth of cut on the deformation-induced martensitic transformation turning AISI 304, Journal of Materials Processing Technology 312, 2023 (1), 117861
DOI: 10.1016/j.jmatprotec.2023.117861 -
(2023): Patterning of Surfaces for Subsequent Roll Bonding in a Low-Oxygen Environment Using Deformable Mesh Inlays, JMMP 7, 2023 (5), 158
DOI: 10.3390/jmmp7050158 -
(2023): An X-ray Microscopy Study of the Microstructural Effects on Thermal Conductivity in Cast Aluminum-Copper Compounds, Metals 13, 2023 (4), 671
DOI: 10.3390/met13040671 -
(2023): Identification of overloads on splined shafts by means of eddy current testing technology, Proceedings of the 13th European Conference on Non-Destructive Testing, 2023, 1-6
DOI: 10.58286/28069 -
(2023): Detection and Characterization of Fatigue Cracks in Butt Welds of Offshore Structures Using the Eddy Current Method, Diagnostics and Prognostics of Engineering Systems 6, 2023 (2), 56
DOI: 10.1115/1.4056313 -
(2023): Entwicklung hybrider, magnetischer Werkstoffsysteme durch Implementierung ferromagnetischer Materialien in eine Al-Matrix, Tagungsband 5. Symposium Materialtechnik. Clausthal-Zellerfeld, 2023
DOI: 10.21268/20231006-0 -
(2023): Fracture Resistance of Repaired 5Y-PSZ Zirconia Crowns after Endodontic Access, Dentistry Journal 11, 2023 (3), 76
DOI: 10.3390/dj11030076 -
(2023): Induction Melting a cold crucible Furnace applied to innovative high-melting Temperature Metals, Magnetohydrodynamics 58, 2023 (4), 523-532
DOI: 10.22364/mhd.58.4.17 -
(2023): Lastsensitive Zahnwelle mit sensorischem Werkstoff als sensorintegriertes Maschinenelement, DFG SPP 2305, 2023, 101-106
DOI: 10.21268/20230425-9 -
(2023): Electroplasticity Mechanisms in hcp Materials, Adv. Eng. Mater., 2023
DOI: https://doi.org/10.1002/adem.202201912 -
(2023): Development and evaluation of a closed-loop z-axis control strategy for wire-and-arc-additive manufacturing using the process signal, Int J Adv Manuf Technol, 2023
DOI: 10.1007/s00170-023-12012-w -
(2023): Plasma Welding of Aluminum in an Oxygen-Free Argon Atmosphere, Advances In Materials Science 23, 2023 (1), 5-18
DOI: 10.2478/adms-2023-0001 -
(2023): Untersuchung und Optimierung der Prozessparameter und Werkzeuge zum Unterwasserkleben von Halterungssystemen, DVS Media – Schweissen und Schneiden, 2023 (3), 144-151
-
(2023): Investigation and optimization of process parameters and tools for underwater bonding of brackets, Welding and Cutting, 2023 (2), 50-55
DOI: https://doi.org/10.53192/WAC20230250 -
(2023): Increasing thermal conductivity in aluminium-copper compound castings: modelling and experiments, Materials Science and Technology 22, 2023, 1-11
DOI: 10.1080/02670836.2023.2184591 -
(2023): Determination of thermal conductivity of eutectic Al–Cu compounds utilizing experiments, molecular dynamics simulations and machine learning, Modelling Simul. Mater. Sci. Eng. 31, 2023 (4), 45001
DOI: 10.1088/1361-651X/acc960 -
(2023): Understanding the enhanced corrosion performance of two novel Ti-based biomedical high entropy alloys, Journal of Alloys and Compounds 956, 2023, 170343
DOI: 10.1016/j.jallcom.2023.170343 -
(2023): Energy Harvesting in rotierenden Maschinenelementen, Mitteilungen aus dem Institut für Maschinenwesen der Technischen Universität Clausthal, 2023, 48, 89-94
-
(2023): Material-based model for the simulation of underwater welding, Welding and Cutting 23, 2023 (1), 24-29
DOI: 10.53192/WAC20230124 -
(2023): Accelerated coarsening behavior of the γ´-phase in CMSX-4 during non-isothermal heat treatment, Materials Today Communications 36, 2023, 106703
DOI: 10.1016/j.mtcomm.2023.106703 -
(2023): Implications of ageing effects on thermal and mechanical properties of PMMA-based bone cement for THA revision surgery, Journal of the Mechanical Behavior of Biomedical Materials, 148, 2023, 106218
DOI: 10.1016/j.jmbbm.2023.106218 -
(2023): Thermal spraying in oxygen-free environment: Meltoff and atomisation behaviour of twin-wire arc spraying processes in silane-doped inert gases, Thermal Spray Bulletin, 16, 1, 2023, 24-30
DOI: 10.53192/TSB20230124 -
(2023): Development of EN AW-6082 Metal Foams and Stochastic Foam Modeling for the Individualization of Extruded Profiles, Journal of Materials Engineering and Performance, 2023
DOI: 10.1007/s11665-023-09031-9 -
(2023): Investigations on fatigue strength of wet welded structural steels, Welding and Cutting, 2023, (2), 44-49
DOI: 10.53192/WAC20230244 -
(2023): A Composite of Polyether Ether Ketone and Silica‐Coated Copper Particles for Creating Tailored Conductive Tracks via Laser Printing, Macro Materials & Eng, 2023
DOI: 10.1002/mame.202300264 -
(2023): Implementation of Pulsed - Shielded Metal Arc Underwater Welding (P-SMAUW), DVS Berichte 2023, 81-92
-
(2023): Correlating Ultrasonic Velocity in DC04 with Microstructure for Quantification of Ductile Damage, JMMP 7, 2023 (4), 142
DOI: 10.3390/jmmp7040142 -
(2023): Oxygen‐Free Production—From Vision to Application, Adv. Eng. Mater., 2023, 2201819
DOI: 10.1002/adem.202201819 -
(2023): Untersuchungen zur Ermüdungsfestigkeit von nass geschweißten Offshore-Stählen, Schweißen und Schneiden 75, 2023 (8), 548-553
-
(2023): Aspects of a Sustainability Focused Comparison of the Wire Arc Additive Manufacturing (WAAM) and the Laser Powder Bed Fusion (LPBF) Process, In: Scholz, S.G., Howlett, R.J., Setchi, R. (eds) Sustainable Design and Manufacturing. SDM 2022. Smart Innovation, Systems and Technologies, vol 338. Springer, Singapore, 2023
DOI: 10.1007/978-981-19-9205-6_9 -
(2022): In-Situ Characterization of Microstructural Changes in Alloy 718 during High-Temperature Low-Cycle Fatigue, Metals 12, 2022 (11), 1871
DOI: 10.3390/met12111871 -
(2022): Challenges in communicating the future of high-level radioactive waste disposal, TATuP 31, 2022 (3), 18-23
DOI: 10.14512/tatup.31.3.18 -
(2022): Pressure-compacted and spider silk-reinforced fibrin demonstrates sufficient biomechanical stability as cardiac patch in vitro, Journal of biomaterials applications 36, 2022 (6), 1126-1136
DOI: 10.1177/08853282211046800 -
(2022): CrN/AlN nanolaminates: Architecture, residual stresses, and cracking behavior, Journal of Vacuum Science & Technology A 40, 2022 (1), 13414
DOI: 10.1116/6.0001462 -
(2022): Induction Heating in Underwater Wet Welding—Thermal Input, Microstructure and Diffusible Hydrogen Content, Materials (Basel, Switzerland) 15, 2022 (4), 1417
DOI: 10.3390/ma15041417 -
(2022): Maßgeschneiderte Magnesiumlegierung für das selektive Laserschmelzen: Werkstoffentwicklung und Prozessmodellierung, Giesserei, 2022, 11, 63
-
(2022): Investigation of the influence of the forming process and finishing processes on the properties of the surface and subsurface of hybrid components, Int J Adv Manuf Technol 119, 2022 1-2, 119-136
DOI: 10.1007/s00170-021-08066-3 -
(2022): Material dependent surface and subsurface properties of hybrid components, Prod. Eng. Res. Devel. 16, 2022 (5), 647-659
DOI: 10.1007/s11740-022-01128-9 -
(2022): Investigations on Additively Manufactured Stainless Bearings, Investigations on Additively Manufactured Stainless Bearings. Coatings 12, 2022 (11), 1699
DOI: 10.3390/coatings12111699 -
(2022): Influence of the atmosphere and temperature on the properties of the oxygen-affine bonding system titanium-diamond during sintering, Int J Adv Manuf Technol 120, 2022 11-12, 7187-7196
DOI: 10.1007/s00170-022-09171-7 -
(2022): Setting of deformation-induced martensite content in cryogenic external longitudinal turning, Procedia CIRP 108, 2022 (5), 170-175
DOI: 10.1016/j.procir.2022.03.030 -
(2022): Funktionsorientierte Stellgrößenauslegung beim Drehen, wt Werkstattstechnik online 11, 2022, 767-772
DOI: 10.37544/1436–4980–2022–11–12–41 -
(2022): High Strain Rate and Stress-State-Dependent Martensite Transformation in AISI 304 at Low Temperatures, Metals 12, 2022 (5), 747
DOI: 10.3390/met12050747 -
(2022): Characterization of deformation-induced martensite by cryogenic turning using eddy current testing, Procedia CIRP 108, 2022 (0), 49-54
DOI: 10.1016/j.procir.2022.03.014 -
(2022): Non-destructive, Contactless and Real-Time Capable Determination of the α’-Martensite Content in Modified Subsurfaces of AISI 304, J Nondestruct Eval 41, 2022 (4), 123
DOI: 10.1007/s10921-022-00905-x -
(2022): Non-destructive Evaluation of Workpiece Properties along the Hybrid Bearing Bushing Process Chain, J. of Materi Eng and Perform 11, 2022 (2), 5725
DOI: 10.1007/s11665-022-07598-3 -
(2022): Oxygen-Free Compound Casting of Aluminum and Copper in a Silane-Doped Inert Gas Atmosphere, Inter Metalcast 20, 2022 (1), 1701027
DOI: 10.1007/s40962-022-00910-w -
(2022): Oxidfreier Verbundguss - Optimale Wärmeleitung zwischen artfremden Verbundpartnern, Giesserei Special 109, 2022, 32-40
-
(2022): From corrosion behavior to radiation response, Intermetallics 149, 2022, 107680
DOI: 10.1016/j.intermet.2022.107680 -
(2022): Investigation of the mechanical properties and corrosion behaviour of hybrid L 80 Type 1 and duplex steel joints produced by magnetically impelled arc butt welding, Journal of Advanced Joining Processes 5, 2022 (9), 100109
DOI: 10.1016/j.jajp.2022.100109 -
(2022): Lastsensitive Zahnwelle mit sensorischem Werkstoff, VDI-Bericht 2408 – 9. VDI-Fachtagung Welle-Nabe-Verbindungen 2022, 2022, 253-257
-
(2022): Detection of the contact tube to working distance in wire and arc additive manufacturing, Int J Adv Manuf Technol 120, 2022, 989-999
DOI: 10.1007/s00170-022-08805-0 -
(2022): Influence of hydrogel coatings on corrosion and fatigue of iron in simulated body fluid, Materials & Corrosion, 2022, 599
DOI: 10.1002/maco.202112841 -
(2022): Investigations into Flux-Free Plasma Brazing of Aluminum in a Local XHV-Atmosphere, Materials (Basel, Switzerland) 15, 2022 (23), 8292
DOI: 10.3390/ma15238292 -
(2022): Functionality Investigations of Dry-Lubricated Molybdenum Trioxide Cylindrical Roller Thrust Bearings, Coatings, 2022, 12, 591
DOI: 10.3390/coatings12050591 -
(2022): Herstellung und Untersuchung von Doppelmantel- Fülldrähten für das kontinuierliche nasse Unterwasserschweißen, Schweißen und Schneiden 74 7-8, 438-445
-
(2022): Manufacture and investigation of two chamber flux-cored wires for continuous wet underwater welding, Welding and Cutting, 2022 (4), 296-302
DOI: 10.53192/WAC202204296 -
(2022): An Experimental and Numerical Study of Damage Due to Particle Impact on Sapphire Orifices Used in High-Pressure Water Jet Cutting, Machines 10, 2022 (9), 756
DOI: 10.3390/machines10090756 -
(2022): A sharp-interface model for diffusional evolution of precipitates in visco-plastic materials, Computer Methods in Applied Mechanics and Engineering 391, 2022, 114440
DOI: 10.1016/j.cma.2021.114440 -
(2022): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin 14 (2), 120-127
-
(2022): Young’s Modulus and Residual Stresses of Oxide-Free Wire Arc Sprayed Copper Coatings, Coatings, 12, 10, 2022, 1482
DOI: 10.3390/coatings12101482 -
(2022): Oxide Free Wire Arc Sprayed Coatings—An Avenue to Enhanced Adhesive Tensile Strength, Metals 12, 2022 (4), 684
DOI: 10.3390/met12040684 -
(2022): Electron beam welding and brazing in atmosphere with reduced accelerating voltage on aluminium alloys susceptible to hot cracking, Welding and Cutting, 2022 (4), 272-281
DOI: https://doi.org/10.53192/WAC202204272 -
(2022): Creation of a Knowledge Space by Semantically Linking Data Repository and Knowledge Management System - a Use Case from Production Engineering, IFAC-PapersOnLine 55, 2022 (10), 2030-2035
-
(2022): Creep of Directionally Solidified Eutectics Ni/Ni3 Al–NbC under Thermal Cycling, Inorganic Materials: Applied Research 13, 2022 (4), 1099-1108
DOI: 10.1134/S2075113322040347 -
(2022): Characterization of the Interface between Aluminum and Iron in Co-Extruded Semi-Finished Products, Materials (Basel, Switzerland) 15, 2022 (5), 1692
DOI: 10.3390/ma15051692 -
(2022): Microstructural Investigation of a FeMnAlNi Shape Memory Alloy Processed by Tungsten Inert Gas Wire and Arc Additive Manufacturing, Metals 12, 2022 (10), 1731
DOI: 10.3390/met12101731 -
(2022): Corrosion fatigue behavior of electron beam melted iron in simulated body fluid, npj Mater Degrad 6, 2022 (1), 1917
DOI: 10.1038/s41529-022-00226-4 -
(2022): Cu-Ni-Based Alloys from Nanopowders as Potent Thermoelectric Materials for High-Power Output Applications, Alloys 1, 2022 (1), 3-14
DOI: 10.3390/alloys1010002 -
(2021): The effect of nitrogen alloying on hydrogen-assisted plastic deformation and fracture in FeMnNiCoCr high-entropy alloys, Scripta Materialia 194, 2021, 113642
DOI: 10.1016/j.scriptamat.2020.113642 -
(2021): Influence of Pre-strain on Very-Low-Cycle Stress–Strain Response and Springback Behavior, J. of Materi Eng and Perform 5, 2021 (3), 4353
DOI: 10.1007/s11665-020-05399-0 -
(2021): Microstructural degradation in the subsurface layer of the nickel base alloy 718 upon high-temperature oxidation, Materials at High Temperatures 33, 2021 (4), 1-11
DOI: 10.1080/09603409.2021.1895541 -
(2021): Increasing the energy absorption of monolithic manganese boron steels in oxygen-free environment, IOP Conference Series: Materials Science and Engineering 1157, 2021, 12021
-
(2021): Challenges in the Forging of Steel-Aluminum Bearing Bushings, Materials 14, 2021 (4), 803
DOI: 10.3390/ma14040803 -
(2021): Contact Geometry Modification of Friction-Welded Semi-Finished Products to Improve the Bonding of Hybrid Components, Metals 11, 2021 (1), 115
DOI: 10.3390/met11010115 -
(2021): Influence of residual stresses in hard tool coatings on the cutting performance, Journal of Manufacturing Processes 69, 2021, 340-350
DOI: 10.1016/j.jmapro.2021.08.011 -
(2021): In Situ X‐Ray Diffraction Analysis of Microstructure Evolution during Deep Cryogenic Treatment and Tempering of Tool Steels, Steel research int 409, 2021, 2100076
DOI: 10.1002/srin.202100076 -
(2021): Changes in Mechanical and Microstructural Properties of Magnesium Alloys Resulting from Superimposed High Current Density Pulses, Materials Science Forum (THERMEC 2021) 1016, 2021, 385-391
ISSN: 1662-9752 -
(2021): Effects on the deformation-induced martensitic transformation in AISI 304 in external longitudinal turning, Advances in Industrial and Manufacturing Engineering 2, 2021 (1), 100044
DOI: 10.1016/j.aime.2021.100044 -
(2021): Control of Heat Treatment of Case-Hardening Steel 18CrNiMo7-6 by Determining the Penetration Depth of Eddy Currents, Met Sci Heat Treat 321, 2021 (23), 3878
DOI: 10.1007/s11041-021-00627-3 -
(2021): Deformation-induced martensitic transformation in AISI304 by cryogenic machining, Materials Letters, 2021, 129090
DOI: 10.1016/j.matlet.2020.129090 -
(2021): Characterization of Graded Subsurface Zones in Industrial Case-Hardening Using a Non-Destructive Testing System, HTM 76, 2021 (3), 237-245
DOI: 10.1515/htm-2021-0006 -
(2021): Hot forming of shape memory alloys in steel shells, Prod. Eng. Res. Devel. 481–482, 2021 (3), 266
DOI: 10.1007/s11740-021-01024-8 -
(2021): Investigating the Influence of Process Parameters on the Mechanical Properties of Extruded Aluminum Tubes by Cyclic Indentation Tests, Metals 11, 2021 (5), 744
DOI: 10.3390/met11050744 -
(2021): Fracture behavior of novel biomedical Ti-based high entropy alloys under impact loading, Materials Science and Engineering: A 803, 2021, 140456
DOI: 10.1016/j.msea.2020.140456 -
(2021): Functional Analysis of Components Manufactured by a Sheet-Bulk Metal Forming Process, JMMP 5, 2021 (2), 49
DOI: 10.3390/jmmp5020049 -
(2021): Fringe Projection Profilometry in Production Metrology, Sensors 21, 2021 (7), 2389
DOI: 10.3390/s21072389 -
(2021): Entwicklung von Kupfer-Aluminium-Verbundloten zur In-situ-Bildung von CuAl-Lotlegierungen beim Ofenlöten von CrNi-Stählen, Schweißen und Schneiden 73, 2021 (5), 284-293
-
(2021): Cold Roll Bonding of Tin-Coated Steel Sheets with Subsequent Heat Treatment, Metals 11, 2021 (6), 917
DOI: 10.3390/met11060917 -
(2021): Heat Transfers Coefficients of Directly and Indirectly Cooled Component Areas during Air-Water Spray Cooling, HTM 76, 2021 (1), 64-75
DOI: 10.1515/htm-2020-0005 -
(2021): Processing, Structure, and Properties of Additively Manufactured Titanium Scaffolds with Gyroid-Sheet Architecture, Additive Manufacturing 19, 2021 (12), 101916
DOI: 10.1016/j.addma.2021.101916 -
(2021): Induction heating as practical preheating and post weld heat treatment to improve the quality in underwater wet welding of fine grain structural steels with high carbon equivalents, Welding and Cutting 20, 2021 (3), 228-234
-
(2021): Induktionswärmetechnik als praxisrelevantes Vor- und Nachbehandlungsverfahren zur Verbesserung der Schweißnahtqualität beim Unterwasserschweißen von Feinkornstählen mit erhöhtem Kohlenstoffäquivalent, Schweißen und Schneiden 73, 2021 (10), 718-725
-
(2021): Nitrierbehandlung eines zyklisch selbsthärtenden Warmarbeitsstahls, massivUMFORMUNG, 2021 (1), 68-73
-
(2021): Combination of optical metrology and non-destructive testing technology for the regeneration of aero engine components, tm - Technisches Messen 0, 2021 (0)
DOI: 10.1515/teme-2020-0093 -
(2021): Hydrogen-assisted Crack Propagation in Pre-strained Twinning-induced Plasticity Steel: From Initiation at a Small Defect to Failure, ISIJ Int. 61, 2021 (4), 1278-1286
DOI: 10.2355/isijinternational.ISIJINT-2019-510 -
(2021): Effect of off-stoichiometric compositions on microstructures and phase transformation behavior in Ni-Cu-Pd-Ti-Zr-Hf high entropy shape memory alloys, Journal of Alloys and Compounds 857, 2021, 157467
DOI: 10.1016/j.jallcom.2020.157467 -
(2021): Einfluss von Silan-dotierten Umgebungsatmosphären auf tribologischen Eigenschaften von Titan, T+S (Tribologie und Schmierungstechnik) 68, 2021 (1), 5-13
DOI: 10.24053/TuS-2021-0002 -
(2021): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin, 14, 2, 2021, 120-127
ISSN: 1866–6248 -
(2021): Development of an Aluminum-Based Hybrid Billet Material for the Process-Integrated Foaming of Hollow Co-Extrusions, Metals 11, 2021 (9), 1382
DOI: 10.3390/met11091382 -
(2021): Crack initiation of an industrial 7XXX aluminum alloy in humid air analyzed via slow strain rate testing and constant displacement testing, Materials Science and Engineering: A 804, 2021 (10), 140776
DOI: 10.1016/j.msea.2021.140776 -
(2021): Elektronenstrahlschweißen und -löten an Atmosphäre mit reduzierter Beschleunigungsspannung an heißrissanfälligen Aluminiumlegierungen, Schweissen und Schneiden 73, 2021 (8), 516-526
-
(2021): Process chain for the manufacture of hybrid bearing bushings, Prod. Eng. Res. Devel. (Production Engineering)
DOI: 10.1007/s11740-021-01028-4 -
(2021): On the Microstructural and Cyclic Mechanical Properties of Pure Iron Processed by Electron Beam Melting, Adv. Eng. Mater. 327, 2021, 2100018
DOI: 10.1002/adem.202100018 -
(2020): Improving the accuracy of FE simulations of induction tempering towards a microstructure-dependent electromagnetic model, IEEE Trans. Magn. 56, 2020 (10), 1-9
DOI: 10.1109/TMAG.2020.3013562 -
(2020): Ion Beam Processing for Sample Preparation of Hybrid Materials with Strongly Differing Mechanical Properties, Metallogr. Microstruct. Anal. 9, 2020 (1), 54-60
DOI: 10.1007/s13632-019-00605-5 -
(2020): Microstructural Evolution and Mechanical Properties of Hybrid Bevel Gears Manufactured by Tailored Forming, Metals 10, 2020 (10), 1365
DOI: 10.3390/met10101365 -
(2020): New Multistage Sheet-Bulk Metal Forming Process Using Oscillating Tools, Metals 10, 2020 (5), 617
DOI: 10.3390/met10050617 -
(2020): Characterization and Modeling of Intermetallic Phase Formation during the Joining of Aluminum and Steel in Analogy to Co-Extrusion, Metals 10, 2020 (12), 1582
DOI: 10.3390/met10121582 -
(2020): Influence of degree of deformation on welding pore reduction in high-carbon steels, Influence of degree of deformation on welding pore reduction in high-carbon steels. Prod. Eng. Res. Devel. 15, 2021 (2), 161-168
DOI: 10.1007/s11740-020-01009-z -
(2020): Numerical investigations regarding a novel process chain for the production of a hybrid bearing bushing, Prod. Eng. Res. Devel. 14, 2020 5-6, 569-581
DOI: 10.1007/s11740-020-00992-7 -
(2020): Investigation of the temporal rearrangement of zirconium hydride precipitates in cladding material for the interim and final storage period, Kerntechnik 85, 2020 (6), 433-439
DOI: 10.3139/124.200070 -
(2020): Investigations on Tailored Forming of AISI 52100 as Rolling Bearing Raceway, Metals 10, 2020 (10), 1363
DOI: 10.3390/met10101363 -
(2020): Simulation assisted process chain design for the manufacturing of bulk hybrid shafts with tailored properties, Int J Adv Manuf Technol 108, 2020 7-8, 2409-2417
DOI: 10.1007/s00170-020-05532-2 -
(2020): Influence of nitrogen in process atmospheres on the corrosion and the fatigue behavior of brazed stainless steel joints, Welding and Cutting 19, 2020 (4), 312-317
-
(2020): Eddy Current Detection of the Martensitic Transformation in AISI304 Induced upon Cryogenic Cutting, Steel Research Int. 2, 2020, 2000299
DOI: 10.1002/srin.202000299 -
(2020): Prozessbegleitende Erfassung der Gefügeumwandlung im Randbereich bainitischer Schmiedeteile bei der Abkühlung im Warmbad, massivUMFORMUNG, 2020 (2), 58-63
-
(2020): Investigation of degraded bone substitutes made of magnesium alloy using scanning electron microscope and nanoindentation, Journal of the Mechanical Behavior of Biomedical Materials 109, 2020, 103825
DOI: 10.1016/j.jmbbm.2020.103825 -
(2020): A simulation model for the degradation of magnesium-based bone implants, Journal of the Mechanical Behavior of Biomedical Materials 101, 2020, 103411
DOI: 10.1016/j.jmbbm.2019.103411 -
(2020): Plasma nitriding Ti-6Al-4V with the aid non-transmitted plasma-arc using different protection atmosphere, Materials Today: Proceedings, Volume 30, Part 3, 2020, Pages 694-699, ISSN 2214-7853,
DOI: https://doi.org/10.1016/j.matpr.2020.01.524 -
(2020): Properties and anisotropy behaviour of a nickel base alloy material produced by robot-based wire and arc additive manufacturing, Weld World 64, 1921–1931, 2020
DOI: https://doi.org/10.1007/s40194-020-00971-7 -
(2020): Pattern-forming nanoprecipitates in NiTi-related high entropy shape memory alloys, Scripta Materialia 186, 2020, 132-135
DOI: 10.1016/j.scriptamat.2020.05.007 -
(2020): The Effect of Increasing Chemical Complexity on the Mechanical and Functional Behavior of NiTi-Related Shape Memory Alloys, Shap. Mem. Superelasticity 122, 2020, 106792
DOI: 10.1007/s40830-020-00284-0 -
(2020): Influence of stick electrode coating’s moisture content on the diffusible hydrogen in underwater wet shielded metal arc welding, Advances In Materials Science 20, 2020 4 (66), 27-37
DOI: 10.2478/adms-2020-0020 -
(2020): Reducing the risk of hydrogen-induced cold cracks in hyperbaric wet welding of high strength steels by using austenitic welding consumables, Welding and Cutting, 2020 (1), 54-60
-
(2020): Effect of the water depth on the hydrogen content in SMAW wet welded joints, Springer Nature Applied Sciences 2, 2020 (7), 25
DOI: 10.1007/s42452-020-3066-8 -
(2020): Control of the diffusible hydrogen content in different steel phases through the targeted use of different welding consumables in underwater wet welding, Materials and Corrosion 8, 2020 (3), 11
DOI: 10.1002/maco.202011963 -
(2020): The Applicability of the Standard DIN EN ISO 3690 for the Analysis of Diffusible Hydrogen Content in Underwater Wet Welding, Materials 13, 2020 (17), 3750
DOI: 10.3390/ma13173750 -
(2020): Order and Temperatures of Magnetic Transitions in a Ni₅₁.₉Mn₂₇.₀Ga₂₁.₁ Alloy, IEEE Trans. Magn. 56, 2020 (7), 1-5
DOI: 10.1109/TMAG.2020.2991317 -
(2020): Influence of incorporated nanoparticles on superelastic behavior of shape memory alloys, Materials Science and Engineering: A 776, 2020, 139025
DOI: 10.1016/j.msea.2020.139025 -
(2020): Towards Dry Machining of Titanium-Based Alloys: A New Approach Using an Oxygen-Free Environment, Metals 10, 2020 (9), 1161
DOI: 10.3390/met10091161 -
(2020): Magnesium Alloys for Open-Pored Bioresorbable Implants, JOM 72, 2020 (5), 1859-1869
DOI: 10.1007/s11837-020-04078-8 -
(2020): Application of a titanium filler metal by cold gas dynamic spraying, Thermal Spray Bulletin 13, 2020 (2), 108-113
-
(2020): Fracture Behavior of Ultrafine-Grained Titanium Under Tension at Elevated Temperatures, Journal of Engineering Materials and Technology 142, 2020 (4), 041009
DOI: 10.1115/1.4047747 -
(2020): A multiscale study of hot-extruded CoNiGa ferromagnetic shape-memory alloys, Materials & Design 196, 2020, 109118
DOI: 10.1016/j.matdes.2020.109118 -
(2020): Numerical Simulation of the Abrasive Wear Behavior of Selectively Oxidized α-Fe2O3 Oxide Layers on Tool Steel Surfaces, JOM 72, 2020 (7), 2536-2547
DOI: 10.1007/s11837-020-04172-x -
(2020): Characterization of Molybdenum Based Coatings on 100Cr6 Bearing Steel Surfaces, Tribology Online 15, 2020 (3), 181-185
DOI: 10.2474/trol.15.181 -
(2020): Effects of Cryogenic Treatment on the Microstructure and Mechanical Properties of High-alloyed Tool Steels, HTM 75, 2020 (5), 287-307
DOI: 10.3139/105.110422 -
(2020): Lateral Angular Co-Extrusion: Geometrical and Mechanical Properties of Compound Profiles, Metals 10, 2020, 1162
DOI: 10.3390/met10091162 -
(2020): The effects of severe plastic deformation on the mechanical and corrosion characteristics of a bioresorbable Mg-ZKQX6000 alloy, Materials Science and Engineering: C 115, 2020, 111130
DOI: 10.1016/j.msec.2020.111130 -
(2020): Strain path dependency in incremental sheet-bulk metal forming, Int J Mater Form 90, 2020 (7), 3585
DOI: 10.1007/s12289-020-01537-0 -
(2019): Preparation Methods for Scanning Electron Microscope Characterization of Nano-Carbides in Cold Work Steel X153CrMoV12, Pract. Metallogr. 56, 2019 (5), 303-316
DOI: 10.3139/147.110555 -
(2019): Influence of Alternating Short-Cycle Bending on the Mechanical Properties of Copper, α-Titanium and the Mild Steel DC01, J. of Materi Eng and Perform 28, 2019 (11), 7165-7170
DOI: 10.1007/s11665-019-04458-5 -
(2019): Simulation-Aided Process Chain Design for the Manufacturing of Hybrid Shafts, HTM 74, 2019 (2), 115-135
DOI: 10.3139/105.110378 -
(2019): Manufacturing and Evaluation of Multi-Material Axial-Bearing Washers by Tailored Forming, Metals 9, 2019 (2), 232
DOI: 10.3390/met9020232 -
(2019): Optimierung des Tragverhaltens unter Wasser gefügter Bolzenschweißverbindungen großer Dimensionen für Reparatur- und Instandhaltungsmaßnahmen, Schweißen und Schneiden 71, 2019 (5), 278-284
-
(2019): Hubzündungsbolzenschweißen großer Dimensionen unter Wasser Qualifiziert bis 50 m Wassertiefe, Der Praktiker, 2019 1-2, 26-31
-
(2019): Compressive response of high-strength [001]-oriented single crystals of a Co35Ni35Al30 shape memory alloy, Journal of Alloys and Compounds 787, 2019, 963-971
DOI: 10.1016/j.jallcom.2019.02.185 -
(2019): Untersuchungen zum Einfluss von Stickstoff in der Lötatmosphäre auf die Lebensdauerfestigkeit Ni-Basis-gelöteter CrNi-Stahl-Verbindungen unter korrosiver Belastung, Schweißen und Schneiden 71, 2019 (4), 230-237
-
(2019): Anomalous twinning in AZ 31 magnesium alloy during electrically assisted forming, Materials Letters 255, 2019, 126516
DOI: 10.1016/j.matlet.2019.126516 -
(2019): Brazing in SiH4-Doped Inert Gases - A New Approach to an Environment Friendly Production Process, Int. J. of Precis. Eng. and Manuf.-Green Tech. 495, 2019 (1), 187
DOI: 10.1007/s40684-019-00109-1 -
(2019): Investigation of the Prediction Accuracy of a Finite Element Analysis Model for the Coating Thickness in Cross-Wedge Rolled Coaxial Hybrid Parts, Materials 12, 2019 (18), 2969
DOI: 10.3390/ma12182969 -
(2019): Assessing printability maps in additive manufacturing of metal alloys, Acta Materialia 176, 2019, 199-210
DOI: 10.1016/j.actamat.2019.07.005 -
(2019): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2019): Tailoring the Microstructure in Polycrystalline Co–Ni–Ga High-Temperature Shape Memory Alloys by Hot Extrusion, Shap. Mem. Superelasticity 5, 2019 (1), 84-94
DOI: 10.1007/s40830-019-00208-7 -
(2019): Fatigue behavior of As-built selective laser melted titanium scaffolds with sheet-based gyroid microarchitecture for bone tissue engineering, Acta Biomaterialia 94, 2019, 610-626
DOI: 10.1016/j.actbio.2019.05.046 -
(2019): Comparison of degradation behaviour and osseointegration of the two magnesium scaffolds, LAE442 and La2, in vivo, Materialia 8, 2019, 100436
DOI: 10.1016/j.mtla.2019.100436 -
(2019): Verminderung des Risikos wasserstoffinduzierter Kaltrisse durch den Einsatz austenitischer Schweißzusatzwerkstoffe beim hyperbar nassen Schweißen höherfester Baustähle, Schweißen und Schneiden 71, 2019 (9), 588-594
-
(2019): Giant reversible stress-induced change of resistivity in Ni-Mn-In-Co alloys, Journal of Applied Physics 125, 2019 (19), 195103
DOI: 10.1063/1.5088233 -
(2019): Microstructure Formation in Cast TiZrHfCoNiCu and CoNiCuAlGaIn High Entropy Shape Memory Alloys: A Comparison, Materials 12, 2019 (24)
DOI: 10.3390/ma12244227 -
(2019): Impact of Heating–Cooling Rates on the Functional Properties of Ti–20Ta–5Al High-Temperature Shape Memory Alloys, Shap. Mem. Superelasticity 5, 2019 (1), 95-105
DOI: 10.1007/s40830-019-00207-8 -
(2019): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2019): Development of a tool concept with selectively oxidised inserts for dry deep drawing, Dry Met. Forming OAJ FMT 5, 2019, 46-49
-
(2019): Compressive shape memory actuation response of stress-induced martensite aged Ni51Fe18Ga27Co4 single crystals, Materials Science and Engineering: A 746, 2019, 448-455
DOI: 10.1016/j.msea.2019.01.004 -
(2019): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2019): Werkstofftechnisch basiertes Modell für die Simulation des Unterwasserschweißens, Schweißen und Schneiden 71, 2019 (8), 513-519
-
(2019): Visualization and Observation of Morphological Peculiarities of Twin Formation in Mg-Based Samples After Electrically Assisted Forming, Metallogr. Microstruct. Anal. 8, 2019 (6), 806-814
DOI: 10.1007/s13632-019-00589-2 -
(2019): Automatisierung der Verbindungsvorbereitung von Stahlseilfördergurten - Einsatz von Wasserstrahlverfahren, Schüttgut 25, 2019 (2), 84-88
-
(2019): Cyclic deformation response of ultra-fine grained titanium at elevated temperatures, International Journal of Fatigue 122, 2019, 228-239
DOI: 10.1016/j.ijfatigue.2019.01.021 -
(2019): Joining of blanks by cold pressure welding: Incremental rolling and strategies for surface activation and heat treatment, Materialwiss. Werkstofftech. 50, 2019 (8), 924-939
DOI: 10.1002/mawe.201900031 -
(2019): Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfaces, Wear 426-427, 2019, 1603-1615
DOI: 10.1016/j.wear.2019.01.009 -
(2019): Evolution of surface characteristics of two industrial 7xxx aluminium alloys exposed to humidity at moderate temperature, Surface and Interface Analysis 51, 2019 (19), 5775
DOI: 10.1002/sia.6652 -
(2019): Generating Ultrabroadband Deep-UV Radiation and Sub-10 nm Gap by Hybrid-Morphology Gold Antennas, Nano letters 19, 2019 (7), 4779-4786
DOI: 10.1021/acs.nanolett.9b02100 -
(2019): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2019): Material models for the thermoplastic material behaviour of a dual-phase steel on a microscopic and a macroscopic length scale, Journal of the Mechanics and Physics of Solids 129, 2019, 205-228
DOI: 10.1016/j.jmps.2019.04.012 -
(2018): Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt Coatings, Adv. Eng. Mater. 20, 2018 (9), 1800102
DOI: 10.1002/adem.201800102 -
(2018): Decommissioning of Nuclear Facilities: An Interdisciplinary Task for Junior Staff, atw - International Journal for Nuclear Power 63, 2018 (11/12), 601-604
-
(2018): On the Utility of Crystal Plasticity Modeling to Uncover the Individual Roles of Microdeformation Mechanisms on the Work Hardening Response of Fe-23Mn-0.5C TWIP Steel in the Presence of Hydrogen, J. Eng. Mater. Technol 140, 2018 (3), 31002
DOI: 10.1115/1.4038801 -
(2018): A Numerical Study on Co-Extrusion to Produce Coaxial Aluminum-Steel Compounds with Longitudinal Weld Seams, Metals 8, 2018 (9), 717
DOI: 10.3390/met8090717 -
(2018): Shaping single atomic junctions in ultra-thin Ag structures by electromigration, Appl. Phys. Lett. 113, 2018 (1), 13106
DOI: 10.1063/1.5040405 -
(2018): Manufacturing of High-Performance Bi-Metal Bevel Gears by Combined Deposition Welding and Forging, Metals 8, 2018 (11), 898
DOI: 10.3390/met8110898 -
(2018): Influence of High Current-Density Impulses on the Stress-Strain Response and Microstructural Evolution of the Single Crystal Superalloy CMSX-4, Materials Research 21, 2018 (6), 1063
DOI: 10.1590/1980-5373-MR-2018-0428 -
(2018): Effect of Electrical Pulses on the Mechanical Behavior of Single Crystals of Nickel-Based CMSX-4 Superalloy and the Mobility of Low-Angle Grain Boundary in Aluminum Bicrystals, Bulletin of the Russian Academy of Sciences: Physics 82, 2018 (9), 1079-1085
DOI: 10.3103/S106287381809006X -
(2018): The Influence of Alternating Low-Cycle Bending Loads on Sheet Properties Having an Hcp Crystal Lattice, J. of Materi Eng and Perform 27, 2018 (2), 541-549
DOI: 10.1007/s11665-018-3123-2 -
(2018): Surface integrity of turned laser-welded hybrid shafts, Prod. Eng. Res. Devel., 2018
DOI: 10.1007/s11740-018-0862-8 -
(2018): Technology-based re-contouring of blade integrated disks after weld repair, J. Eng. Gas Turbines Power, 2018
DOI: 10.1115/1.4040738 -
(2018): Investigation of the γ′-Strengthened Quaternary Co-Based Alloys Co-Al-W-Ta, Metall and Mat Trans A 49, 2018 (9), 4042-4057
DOI: 10.1007/s11661-018-4756-3 -
(2018): Development of B2 Shape Memory Intermetallics Beyond NiAl, CoNiAl and CoNiGa, Shap. Mem. Superelasticity 4, 2018 (3), 360-368
DOI: 10.1007/s40830-018-0180-1 -
(2018): Magnetic pulse controlled microstructure development in Co 49 Ni 21 Ga 30 single crystals, Materials Science and Technology 34, 2018 (16), 1954-1964
DOI: 10.1080/02670836.2018.1497129 -
(2018): Internal pressure as a key thermodynamic factor to obtain high-temperature superelasticity of shape memory alloys, Materials Letters 210, 2018, 252-254
DOI: 10.1016/j.matlet.2017.09.034 -
(2018): Direct Observation of Nano-dimensional Internal Structure of Ferromagnetic Domains in the Ferromagnetic Shape Memory Alloy Co-Ni-Ga, Journal of Magnetism and Magnetic Materials, 2018
DOI: 10.1016/j.jmmm.2018.06.066 -
(2018): Kontinuierliches Unterwasserschweißen mit Massivdrahtelektroden, Schweißen und Schneiden 70, 2018 (10), 720-726
-
(2018): Strategies for the Heat Treatment of Steel-Aluminium Hybrid Components, HTM 73, 2018 (5), 268-282
DOI: 10.3139/105.110368 -
(2018): Processing and coating of open-pored absorbable magnesium-based bone implants, Materials Science and Engineering: C 98, 2019, 1073-1086
DOI: 10.1016/j.msec.2018.12.125 -
(2018): Crystallographic Structure Analysis of a Ti-Ta Thin Film Materials Library Fabricated by Combinatorial Magnetron Sputtering, ACS combinatorial science 20, 2018 (3), 137-150
DOI: 10.1021/acscombsci.7b00135 -
(2018): Thermal Properties of Intermetallic Phases at the Interface of Aluminum-Copper Compound Castings, Adv. Eng. Mater. 20, 2018 (6), 1701027
DOI: 10.1002/adem.201701027 -
(2018): The Effect of SiC Addition on Microstructure and Mechanical Properties of Gas Tungsten Arc-Welded Ti-6Al-4V Alloy, J. of Materi Eng and Perform 27, 2018 (1), 253-260
DOI: 10.1007/s11665-017-3091-y -
(2018): Herstellungsprozess und Wälzfestigkeit von hybriden Hochleistungsbauteilen, Konstruktion 70, 2018 (9), 84-89 More info
-
(2018): Hydrogen-assisted failure in a bimodal twinning-induced plasticity steel: Delamination events and damage evolution, International Journal of Hydrogen Energy 43, 2018 (4), 2492-2502
DOI: 10.1016/j.ijhydene.2017.11.177 -
(2018): Future regeneration processes for high-pressure turbine blades, CEAS Aeronaut J 9, 2018 (1), 85-92
DOI: 10.1007/s13272-017-0277-9 -
(2018): Direct microstructure design by hot extrusion – High-temperature shape memory alloys with bamboo-like microstructure, Scripta Materialia 162, 2019, 127-131
DOI: 10.1016/j.scriptamat.2018.10.051 -
(2018): Laser welding of dissimilar low-alloyed steel-steel butt joints and the effects of beam position and ultrasound excitation on the microstructure, Journal of Laser Applications 30, 2018 (3), 32417
-
(2018): Two-way shape memory effect and thermal cycling stability in Co 35 Ni 35 Al 30 single crystals by low-temperature martensite ageing, Scripta Materialia 150, 2018, 18-21
DOI: 10.1016/j.scriptamat.2018.02.013 -
(2018): Giant rubber-like behavior induced by martensite aging in Ni51Fe18Ga27Co4 single crystals, Scripta Materialia 162, 2019, 387-390
DOI: 10.1016/j.scriptamat.2018.12.003 -
(2018): Spiky Nickel Electrodes for Electrochemical Oxygen Evolution Catalysis by Femtosecond Laser Structuring, International Journal of Electrochemistry, 2018 (12), 1-12
DOI: 10.1155/2018/9875438 -
(2018): Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatings, Thermal Spray Bulletin 70, 2018 (2), 104-111
-
(2018): Inductive heat treatment as an alternative tempering method for the selective oxidation of 1.2379 tool steel surfaces, Dry Met. Forming OAJ FMT 4, 2018, 13-17
-
(2018): Resonant-Plasmon-Assisted Subwavelength Ablation by a Femtosecond Oscillator, Phys. Rev. Applied 9, 2018 (2), 024001-10
DOI: 10.1103/PhysRevApplied.9.024001 -
(2018): Impact of Plasmon-Induced Atoms Migration in Harmonic Generation, ACS Photonics 5, 2018 (4), 1208-1214
DOI: 10.1021/acsphotonics.7b01560 -
(2018): Modelling of the fatigue crack growth of a coated single crystalline nickel-based superalloy under thermal mechanical loading, International Journal of Fatigue 116, 2018, 268-274
DOI: 10.1016/j.ijfatigue.2018.06.015 -
(2018): The effect of temperature gradients in thermo-mechanical fatigue testing, Materials at High Temperatures 36, 2018 (2), 97-103
DOI: 10.1080/09603409.2018.1466500 -
(2018): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2018): Effects of microstructural mechanisms on the localized oxidation behavior of NiTi shape memory alloys in simulated body fluid, J Mater Sci 53, 2018 (2), 948-958
DOI: 10.1007/s10853-017-1586-4 -
(2018): Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-Beschichtungen, Unter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
-
(2018): Effect of Different Intercritical Annealing Treatments without and with Overaging on the Mechanical Material Behavior, Steel Research Int. 89, 2018 (10), 1800196
DOI: 10.1002/srin.201800196 -
(2018): Ion polishing as a method of imaging the magnetic structures in CoNiGa monocrystal, Results in Physics 10, 2018, 277-280
DOI: 10.1016/j.rinp.2018.06.020 -
(2017): How dry is dry? - A critical analysis of surface conditions used in dry metal forming, Dry Met. Forming OAJ FMT 3, 2017, 90-94
-
(2017): Hydrogen-enhanced Orientation Dependence of Stress Relaxation and Strain-aging in Hadfield Steel Single Crystals, Scripta Materialia 136, 2017, 101-105
DOI: 10.1016/j.scriptamat.2017.04.028 -
(2017): The Influence of the Thermomechanical Processing Regime on the Structural Evolution of Mo-Nb-Ti-V Microalloyed Steel Subjected to High-Pressure Torsion, Metall and Mat Trans A 48, 2017 (7), 3400-3409
DOI: 10.1007/s11661-017-4085-y -
(2017): Application of mechanical surface finishing processes for roughness reduction and fatigue improvement of additively manufactured Ti-6Al-4V parts, International Journal of Fatigue 102, 2017, 135-142
DOI: 10.1016/j.ijfatigue.2017.05.008 -
(2017): Influences on the formability and mechanical properties of 7000-aluminum alloys in hot and warm forming, J. Phys.: Conf. Ser. 896, 2017, 12004
DOI: 10.1088/1742-6596/896/1/012004 -
(2017): Investigation of the coating thickness of plasma-transferred arc deposition welded and cross wedge rolled hybrid parts, Prod. Eng. Res. Devel. 11, 2017 (3), 255-263
DOI: 10.1007/s11740-017-0734-7 -
(2017): Influence of High-Current-Density Impulses on the Compression Behavior: Experiments with Iron and a Nickel-Based Alloy, Journal of Materials Engineering and Performance 26, 2017 (1), 177-184
DOI: 10.1007/s11665-016-2457-x -
(2017): Residual stress formation after re-contouring of micro-plasma welded Ti−6Al−4 V parts by means of ball end milling, Mat.-wiss. u. Werkstofftech. 48, 2017 (11), 1034-1039
DOI: 10.1002/mawe.201600743 -
(2017): Rückbau von Stahlstrukturen unter Wasser mittels Laserstrahlschneiden, Schiff und Hafen 69, 2017 (11), 40-44
-
(2017): Formation and growth of voids in dual-phase steel at microscale and nanoscale levels, Journal of Materials Science 52, 2017 (8), 4234-4243
DOI: 10.1007/s10853-016-0678-x -
(2017): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics 26, 2016 (8), 1147-1169
DOI: 10.1177/1056789516650245 -
(2017): Microstructural characterization and simulation of damage for geared sheet components, J. Phys.: Conf. Ser. 896, 2017, 12076
DOI: 10.1088/1742-6596/896/1/012076 -
(2017): Pulsed magnetic field-induced changes in the meso- and nanostructure of Co49Ni21Ga30 martensite, Funct. Mater. Lett. 10, 2017 (04), 1750044
DOI: 10.1142/S1793604717500448 -
(2017): Manuelles und halbautomatisches Elektrokontakttrennen von Spundwänden unter Wasser, Schweißen und Schneiden 69, 2017 (5), 244-251
-
(2017): Die Sonnenscheibe aus Moordorf - Bronzezeit oder Fälschung, DGM-Jahresmagazin - Materialographie/Metallographie 2017, 44-46
-
(2017): Microstructure and Mechanical Properties of Friction Welded Steel-Aluminum Hybrid Components after T6 Heat Treatment, Materials Science and Engineering: A 696, 2017, 33-41
DOI: 10.1016/j.msea.2017.04.052 -
(2017): Method for Semi-Automated Measurement and Statistical Evaluation of Iron Aluminum Intermetallic Compound Layer Thickness and Morphology, Metallogr. Microstruct. Anal. 6, 2017 (5), 367-374
DOI: 10.1007/s13632-017-0378-1 -
(2017): Influence of martensitic transformation on the magnetic transition in Ni-Mn-Ga, Journal of Magnetism and Magnetic Materials 432, 2017, 266-270
DOI: 10.1016/j.jmmm.2017.02.008 -
(2017): Laserstrahlschneiden unter Wasser für höhere Produktivität, Schweißen und Schneiden 69, 2017 (11), 774-780
-
(2017): Microstructural evolution and functional fatigue of a Ti–25Ta high-temperature shape memory alloy, J. Mater. Res. 32, 2017 (23), 4287-4295
DOI: 10.1557/jmr.2017.319 -
(2017): Influence of Cross Wedge Rolling on the Coating Quality of Plasma-Transferred Arc Deposition Welded Hybrid Steel Parts, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (7), 1-7
-
(2017): Influence of silicon on the structure and weldability of steel-aluminium joints processed by non-vacuum electron beam welding, International Journal of Emerging Technology and Advanced Engineering 7, 2017 (9), 348-356
-
(2017): A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/Al, J Therm Spray Tech 26, 2017 (7), 1659-1668
DOI: 10.1007/s11666-017-0612-z -
(2017): Surface modification of an austenitic stainless steel wire by a multi-pulse treatment with a high-power electric current, Journal of Materials Science 52, 2017 (13), 8007-8015
DOI: 10.1007/s10853-017-1003-z -
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten Druckgussbauteilen, Giesserei Special, 2017 (1), 74-89 More info
-
(2017): Two-way shape memory effect under multi-cycles in [001]-oriented Ni 49 Fe 18 Ga 27 Co 6 single crystal, Materials Science and Engineering: A 706, 2017, 95-103
DOI: 10.1016/j.msea.2017.08.108 -
(2017): An EBSD Evaluation of the Microstructure of Crept Nimonic 101 for the Validation of a Polycrystal–Plasticity Model, J. of Materi Eng and Perform 26, 2017 (12), 6087-6098
DOI: 10.1007/s11665-017-3046-3 -
(2017): Einschluss oder Zugriff, Tiefenlagerung ohne oder mit Vorkehrungen zur Rückholbarkeit, GAiA Ökologische Perspektiven für Wissenschaft und Gesellschaft, 2017 (2), 114-117
DOI: 10.14512/gaia.26.2.13 -
(2017): Engineering of biodegradable magnesium alloy scaffolds to stabilize biological myocardial grafts, Biomedizinische Technik. Biomedical engineering 62, 2017 (5), 493-504
DOI: 10.1515/bmt-2016-0205 -
(2017): Investigating the origin of third harmonic generation from diabolo optical antennas, Appl. Phys. Lett. 111, 2017 (17), 173102
DOI: 10.1063/1.5001005 -
(2017): Self-optimization of plasmonic nanoantennas in strong femtosecond fields, Optica 4, 2017 (9), 1038-1043
DOI: 10.1364/OPTICA.4.001038 -
(2017): Robotic guided waterjet cutting technique for high tibial dome osteotomy: A pilot study, The international journal of medical robotics + computer assisted surgery MRCAS 4, 2017 (2), 174-179
DOI: 10.1002/rcs.1825 -
(2017): Mechanical Properties of Co-Extruded Aluminium-Steel Compounds, Key Engineering Materials 742, 2017, 512-519
DOI: 10.4028/www.scientific.net/KEM.742.512 -
(2017): Peculiarities of high-temperature superelasticity in Ni–Fe–Ga single crystals in compression, Tech. Phys. Lett. 43, 2017 (3), 320-323
DOI: 10.1134/S1063785017030245 -
(2017): 1-Step “Quenching and Partitioning” of the Press-Hardening Steel 22MnB5, Steel Research Int. 88, 2017 (6), 1600307
DOI: 10.1002/srin.201600307 -
(2017): The Effect of Intercritical Annealing on the Microstructure and Mechanical Properties of Ferritic-Martensitic Two-Phase Steels, Steel Research Int. 88, 2017 (2), 271-280
DOI: 10.1002/srin.201600107 -
(2017): Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal forming, Wear 376-377, 2017, 1789-1803
DOI: 10.1016/j.wear.2017.01.084 -
(2017): Wear Testing of Thermally Oxidised Tool Steel Specimens with α-Fe2O3 Layers, Dry Met. Forming OAJ FMT 3, 2017, 45-49
-
(2017): Automatable Splicing Method for Steel Cord Conveyor Belts – Evaluation of Water Jetting as a Preparation Process, Journal of Mechanical Engineering 63, 2017 (10), 590-596
DOI: 10.5545/sv-jme.2017.4363 -
(2017): Zn-Li alloy after extrusion and drawing: Structural, mechanical characterization, and biodegradation in abdominal aorta of rat, Materials Science and Engineering: C 76, 2017, 301-312
DOI: 10.1016/j.msec.2017.02.167 -
(2016): Effect of strain rate on hydrogen embrittlement susceptibility of twinning-induced plasticity steel pre-charged with high-pressure hydrogen gas, International Journal of Hydrogen Energy 41, 2016 (34), 15362-15372
DOI: 10.1016/j.ijhydene.2016.06.259 -
(2016): Process Integrated Heat Treatment of a Microalloyed Medium Carbon Steel: Microstructure and Mechanical Properties, J. of Materi Eng and Perform 25, 2016 (4), 1453-1462
DOI: 10.1007/s11665-016-2004-9 -
(2016): Role of nanotwins on fatigue crack growth resistance – Experiments and theory, International Journal of Fatigue 84, 2016, 28-39
DOI: 10.1016/j.ijfatigue.2015.11.012 -
(2016): Biocompatibility and degradation of LAE442-based magnesium alloys after implantation of up to 3.5years in a rabbit model, Acta Biomaterialia 44, 2016, 355-365
DOI: 10.1016/j.actbio.2016.08.002 -
(2016): Umformtechnische Herstellung hybrider Lagerbuchsen, wt Werkstattstechnik online 106, 2016 (10), 743-748
-
(2016): Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf Titanbasis, Forsch. Ingenieurwes. 81, 2017 (1), 1-12
DOI: 10.1007/s10010-016-0209-6 -
(2016): Qualifying Electrically Conductive Cold Embedding-Media for Scanning Electron Microscopy, Metallogr. Microstruct. Anal. 5, 2016 (4), 332-341
DOI: 10.1007/s13632-016-0286-9 -
(2016): Induction heat treatment of sheet-bulk metal-formed parts assisted by water-air spray cooling, Steel Research Int. 87, 2016 (9), 1220-1227
DOI: 10.1002/srin.201500404 -
(2016): Ion Beam Processing in the Sample Preparation for the Analysis of Ductile Damage in Deep Drawing Steels, Prakt. Metallogr. 53, 2016 (4), 221-236
DOI: 10.3139/147.110377 -
(2016): Specimen Preparation by Ion Beam Slope Cutting for Characterization of Ductile Damage by Scanning Electron Microscopy, Microsc. Res. Tech. 79, 2016 (4), 321-327
DOI: 10.1002/jemt.22633 -
(2016): Ductile Damage and Fatigue Behavior of Semi-Finished Tailored Blanks for Sheet-Bulk Metal Forming Processes, Journal of Materials Engineering and Performance 25, 2016 (3), 1136-1142
DOI: 10.1007/s11665-016-1908-8 -
(2016): Modelling the Plasma Jet in Multi-Arc Plasma Spraying, J Therm Spray Tech 25, 2016 (6), 1111-1126
DOI: 10.1007/s11666-016-0438-0 -
(2016): Impact of intraprosthetic drilling on the strength of the femoral stem in periprosthetic fractures: A finite element investigation, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Engineering in Medicine 230, 2016 (7), 675-681
DOI: 10.1177/0954411916647078 -
(2016): Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling process, Mat.-wiss. u. Werkstofftech 47, 2016 (8), 780-788
DOI: 10.1002/mawe.201600612 -
(2016): Effect of Deformation Texture on the Anisotropy of Elasticity and Damage of Two Phase Steel Sheets, The Physics of Metals and Metallography 117, 2016 (7), 719-724
DOI: 10.1134/S0031918X16050033 -
(2016): MgNd2 alloy in contact with nasal mucosa: an in vivo and in vitro approach, J Mater Sci: Mater Med 27, 2016 (2), 25
DOI: 10.1007/s10856-015-5636-7 -
(2016): Thermal Stability of the Structure of a Heat-Resistant Cobalt Alloy Hardened with Intermetallic γ'-Phase Precipitates, Russian Metallurgy, 2016 (4), 286-291
-
(2016): The effect of texture in modeling deformation processes of bcc steel sheets, Materials Letters 164, 2016, 356-359
DOI: 10.1016/j.matlet.2015.11.007 -
(2016): Experimental analysis of anisotropic damage in dual-phase steel by resonance measurement, International Journal of Damage Mechanics, 2016
DOI: 10.1177/1056789516650245 -
(2016): Cutting and Welding of High-Strength Steels Using Non-Vacuum Electron Beam as a Universal Tool for Material Processing, WJET 04, 2016 (04), 598-607
DOI: 10.4236/wjet.2016.44056 -
(2016): Holistic consideration of grain growth behavior of tempering steel 34CrNiMo6 during heating processes, Journal of Materials Processing Technology 229, 2016, 61-71
DOI: 10.1016/j.jmatprotec.2015.09.015 -
(2016): Determination of heat transfer coefficients for complex spray cooling arrangements, International Journal of Microstructure and Materials Properties 11, 2016 3/4, 229-246
DOI: 10.1504/IJMMP.2016.079149 -
(2016): Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter Prozessgase, Schweißen und Schneiden 68, 2016 (5)
-
(2016): Influence of the Surface and Heat Treatment on the Bond Strength of Galvanized Steel/Aluminum Composites Joined by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (8), 1371-1380
DOI: 10.1002/adem.201600085 -
(2016): Molecular Engineering of Aluminum-Copper Interfaces for Joining by Plastic Deformation, Adv. Eng. Mater. 18, 2016 (6), 1066-1074
DOI: 10.1002/adem.201500501 -
(2016): Effect of Pre-Rolling Heat Treatments on the Bond Strength of Cladded Galvanized Steels in a Cold Roll Bonding Process, Steel Research Int. 87, 2016 (12), 1619-1626
DOI: 10.1002/srin.201600021 -
(2016): Evaluation of Void Nucleation and Development during Plastic Deformation of Dual-Phase Steel DP600, Steel Research Int. 87, 2016 (12), 1583-1591
DOI: 10.1002/srin.201500483 -
(2016): Investigations of ductile damage in DP600 and DC04 deep drawing steel sheets during punching, Procedia Structural Integrity 2, 2016, 673-680
DOI: 10.1016/j.prostr.2016.06.087 -
(2016): Investigations of ductile damage during the process chains of toothed functional components manufactured by sheet-bulk metal forming, Production Engineering 10, 2016 (1), 5-15
DOI: 10.1007/s11740-016-0656-9 -
(2016): Experimental and numerical investigation of increased formability in combined quasi-static and high-speed forming processes, Journal of Materials Processing Technology 237, 2016, 254-269
DOI: 10.1016/j.jmatprotec.2016.06.007 -
(2016): Corrosion behavior, biocompatibility and biomechanical stability of a prototype magnesium-based biodegradable intramedullary nailing system, Materials Science and Engineering: C 59, 129-135
DOI: 10.1016/j.msec.2015.10.006 -
(2016): Cyclic Degradation of Co49Ni21Ga30 High-Temperature Shape Memory Alloy: On the Roles of Dislocation Activity and Chemical Order, Shap. Mem. Superelasticity 2, 2016 (1), 37-49
DOI: 10.1007/s40830-015-0049-5 -
(2016): 57Fe Mössbauer, SEM/EDX, p-XRF and μ-XRF studies on a Dutch painting, Hyperfine Interact 237, 2016 (1)
DOI: 10.1007/s10751-016-1296-3 -
(2016): Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging Die, Advanced Materials Research 1140, 2016, 91-98
DOI: 10.4028/www.scientific.net/AMR.1140.91 -
(2016): Ex-situ and in-situ investigations of thermal anti-oxidation treatments of stainless steels by reflection mode EXAFS, J. Phys.: Conf. Ser. 712, 2016, 12047
DOI: 10.1088/1742-6596/712/1/012047 -
(2016): Analysis of Microstructure and Damage Evolution in Ultra-Thin Wires of the Magnesium Alloy MgCa0.8 at Multipass Drawing, JOM 68, 2016 (12), 3063-3069
DOI: 10.1007/s11837-016-2127-3 -
(2016): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, Thermal Spray Bulletin 68, 2016 (1), 54-59
-
(2016): Micro-Scale Cyclic Bending Response of NiTi Shape Memory Alloy, Materials Transactions 57, 2016 (3), 472-475
DOI: 10.2320/matertrans.M2015423 -
(2016): Intelligente Schmiedewerkzeuge – Effizienter Verschleißschutz durch zyklische Randschichthärtung?, massivUMFORMUNG, 2016 (3), 44-48
-
(2016): Phosphate conversion coating reduces the degradation rate and suppresses side effects of metallic magnesium implants in an animal model, J. Biomed. Mater. Res., 2016
DOI: 10.1002/jbm.b.33704 -
(2016): Turbine blade wear and damage – An overview of advanced characterization techniques, Materials Testing 58, 2016 (5), 389-394
DOI: 10.3139/120.110872 -
(2016): Influence of surface pre-treatments on the high-cycle fatigue behavior of Ti–6Al–4V – From anodizing to laser-assisted techniques, International Journal of Fatigue 91, 2016, 195-203
DOI: 10.1016/j.ijfatigue.2016.06.010 -
(2016): An exploration of plastic deformation dependence of cell viability and adhesion in metallic implant materials, Journal of the Mechanical Behavior of Biomedical Materials 60, 2016, 177-186
DOI: 10.1016/j.jmbbm.2016.01.001 -
(2016): Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und Festwalzen, Werkstoffe in der Fertigung, 2016 (4), 27-28
-
(2016): New Specimen Design for Wear Investigations in Dry Sheet Metal Forming, Dry Met. Forming OAJ FMT 2, 2016, 62-66
-
(2015): Numerical Modelling of the Tribology of a Selective Oxidised 1.2379 Tool Steel Surface Developed for Dry Metal Forming , Dry Met. Forming OAJ FMT 1, 2015; 91-95
-
(2015): Testing of pipe sections, Materials Testing 57, 2015 (7-8); 643-648.
DOI: 10.3139/120.110759 -
(2015): On the micro-deformation mechanisms active in high-manganese austenitic steels under impact loading, Materials Science and Engineering: A, 632; 29-34
DOI: 10.1016/j.msea.2015.02.054 -
(2015): The influence of storage and heat treatment on a magnesium-based implant material: an in vitro and in vivo study, BioMedical Engineering OnLine 14 (1), 1680
-
(2015): In-situ-Erfassung der Werkstoffumwandlung und Gefügeausbildung von Schmiedebauteilen im Abkühlpfad, HTM Journal of Heat Treatment and Materials 70 (3), 2015; S. 150-161
DOI: 10.3139/105.110259 -
(2015): Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatment, La Metallurgia Italiana - International Journal of the Italian Association for Metallurgy 2015 (11/12), 29-37
-
(2015): Mechanical response of low stacking fault energy Co–Ni alloys – Continuum, mesoscopic and atomic level treatments, International Journal of Plasticity 71, 2015; 32-61
-
(2015): Biodegradable nasal stents (MgF 2 -coated Mg-2 wt %Nd alloy)-A long-term in vivo study, Journal of Biomedical Materials Research Part B: Applied Biomaterials
DOI: 10.1002/jbm.b.33559 -
(2015): A novel biodegradable frontal sinus stent (MgNd2): a long-term animal study, European Archives of Oto-Rhino-Laryngology
DOI: 10.1007/s00405-015-3774-7 -
(2015): Verbundguss von Aluminium und Kupfer für Anwendungen als Hochleistungskühlkörper, Giesserei Praxis 66 (10); 459-462
-
(2015): Characterization of the Microstructure Evolution in IF-Steel and AA6016 during Plane-Strain Tension and Simple Shear, Materials 8; 285-301
DOI: 10.3390/ma8010285 -
(2015): Extrusion of the bimetallic aluminum-magnesium rods and tubes, Forsch Ingenieurwes 79, 2015 (1-2); 17–27
DOI: 10.1007/s10010-015-0184-3 -
(2015): Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-Coatings, Applied Mechanics and Materials 788, 2015, 143-150
DOI: 10.4028/www.scientific.net/AMM.788.143 -
(2015): The effectiveness of spheroidization pearlitic steel with regard to the degree of plastic deformation, Interdisciplinary Journal of Engineering Sciences, 3, 2015 (1); 6-9
-
(2015): Twinning activities in high-Mn austenitic steels under high-velocity compressive loading, Materials Science and Engineering: A 648; 104-112.
DOI: dx.doi.org/10.1016/j.msea.2015.09.045 -
(2015): Systematic investigation into wet arc welding under water with covered stick electrodes, Welding and Cutting 14, 2015 (1), 48-53
-
(2015): Kraftschlüssiger Spaltausgleich an imperfekten Flanschverbindungen, Schiff und Hafen 10, 2015; 40-42.
-
(2015): Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steel, Welding and Cutting, 14, 2015 (5), 280-288
-
(2015): Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-Stahl, Schweißen und Schneiden, 67, 2015 (4), 174-182
-
(2015): Protection of yttria-stabilized zirconia for dental applications by oxidic PVD coating, Acta Biomaterialia 11, S. 488–493
DOI: 10.1016/j.actbio.2014.09.042 -
(2015): Martensite stabilization in shape memory alloys – Experimental evidence for short-range ordering, Materials Letters 159, 2015; S. 16-19.
DOI: 10.1016/j.matlet.2015.06.048 -
(2015): Microstructure and transformation related behaviors of a Ni45.3Ti29.7Hf20Cu5 high temperature shape memory alloy, Materials Science and Engineering: A 627, S. 82–94
DOI: 10.1016/j.msea.2014.12.111 -
(2015): Finite element analysis of combined forming processes by means of rate dependent ductile damage modelling, International Journal of Material Forming, 2015
DOI: 10.1007/s12289-015-1278-z -
(2015): Friction-locked gap compensation in imperfect flange connections, Ship & Offshore 6, 2015, 36 - 38.
-
(2015): Transplantation von thermisch gespritzten Schichten, Thermal Spray Bulletin 8, 2015 (1), 50-55.
-
(2015): Stress-induced resistivity changes in a Ni-Mn-In alloy, Applied Physics Letters, 2015, 106; 131908.
DOI: 10.1063/1.4917016 -
(2015): Functional Fatigue and Tension–Compression Asymmetry in [001]-Oriented Co49Ni21Ga30 High-Temperature Shape Memory Alloy Single Crystals, Shape Memory and Superelasticity 1 (1), 2015; 6-17.
DOI: 10.1007/s40830-015-0003-6 -
(2015): Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine blades, Thermal Spray Bulletin, 2015, 8; S. 56-61.
-
(2015): Martensite aging – Avenue to new high temperature shape memory alloys, Acta Materialia 89, S. 298-304
DOI: 10.1016/j.actamat.2015.01.042 -
(2015): Cyclic degradation of titanium–tantalum high-temperature shape memory alloys — the role of dislocation activity and chemical decomposition, Functional Materials Letters 8, 2015; S. 1550062-1 - 1550062-5
DOI: 10.1142/S1793604715500629 -
(2015): Superelasticity in high-strength heterophase single crystals of Ni51.0Ti36.5Hf12.5 alloy, Technical Physics Letters 41 (8), 2015; 797-800.
DOI: 10.1134/S1063785015080283 -
(2015): A Single-Crystal Co-Base Superalloy Strengthened by γ′ Precipitates: Structure and Mechanical Properties, Advanced Engineering Materials 17 (6) 2015, 755-760
DOI: 10.1002/adem.201500088 -
(2015): Alkalization is responsible for antibacterial effects of corroding magnesium, Journal of Biomedical Materials Research Part A, 2015
DOI: 10.1002/jbm.a.35503 -
(2015): In vitro and in vivo corrosion of the novel magnesium alloy Mg–La–Nd–Zr: influence of the measurement technique and in vivo implant location, Biomedical Materials 10 (4) 2015, 045021
DOI: 10.1088/1748-6041/10/4/045021 -
(2015): Neue Anwendungsbereiche numerischer Simulation beim induktiven Randschichthärten mit Feldkonzentratoren, HTM Journal of Heat Treatment and Materials 70 (1), S. 40-49
DOI: 10.3139/105.110250 -
(2015): Investigation of cold pressure welding: cohesion coefficient of copper, Key Engineering Materials 651-653 (2015), S. 1421-1426
DOI: 10.4028/www.scientific.net/KEM.651-653.1421 -
(2015): Herstellung, biomechanische Prüfung und Integrationsverhalten biologischer Interferenzschrauben aus ossärem Material, Fuß & Sprunggelenk 13, 2015, 182–191
DOI: 10.1016/j.fuspru.2015.06.001 -
(2015): Processing of New Materials by Additive Manufacturing: Iron-Based Alloys Containing Silver for Biomedical Applications, Metall. Mater. Trans. A 46, 2015; S. 2829-2833
DOI: 10.1007/s11661-015-2932-2 -
(2015): One-way and two-way shape memory effect in ferromagnetic NiFeGaCo single crystals, Materials Science and Engineering: A 640, 2015; 465-470
DOI: 10.1016/j.msea.2015.06.024 -
(2015): Influence of the Gap Width on the Geometry of the Welded Joint in Hybrid Laser-Arc Welding, Physics Procedia 78, 2015, 14-23
DOI: 10.1016/j.phpro.2015.11.013 -
(2015): Damage Evolution in Pseudoelastic Polycrystalline Co-Ni-Ga High-temperature Shape Memory Alloys, Journal of Alloys and Compounds 633, 2015; 288-295.
DOI: 10.1016/j.jallcom.2015.01.282 -
(2015): Biocompatibility of MgF2-coated MgNd2 specimens in contact with mucosa of the nasal sinus – A long term study, Acta Biomaterialia 18, 2015; 249-261
DOI: 10.1016/j.actbio.2015.03.003 -
(2015): Magnesium-containing layered double hydroxides as orthopaedic implant coating materials-An in vitro and in vivo study, J. Biomed. Mater. Res. (Journal of Biomedical Materials Research Part B: Applied Biomaterials) 04/2015
DOI: DOI: 10.1002/jbm.b.33422 -
(2015): Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal Forming, Dry Met. Forming OAJ FMT 1, 2015, 72-78
-
(2014): Twin Nucleation in Fe-based BCC Alloys - Modeling and Experiments, Modell. Sim. Mater. Sci. Eng., 22, S. 075010-1 - 075010-21
DOI: 10.1088/0965-0393/22/7/075010 -
(2014): Microstructure and mechanical response of single-crystalline high-manganese austenitic steels under high-pressure torsion: The effect of stacking-fault energy, Materials Science and Engineering A., (604), S. 166-175
DOI: 10.1016/j.msea.2014.03.029 -
(2014): Non-vacuum electron-beam carburizing and surface hardening of mild steel, Applied Surface Science 322; S. 6-14
DOI: 10.1016/j.apsusc.2014.09.137 -
(2014): Metalle, die sich erinnern: Mit Formgedächtnis immer in der richtigen Fassung, Unimagazin 01/02 2014, S. 30-33
-
(2014): A method to detect the level and direction of mechanical forces with the aid of load-induced martensitic phase transformation, Prod. Eng. Res. Devel., vol 8, 63-72
-
(2014): Verbundbohrwerkzeug vereint Eigenschaftsvorteile der Fügepartner, Forum Schneidwerkzeug- und Schleiftechnik, Forum Schneidwerkzeug- und Schleiftechnik, 2014, 102-109
-
(2014): Active brazed ceramic cemented carbide compound drills for machining lamellar graphite cast iron, Prod. Eng. Res. Devel. (Production Engineering), 2014, vol. 8, 3
DOI: 10.1007/s11740-014-0547-x -
(2014): Texture and Mechanical Properties of AZ31 Magnesium Alloy Sheets Rolled of Blanks, Technology of Metals 2, S. 12-18
-
(2014): Mechanical Properties of AZ31 Alloy Sheets Deformed by Low-Cycle Reverse Bending, The Physics of Metals and Metallography 115 (1), S. 98-105
DOI: 10.1134/S0031918X14010037 -
(2014): EcoForge – Ressourceneffiziente Prozessketten für Hochleistungsbauteile , Schmiede Journal (2), S. 22-27
-
(2014): Analyse der Biofilmbildung auf kieferorthopädischen Apparaturen, ZWR - Das Deutsche Zahnärzteblatt 123, 2014 (05), 192-199
DOI: 10.1055/s-0034-1383514 -
(2014): Kurzer Prozess – Umformen und Härten, Technologie-Informationen, Innovation Niedersachsen, 2/2014, S. 7 More info
-
(2014): Microstructural evolution in the bonding zones of co-extruded aluminium/titanium, J Mater Sci, 2014, vol. 49, 2442-2455
DOI: 10.1007/s10853-013-7912-6 -
(2014): Joining with electrochemical support (ECUF): Cold pressure welding of copper, Journal of Materials Processing Technology, 2014, vol. 214, 2179–2187
DOI: http://dx.doi.org/10.1016/j.jmatprotec.2014.04.015 -
(2014): Non-destructive detection of weld seams in extruded aluminium profiles, In: Key Engineering Materials 585, S. 103–110.
-
(2014): EcoForge Energieeffiziente Prozesskette zur Herstellung von Hochleistungs-Schmiedebauteilen, HTM Journal of Heat Treatment and Materials, 69 (4), S. 209-219
DOI: 10.3139/105.110220 -
(2014): Interfacial adhesion of zirconia/veneer bilayers with different thermal characteristics, Dent. Mater. J. 33 (5), S. 583–590.
DOI: 10.4012/dmj.2013-181 -
(2014): Structural Evolution of Thin Lamellar Cementite during Cold Drawing of Eutectoid Steels, Procedia Engineering 2014 (81), S. 694–699
DOI: 10.1016/j.proeng.2014.10.062 -
(2014): Characterization of the interface of co-extruded asymmetric aluminum-titanium composite profiles, Materialwissenschaft und Werkstofftechnik, 2014, 45; S. 1054-1060
DOI: 10.1002/mawe.201400353 -
(2014): Formation and Properties of Mixed Ferritic-Martensitic Microstructures in the Air-Hardening Steel LH800, steel research int. 85 (9), S. 1340-1347
DOI: 10.1002/srin.201300420 -
(2014): Suitable Impact Parameters for High-Speed Joining and Influence on the Bonding Zone Microstructure, Journal of Materials Engineering and Performance 23 (3), S. 944-953
DOI: 10.1007/s11665-013-0845-z -
(2014): Digital image correlation at high temperatures for fatigue and phase transformation studies, The Journal of Strain Analysis for Engineering Design (49), S. 204-211
DOI: 10.1177/0309324713498737 -
(2014): Effect of thermal cycling on the martensitic transformation in Ni-Mn-In alloys, Journal of Applied Physics, 116; S. 103515
DOI: 10.1063/1.4895585 -
(2014): Thermal Cycling Behavior of an Aged FeNiCoAlTa Single-crystal Shape Memory Alloy, Scripta Materialia (81), S. 28–31
DOI: 10.1016/j.scriptamat.2014.02.020 -
(2014): Microstructural and Tribological Characterization of Atmospheric Plasma-Nitrided HS6-5-2C Tool Steel, Applied Mechanics and Materials, 2014, 698; S. 345-350
DOI: 10.4028/www.scientific.net/AMM.698.345 -
(2014): Thermal anti-oxidation treatment of CrNi-steels as studied by EXAFS in reflection mode: the influence of monosilane additions in the gas atmosphere of a continuous annealing furnace, Journal of Material Science, 49, 2014, 5454-5461
DOI: 10.1007/s10853-014-8257-5 -
(2014): Geometric adaption of biodegradable magnesium alloy scaffolds to stabilise bio-logical myocardial grafts. Part I, Journal of Materials Science: Materials in Medicine (Springer Verlag), Volume 25, S. 909-916 More info
DOI: 10.1007/s10856-013-5100-5 -
(2014): Sandwich rolling of twin-roll cast aluminium-steel clad strips, Procedia Engineering 2014 (81) S. 1541-1546
DOI: 10.1016/j.proeng.2014.10.187 -
(2014): Setting Discrete Yield-stress Sensors for Recording Early Component Loading Using Eddy-current Array Technology and Induction Thermography, Procedia Technology (15), S. 484–493
DOI: 10.1016/j.protcy.2014.09.008 -
(2014): Characterisation of electron beams generated by a plasma cathode gun, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 242-248, ISSN: 0861-4717
-
(2014): On the functional degradation of binary titanium–tantalum high-temperature shape memory alloys — A new concept for fatigue life extension, Funct. Mater. Lett.; 2014
DOI: 10.1142/S1793604714500428 -
(2014): Functional and structural fatigue of titanium tantalum high temperature shape memory alloys (HT SMAs), Materials Science and Engineering: A (620), S. 359-366
DOI: 10.1016/j.msea.2014.10.038 -
(2014): Spray cooling of extruded EN AW-6082 aluminium alloy sheets: spatial heat transfer coefficients, Forsch Ingenieurwes 78 (1-2), S. 1-7
DOI: 10.1007/s10010-014-0181-y -
(2014): Twin Migration in Fe-based BCC Crystals: Theory and Experiments, Philosophical Magazine, 2014, vol. 94:16, 1816-1840
DOI: http://dx.doi.org/10.1080/14786435.2014.898123 -
(2014): Cyclic Degradation Mechanisms in Aged FeNiCoAlTa Shape Memory Single Crystals, Acta Materialia 79, S. 126-137
DOI: http://dx.doi.org/10.1016/j.actamat.2014.06.019 -
(2014): Two-way Shape Memory Effect in Ferromagnetic Co₃₅Ni₃₅Al₃₀ Single Crystals Aged Under Stress, Scripta Materialia, 2014, Vol. 90-91, S. 10-13
DOI: 10.1016/j.scriptamat.2014.06.034 -
(2014): Complex Investigations of the Influence of Low Cycle Sign-Variable Bending on the Mechanical Properties of Magnesium Alloy AZ31 Sheet , Plastic Deformation of Metals 1, S. 23-27
-
(2014): Joining with electrochemical support: cold pressure welding of copper – weld formation and characterization, Advanced Materials Research, 2014, vol. 966-967, 453-460
DOI: 10.4028/www.scientific.net/AMR.966-967.453 -
(2014): In vivo degradation effects of alloy MgNd2 in contact with mucous tissue, Journal of biomedical materials research. Part A.
DOI: 10.1002/jbm.a.35382 -
(2014): Effect of Reverse Bending on Texture, Structure and Mechanical Properties of Sheets of Magnesium Alloys with Zinc and Zirconium, The Physics of Metals and Metallography 115 (6), S. 609-616
DOI: 10.1134/S0031918X1406012X -
(2014): Composite wires for flux-free arc brazing, WIRE – English edition of the magazine for the spring, wire and cable industry, 64 (1), S. 62-64
-
(2014): Zusatzwerkstoffe zum Lichtbogen-Hartlöten, DRAHT – Deutsche Ausgabe der Zeitschrift für die Feder-, Draht- und Kabelindustrie 65 (2), S. 72-74
-
(2014): Non-vacuum electron beam cutting - A new high performance process, E&E – Electrotechnica & Electronica, 49 (5-6), 2014, 303-309, ISSN: 0861-4717
-
(2014): Systematische Untersuchung zum nassen Lichtbogenschweißen unter Wasser mit umhüllten Stabelektroden, Schweißen und Schneiden, 2014, vol. 66, 05, 250-256 More info
-
(2014): On the Role of Slip - Twin Interactions on the Impact Behavior of High-Manganese Austenitic Steels, Mater. Sci. Eng. A., vol. 593, 120–126.
-
(2014): New design and construction of expandable casing tubes, Forschung im Ingenieurwesen 78 (3-4), S. 145-149 More info
-
(2014): Dislocation slip stress prediction in shape memory alloys, International Journal of Plasticity 54, S. 247–266
DOI: 10.1016/j.ijplas.2013.08.017 -
(2014): Novel magnesium alloy Mg-2La caused no cytotoxic effects on cells in physiological conditions, Materials science & engineering. C, Materials for biological applications 41, S. 267–273
DOI: 10.1016/j.msec.2014.04.063 -
(2014): The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloys, IJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
DOI: 10.3139/146.111022 -
(2013): Fatigue crack initiation in Hastelloy X - the role of boundaries, Fatigue & Fracture of Engineering Materials & Structures, 2013, 36 (8); 809-826.
DOI: 10.1111/ffe.12048 -
(2013): Increased accumulation of magnetic nanoparticles by magnetizable implant materials for the treatment of implant-associated complications, Journal of nanobiotechnology 11, S. 34
DOI: 10.1186/1477-3155-11-34 -
(2013): Magnesium‐based bone implants: Immunohistochemical analysis of peri‐implant osteogenesis by evaluation of osteopontin and osteocalcin expression, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.34828/full.
-
(2013): Influence of Heat Treatment on the Degradation Behaviour of Degradable Magnesium Based Implants, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4057/bmt-2013-4057.xml.
-
(2013): Die Qualität im Blick: Der Bainitsensor ermöglicht Einblicke in die Werkstoffumwandlung, phi - Produktionstechnik Hannover informiert, S. 6-7
-
(2013): Modeling Fatigue Crack Growth Resistance of Nanocrystalline Alloys, In: Acta Materialia 61, S. 2531–2547
-
(2013): Experimental characterization of microstructure development during loading path changes in bcc sheet steels, In: Journal of Materials Science 48 (2), S. 674–689
-
(2013): Biocompatibility of fluoride-coated magnesiumcalcium alloys with optimized degradation kinetics in a subcutaneous mouse model, In: J Biomed Mater Res Part A 101A, S. 33–43
-
(2013): The Biodegradable Magnesium Stent as an Alternative Treatment in Cases of chronic Ventilation Disorders of the Paranasal Sinuses, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4049/bmt-2013-4049.xml.
-
(2013): Laserbeschriftung von Hartferritmagneten zur Kennzeichnung von Druckgussteilen, In: Forschung im Ingenieurwesen 77 (1), S. 39–47. Online verfügbar unter http://link.springer.com/content/pdf/10.1007%2Fs10010-013-0161-7.pdf
-
(2013): Twin-roll casting of aluminum–steel clad strips, In: Journal of Manufacturing Processes 15 (4), S. 501–507.
-
(2013): Influence of Hot Deformation on Mechanical Properties and Microstructure of a Twin-Roll Cast Aluminium Alloy EN AW-6082, Journal of Materials Engineering and Performance 23 (3), S. 937-943 More info
DOI: 10.1007/s11665-013-0816-4 -
(2013): Evaluation of the biocompatibility of two magnesium alloys as degradable implant materials in comparison to titanium as non‐resorbable material in the rabbit, In: Materials Science and Engineering: C 33 (1), S. 317–326. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0928493112004237#.
-
(2013): Economical joining of tubular steel towers for wind turbines employing non-vacuum electron beam welding for high-strength steels in comarsion with sub-merged arc welding, In: Welding in the World. Online verfügbar unter http://www.springerlink.com/openurl.asp?genre=article&id=doi:10.1007/s40194-013-0050-6.
-
(2013): Nonvacuum electron beam cutting and welding—two partnering processes for fast and highly efficient metal working, In: Welding in the World 57 (3), S. 315–322. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs40194-013-0032-8.
-
(2013): Topographieoptimierende Präparation metallischer Werkstoffverbunde, In: Praktische Metallographie / Practical Metallography 50 (7), S. 491–500. Online verfügbar unter http://www.practical-metallography.com/PM110242.
-
(2013): Distribution of Microdefects in Sheets of St1.03-12 Low-Carbon Steel in Tension at Different Rates, Materials Science, Vol. 49, Nr. 2, S. 199–205
DOI: 10.1007/s11003-013-9599-x -
(2013): Korrosionsverhalten binärer Magnesium-Zink-Legierungen in salzhaltigen Medien, In: Materialwissenschaft und Werkstofftechnik 44 (1), S. 84–93.
-
(2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und Verschleißbeanspruchungen, In: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract
-
(2013): Verbund-Gießschmieden hybrider Aluminiumbauteile, Mat.-wiss. u. Werkstofftech. (Materialwissenschaft und Werkstofftechnik), S. 819-824
DOI: 10.1002/mawe.201300125 -
(2013): Inconel 939 Processed by Selective Laser Melting: Effect of Microstructure and Temperature on the Mechanical Properties Under Static and Cyclic Loading, In: Materials Science and Engineering A 588, S. 188–195.
-
(2013): Effects of Nanoprecipitation on the Shape Memory and Material Properties of an Ni-rich NiTiHf High Temperature Shape Memory Alloy, In: Acta Materialia 61, S. 7422–7431.
-
(2013): Influence of Cobalt on the Properties of Load-Sensitive Magnesium Alloys, In: Sensors 13, S. 106–118. Online verfügbar unter http://www.mdpi.com/1424-8220/13/1/106/.
-
(2013): Strong and tough magnesium wire reinforced phosphate cement composites for load-bearing bone replacement, In: Journal of the Mechanical Behavior of Biomedical Materials 20, S. 36–44.
-
(2013): Laser Induced Surface Nano-structuring of Ti-6Al-4V for Adhesive Bonding, In: Int. J. Adhesion & Adhesives 45, S. 112–117.
-
(2013): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: J Mater Sci: Mater Med 24, S. 417–436
-
(2013): Texture development and formability prediction for pre-textured cold rolled body-centred cubic steel, In: International Journal of Engineering Science 68 (July 2013), S. 24–37
DOI: 10.1016/j.ijengsci.2013.03.003 -
(2013): Annealing Behavior of Ultrafine Grained Structure in Low-carbon Steel Produced by Equal Channel Angular Pressing, In: Mater. Sci. Eng. A 581, S. 104–107
-
(2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von Turbinenschaufeln, In: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
-
(2013): Water-Air Spray Cooling of Extruded Profiles: Process Integrated Heat Treatment of the Alloy EN AW-6082, Journal of Materials Engineering and Performance 22, 2013 (9), 2580-2587
-
(2013): Polymer-bioceramic composite coatings on magnesium for biomaterial applications, In: Surface and Coatings Technology 236 (15), S. 420–428. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S0257897213009638.
-
(2013): A numerical investigation of the interplay between cohesive cracking and plasticity in polycrystalline materials, In: Computational Materials Science 77, S. 81–92.
-
(2013): Creep Deformation and Mechanisms in Haynes 230 at 800 °C and 900 °C, In: J Nuclear Materials 443, S. 484–490.
-
(2013): Slip transmission in bcc FeCr polycrystal, Materials Science & Engineering A, 588 (2013); 308–317.
DOI: 10.1016/j.msea.2013.08.050 -
(2013): Degrading magnesium screws ZEK100: biomechanical testing, degradation analysis and soft-tissue biocompatibility in a rabbit model, In: Biomedical Materials 8 (4).
-
(2013): Assessment of cellular reactions to magnesium as implant material in comparison to titanium and to glyconate using the mouse tail model, In: JABFM 11 (2), S. 89–94.
-
(2013): Non-destructive determination of local damage and material condition in high-performance components, HTM (HTM Journal of Heat Treatment and Materials), S. 59-67
DOI: 10.3139/105.110176 -
(2013): Modeling of Spray Cooling during Induction Hardening of Spur Gearwheels Made from 42CrMo4 Hardening and Tempering Steel, Steel Research Int. 85 (5), S. 741-755
DOI: 10.1002/srin.201300201 -
(2013): Tempering Induction Hardened 42CrMo4 Steel Helical Gearwheels from Residual Heat Using Spray Cooling, steel research int. 85 (3), S. 415-425
DOI: 10.1002/srin.201300133 -
(2013): Microstructure evolution of the air-hardening steel LH800 due to heat treatment, In: Journal of Heat Treatment and Materials 68 (1), S. 42–48
-
(2013): In vivo degradation of magnesium alloy LA63 scaffolds for temporary stabilisation of biological myocardial grafts in a swine model, In: Biomedical Engineering/Biomedizinische Technik 58 (5), S. 407–416.
-
(2013): Partial Joining of Blanks with Electrochemical Support (ECUF), In: Key Engineering Materials 554-557, S. 1091–1095.
-
(2013): Magnesium Degradation Products: Effects on Tissue and Human Metabolism, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.35023/full.
-
(2013): MgNd2 : A Future Resorbable Magnesium-Based Implant Material?, In: Emerging Materials Research 2 (5), S. 239–247. Online verfügbar unter http://www.icevirtuallibrary.com/content/article/10.1680/emr.13.00034.
-
(2013): The effects of handling and storage on magnesium based implants — First results, In: Materials Science and Engineering: C 33 (5), S. 3010–3017.
-
(2013): Influence of the grain size on the in vivo degradation behaviour of the magnesium alloy LAE442, In: Proceedings of the Institution of Mechanical Engineers, Part H: Journal of Enginee-ring in Medicine 227 (3), S. 317–326.
-
(2013): Biodegradable magnesium implants for orthopedic applications, In: Journal of Materials Science 48 (1), S. 39–50. Online verfügbar unter http://www.springerlink.com/content/n33l6487g9388578/.
DOI: 10.1007/s10853-012-6572-2 -
(2013): Comparative in vitro study and biomechanical testing of two different magnesium alloys, Journal of Biomedical Applications 28, 2013 (8), 1264-1273
DOI: 10.1177/0885328213506758 -
(2013): Applicability of Degradable Magnesium LAE442 Alloy Plate-Screw-Systems in a Rabbit Model, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4059/bmt-2013-4059.xml.
-
(2013): Grain refining of aluminium alloys and silicon by means of boron-nitride particles, International Journal of Material Research (IJMR), S. 266-274
DOI: 10.3139/146.110866 -
(2012): Oberflächenveredelung durch Metall-Kapillardruckgießen, In: Mikroproduktion 2012/03, S. 62–67
-
(2012): Numerische Berechnung einer integrierten Wärmebehandlung für präzisionsge-schmiedete Bauteile, In: Journal of Heat Treatment and Materials 67, S. 337–343. Online verfügbar unter http://www.htm-journal.de/HT110156.
-
(2012): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK. Ein Überblick zum Abschluss des Projektes, Atw. Internationale Zeitschrift für Kernenergie 57, 2012 (4), 250-254
-
(2012): Effect of reversed bending on texture, structure and mechanical properties of low-carbon steels, In: Technologija Metallov (Technology of metals) (11), S. 19–24.
-
(2012): Long Term In Vivo Degradation Behaviour and Biocompatibility of the Magnesium Alloy ZEK100 for Use as Biodegradable Bone Implant, In: Acta Biomaterialia. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112004047
DOI: 10.1016/j.actbio.2012.08.028 -
(2012): Extrusion of hybrid sheet metals, Journal of Materials Processing Tech. 212 (2012), pp. 1030-1038 (Final version published online 18. Feb 2012)
DOI: 10.1016/j.jmatprotec.2011.12.013
ISBN: 0924-0136 -
(2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma Spraying, Journal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/
-
(2012): Preparation Routine for In Situ Strain Analysis of deep drawing Steel DC04 by Means of Transmission Electron Microscopy, In: Praktische Metallographie 2012 (9), S. 577–587
-
(2012): Investigation of ductile damage development in ferritic steel subject to uniaxial deformation, In: Fatigue & Fracture of Engineering Materials & Structures 35 (10), S. 936–942. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1111/j.1460-2695.2012.01679.x/full.
-
(2012): Analiz parametrov vodo-vozdušnogo sprejernogo ohlaždeniâ metalla v integrirovannyh tehnologičeskih processah, Metallurgičeskaja i gornorudnaja promyšlennost' 7, 2012, 208-212
-
(2012): Analiz izmeneniya temperatury metalla pri osevom vodovozdushnom spreyernom okhlazhdenii stalnykh tsilindricheskikh obraztsov, Metallurgičeskaja i gornorudnaja promyšlennost' 6, 2012, 33-39
-
(2012): Features of austenitic steels’ microstructure following plastic deformation, Materialwissenschaft und Werkstofftechnik, 43, (2012), No. 3
-
(2012): Increase the deformability of NiCo single crystals using of electrical pulse-like currents, Key Engineering Materials, 504-506, 143
DOI: 10.4028/www.scientific.net/KEM.504-506.143 -
(2012): Investigation of the Water-Air Cooling Process of the Thick-Walled Extruded Profile Made of Alloy AW-6060 on the Output Table, Metallurgical and mining industry 4 (2), S. 66–74
-
(2012): Issledovanie processa vodo-vozdušnogo ohlaždeniâ tolstostennogo pressovannogo profilâ iz splava EN AW-6060 na vyhodnom stole, In: Metallurgičeskaja i gornorudnaja promyšlennost' (2), S. 33–38
-
(2012): Influence of Cold Forming and Heat Treatment on the Microstructure and Mechani-cal Properties of an Air-Hardening Steel, In: Steel Research International 83 (11), S. 1020–1028. More info
-
(2012): Research on the Biocompatibility of the New Magnesium Alloy LANd442—An In Vivo Study in the Rabbit Tibia over 26 Weeks, Adv. Eng. Mater.; 14; pp. B28–B37
-
(2012): Sensorkontrolliertes Bainitisieren im Spraydüsenfeld, GWI Gaswärme International, 3, pp. 77-85
-
(2012): Influence of Aluminium on the Corrosion Behaviour of Binary Magnesium-Aluminium Alloys in Saline Solutions, Materials and Corrosion, DOI: 10.1002/maco.201206531
-
(2012): Einfluss der Oberflächenbehandlung auf das Korrosionsverhalten von Magnesiumlegierungen, In: Materialwissenschaft und Werkstofftechnik 43 (12), S. 1067–1073
-
(2012): In vivo assessment of the host reactions to the biodegra-dation of the two novel magnesium alloys ZEK100 and AX30 in an animal model, BioMedical Engineering OnLine; Vol.11 Iss. 14
-
(2012): Experimental and Numerical Investigations on Metal Flow during Direct Extrusion of EN AW-6082, Key Engineering Materials Vol. 491 (2012) pp 137-144
-
(2012): On the Improvement of Formability and the Prediction of Forming Limit Diagrams at Fracture by Means of Constitutive Modelling, KEM (Key Engineering Materials), S. 29-34
DOI: 10.4028/www.scientific.net/KEM.504-506.29 -
(2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing Processes, In: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.
-
(2012): Ressourceneffizienz bei der Herstellung von dichtereduzierten Stählen mit dem Bandgießverfahren, In: Chemie Ingenieur Technik 84 (10), S. 1740–1748. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/cite.201200061/abstract.
-
(2012): Magnetic Magnesium Alloys Based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 14, 1-2 S. 28-34
-
(2012): Mit magnetischen Legierungen werden ganze Bauteile zu Sensoren, In: Maschinenmarkt (39), S. 62–65. Online verfügbar unter http://www.maschinenmarkt.vogel.de/themenkanaele/konstruktion/werkstoffe/articles/379106/.
-
(2012): Casting Process and Comparison of the Properties of Adapted Load-Sensitive Magnesium Alloys, In: Production Engineering Research & Development. Online verfügbar unter http://link.springer.com/article/10.1007/s11740-012-0413-7.
-
(2012): Low-temperature degradation of different zirconia ceramics for dental applications , In: Acta Biomaterialia 8 (3), S. 1213–1220. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706111005034.
-
(2012): Fluoride and calcium-phosphate coated sponges of the magnesium alloy AX30 as bone grafts: a comparative study in rabbits, In: Journal of Materials Science: Materials in Medicine. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs10856-012-4812-2?LI=true.
-
(2012): Material Model Identification for DC04 Based on the Numerical Modelling of the Polycrystalline Microstructure and Experimental Data, Key Engineering Materials 504-506 pp.993–998
-
(2012): A Comparative Study of the Cytotoxicity and Corrosion Resistance of Nickel--titanium and Titanium-niobium Shape Memory Alloys, In: Acta Biomaterialia 8, S. 2863–2870
-
(2012): Numerical investigation of in situ TEM tensile tests, In: Metallurgical and mining industry 4 (4), S. 37–44
-
(2012): Investigation of the surface residual stresses in spray cooled induction hardened gearwheels, International Journal of Materials Research, Vol. 103, Nr. 1, pp. 73-79
DOI: 10.3139/146.110622 -
(2012): Stahlerzeugung am laufenden Band: Ressourcensparendes Walzgießen, In: Phi – Produktionstechnik Hannover informiert 13 (2), S. 16–17.
-
(2012): Neue Nickelhartlote für den Schutzgasdurchlaufofen, Schweissen und Schneiden 6 (64), S. 326–330
-
(2012): Application of a Bioactive Coating on Resorbable, Neodymium Containing Magnesium Alloys, and Analyses of their Effects on the In Vitro Degradation Behavior in a Simulated Body Fluid, Advanced Engineering Materials; DOI: 10.1002/adem.201180078; http://onlinelibrary.wiley.com/doi/10.1002/adem.201180078/full
-
(2012): Characterization of MgNd2 alloy for potential applications in bioresorbable implantable devices, In: Acta Biomaterialia 8 (10), S. 3852–3864. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112002371
-
(2012): Reverse Bending Effect on the Texture, Structure, and Mechanical Properties of Sheet Copper, In: The Physics of Metals and Metallography 112 (8), S. 810–816.
-
(2012): An investigation of the blanking process of the quenchable boron alloyed steel 22MnB5 before and after hot stamping process, Journal of Materials Processing Technology 212 (2012), 437– 449
DOI: 10.1016/j.jmatprotec.2011.10.006 -
(2012): Vlijanie bokovyh ogranichitelei na formirovanie tonkih polos pri valkovoi razlivke-prokatke, In: Metallurgiceskaja i gornorudnaja promyvlennost' 277 (5), S. 32–36
-
(2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von Aluminiumlegierungen, In: Schweißen und Schneiden 64 (8), S. 490–496.
-
(2012): Influence of reversed bending on texture, strcture and mechanical properties of α-titanium sheets, In: Deformation and Fracture of Materials (Deformatsiya I Razrushenie materialov) (9), S. 32–37.
-
(2012): Grain refining of aluminium alloys and silicon by means of boron nitride particles, In: International Journal of Material Research (IJMR). Online verfügbar unter http://www.ijmr.de/web/o_archiv.asp?ps=MK110866&task=03&o_id=25112811648-50.
-
(2012): Modeling the relationship between hardness and spray cooling parameters for pinion shafts using a neuro-fuzzy model strategy, In: Journal of Heat Treatment and Materials 67 (1), S. 39–47.
-
(2012): Repair Preparation of Fiber-Reinforced Plastics by the Machining of a Stepped Peripheral Zone, In: Journal of Mechanical Engineering 58 (10), S. 571–577.
-
(2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnaces, International Journal of Materials Research 2011/08, pp. 964-971
DOI: 10.3139/146.110549 -
(2011): Process Principle for the Production of Sintered Dynamic Component-inherent Data Storage, Production Engineering Vol. 5, Nr. 3, S. 233-240, 2011. More info
DOI: 10.1007/s11740-010-0290-x -
(2011): Acoustic Process Monitoring during Transient Precision Forging of High Strength Components., Metallurgical and mining industry 3 (7), S. 91–97.
-
(2011): Phenomenological modeling of anisotropy induced by evolution of the dislocation structure on the macroscopic and microscopic scale, International Journal of Material Forming, 2011.
DOI: 10.1007/s12289-010-1017-4 -
(2011): Prozessoptimiertes Presshärten mittels Sprühkühlung – prozessintegrierte Wärme-behandlung von Blechen des Werkstoffes 22MnB5, In: HTM - Journal of Heat Treatment and Materials 2011 (6), S. 316–322. Online verfügbar unter http://www.htm-journal.de/HT110118
-
(2011): Comparative analysis of supra- and subgingival biofilm formation on polytetrafluorethylene and titanium surfaces of implant abutments., Int J. Prosthodontics (24), S. 373–375.
-
(2011): Mikrostrukturelle Pressschweißnahtcharakterisierung im strangpressten Zustand für Al-Mg-Si-Legierungen: Microstructural weld seam characterisation in the as extruded condition for Al-Mg-Si-alloys, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 531-541, 2011.
-
(2011): Das Institut für Werkstoffkunde der Leibniz Universität Hannover stellt seinen Bereich FORTIS vor, Thermal Spray Bulletin, Nr. 4/11, S. 14-19, 2011.
-
(2011): Präparations- und Analysestrategie zur Untersuchung verformungsinduzierter Poren in kaltverfomtem Stahl, Praktische Metallographie Vol. 48, Nr. 5, S. 232-238, 2011.
-
(2011): Correlation of temperature-speed extrusion parameters; tool design and quality of profiles of magnesium alloys, Metallurgical and mining industry 3, 2011 (7), 23-31
-
(2011): Mit Spraykühlung Ressourcen schonen , Phi – Produktionstechnik Hannover informiert 2/2011, S. 12-13
-
(2011): Economic surface hardening by spray cooling, HTM - Journal of Heat Treatment and Materials 66 (5), S. 290–296.
-
(2011): Modification of the mechanical anisotropy in extrudet AZ31 sheets, Key Engineering Materials Vol. 473, S. 490-497, 2011.
-
(2011): Twin-roll casting of high-strength age-hardened aluminium alloys., Metallurgical and mining industry 7 (3), S. 7–16.
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell, Biomaterialien; 12; 1-4; S. 51
-
(2011): Untersuchung der Biokompatibilität von degradablen Magnesiumlegierungen im Vergleich zu Titan im Kaninchenmodell., Biomaterialien 12 (1-4), S. 51.
-
(2011): Structure and properties of beaded welds created under water by power wire, Obrabotka Metallov 50 (1), S. 31–37
-
(2011): Investigation of the influence of low cycle bending on the properties of thin sheets, International Aluminium Journal Vol. 87, Nr. 7-8, S. 60-62, 2011.
-
(2011): Investigation of the influence of low cycle alternating bending loads on the properties of thin sheets possessing different crystal lattice structures, Metallurgical and mining industry 3 (7), S. 69–73
-
(2011): Einsatz innovativer Fügetechnologien und korrosionsschutzgerechter Designs an 200-l-Gebinden zur sicheren Lagerung schwach- und mittelradioaktiver Abfälle, atw-International Journal for Nuclear Power 56 (10), S. 553–558
-
(2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structures, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
-
(2011): Novel Repair Concept for Composite Materials by Repetitive Geometrical Interlock Elements, Materials 2011, 4; pp. 2219-2230.
-
(2011): Magnetic Magnesium Alloys based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 13, S. 1-7
DOI: 10.1002/adem.201100197 -
(2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die Druckindustrie, In: Thermal Spray Bulletin 4 (2), S. 114–120.
-
(2011): Comparative analysis of long-term biofilm formation on metal and ceramic brackets , Angle Orthodontist, 81-5, S. 907-914
-
(2011): Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2, Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
-
(2011): The multi-scale physical and numerical modeling of fracture phenomena in the MgCa0.8 alloy, Computers & Structures 89, S. 1038–1049
-
(2011): The development with help of boundary element method, calibration and verifica-tion of the model of fracture of special magnesium alloys in microscale, In: Rudy i metale niezelazne 56 (11), S. 581–587
-
(2011): Schneiden und Schweißen von Kupfer mit dem Elektronenstrahl, Metall - Internationalle Fachzeitschrift für Metallurgie 65 (11), S. 507–511
-
(2011): Microstructural Behaviour of Tempering Steels during Precision Forging and Quenching from Hot-forming Temperatures, Metallurgical and Mining Industry, 2011, Vol. 3, No. 7, S. 79-86
-
(2011): Process Design for the Manufacturing of Magnetic Pulse Welded Joints, Key Engineering Materials Vol. 473, S. 243-250, 2011.
DOI: 10.4028/www.scientific.net/KEM.473.243 -
(2011): Orts- und temperaturabhängige Wärmeübergangskoeffizienten bei der Sprühkühlung von AlSi10Mg-Gussplatten, Forschung im Ingenieurwesen Vol. 75, Nr. 1, S. 25-34, 2011.
DOI: 10.1007/s10010-011-0131x -
(2011): Induction hardening of spur gearwheels made from 42CrMo4 hardening and tempering steel by employing spray cooling, Steel Research International Vol. 82, Nr. 4, S. 329-336, 2011.
DOI: 10.1002/srin.201000218 -
(2011): Sheet-bulk Metal Forming a New Process for the Production of Sheet Metal Parts with Functional Components, In: Metallurgical and mining industry 3 (7), S. 53–58.
-
(2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und Schneidwerkzeugen, Info-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
-
(2011): Ex vivo examination of the biocompatibility of biodegradable magnesium via microdialysis in the isolated perfused bovine udder model, Int. J. Artif. Organs Vol. 34, Nr. 1, S. 34-43, 2011.
-
(2011): Front Cover Advanced Materials 12/2011, Advanced Engineering Materials; Vol. 13; Iss. 12; http://onlinelibrary.wiley.com/doi/10.1002/adem.201190032/abstract; doi: 10.1002/adem.201190032
-
(2011): The Effect of Different Sterilization Methods on the Mechanical Strength of Magnesium Based Implant Materials, Advanced Engineering Materials.
DOI: 10.1002/adem.201100074 -
(2011): Comparison of the Corrosion Behavior of Coated and Uncoated Magnesium Alloys in an In Vitro Corrosion Environment, Advanced Engineering Materials
DOI: 10.1002/adem.201080144 -
(2011): Designentwicklung für einen resorbierbaren Magnesiumstent für die Nasennebenhöhlen, Biomaterialien 12 (1-4), S. 183
-
(2011): The manufacture of resorbable suture material from magnesium - drawning and stranding of thin wires, Advanced Engineering Materials 13, 2011, S. 1087-1095
DOI: 10.1002/adem.201100152 -
(2011): An Experimental and Numerical Assessment of Sheet-Bulk Formability of Mild Steel DC04, Journal of Manufacturing Science and Engineering 133 (6). Online verfügbar unter http://link.aip.org/link/?MAE/133/061008 More info
-
(2011): Influence of reactive process gases on zinc solders on aluminium and steel, Welding and Cutting 10 (5), S. 314–317
-
(2011): In Vivo Degradation Behavoir of the Magnesium Alloy LAN442 in Rabbit Tibiae, Materials, 4; 12; P. 2197
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, Uni Magazin (01|02 2011), S. 48–51
-
(2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, AlumniCampus (6), S. 32–35
-
(2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloy, Journal of Materials Science, Doi: 10.1007/s10853-011-5785-0
-
(2010): Friction and Temperature Development in the Hot Roll Cladding Process, Steel Research International Vol. 81, Nr. 1, S. 48-54, 2010.
-
(2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnaces, Key Engineering Materials, Nr. 438, S. 73-80, 2010.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn, Schweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
-
(2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfaces, Key Engineering Materials, Nr. 438, S. 123-129, 2010.
-
(2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus Leichtmetalllegierungen, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
-
(2010): Computation of isothermal transformation diagrams of 42CrMo4 steel from dilatometer measurements with continuous cooling., International Heat Treatment and Surface Engineering Vol. 4, Nr. 4, S. 171-175, 2010.
-
(2010): In vitro und in vivo Modelle zur molekularen Evaluierung der zellulären Reaktionen auf Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 19-21. Berlin: Walter de Gruyter, 2010.
-
(2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-Schneidstempelinlays, UTF science, Nr. III, S. 1-12, 2010.
-
(2010): Influence of hydrothermal and mechanical conditions on the strength of zirconia, Acta Biomaterialia Vol. 2010, Nr. 6, S. 4547-4552, 2010.
-
(2010): Anisotropy of Mechanical Properties of Magnesium Alloy AZ31 Sheets as a Result of Sign-Variable Bending Deformation, Metallurgical and Mining Industry. Vol. 2, Nr. 3, S. 215-219, 2010.
-
(2010): Vlijanie deformacii znakoperemennym izgibom na teksturu i anizotropiju uprugich svojstv listov nizkouglerodistoj stali, Materialovedenie Vol. 163, Nr. 10, S. 33-38, 2010.
-
(2010): Vlijanie cholodnoj pravki na teksturu i anizotropiju svojstv listov magnievogo splava AZ31, Deformacija i razruvenie, Nr. 8, S. 34-41, 2010.
-
(2010): Extrusion and Air-Water Cooling of AlSi1MgMn Alloy Extruded Profiles, Metallurgical and mining industry 2, 2010 (5), 355-362
-
(2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Galvanotechnik, Nr. 11, S. 2646-2650, 2010.
-
(2010): Reduction of biofilm on orthodontic brackets by use of a polytetrafluorethylene (PTFE) coating, European Journal of Orthodontics, Nr. 32, S. 414-418, 2010.
-
(2010): Setting of Gradient Material Properties and Quality Control of High Tension 3D NVEB-Weld Joints, Advanced Materials Research, Nr. 137, S. 375-411, 2010.
-
(2010): Development and biocompatibility of a novel corrodible fluoride-coated magnesium-calcium alloy with improved degradation kinetics and adequate mechanical properties for cardiovascular applications., Journal of Biomedical Materials Research Part A 93A (2), S. 763–775.
-
(2010): Suspension Plasma Spraying of triboactive coatings for high temperature applications, Key Engineering Materials, Nr. 438, S. 139-146, 2010.
-
(2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying process, Materialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
-
(2010): Mittendrin statt nur dabei: Die Werkstoffkunde, elementare Säule der Ingenieurwissenschaften, Phi Vol. 11, Nr. 2, S. 8-9, 2010.
-
(2010): The Possible Mechanism of Slip Band Formation, Sistemnye Technologii Vol. 70, Nr. 5, S. 162-166, 2010.
-
(2010): Untersuchung der mikrostrukturellen Werkstoffcharakteristik des Stahls DC06 bei der plastischen Umformung: Analysis on the micro structural material characteristic of the DC06 steel by the plastic deformation, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 10, S. 844-852, 2010.
-
(2010): Zerstörungsfreie Messmethoden zur Bestimmung des Warmauslagerungszustandes von Aluminiumlegierungen am Beispiel der Legierung EN AW-6082, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 8, S. 646-651, 2010.
-
(2010): Experimental twin-roll casting equipment for production of thin strips, Metallurgical and Mining Industry. Vol. 2, Nr. 5, S. 348-354, 2010.
-
(2010): Non-destructive, high-resolution 3D visualization of a cardiac defect in the chick embryo resembling complex heart defect in humans using Micro-Computed Tomography. Double outlet right ventricle (DORV) with left juxtaposition of atrial appendages (LJAA)., Circulation Vol. 122, Nr. 22, S. 561-564, 2010. More info
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, In: Key Engineering Materials 438, S. 147–154.
-
(2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, Key Engineering Materials Vol. 2010, Nr. 438, S. 147-154, 2010.
-
(2010): Einfluss einer alternierenden Biegebeanspruchung auf die mechanischen Eigenschaften der Magnesiumlegierung AZ31, Aluminium, Nr. 5, S. 55-58, 2010.
-
(2010): Comparison of the In Vivo Degradation Progress of Solid Magnesium Alloy Cylinders and Screw-Shaped Magnesium Alloy Cylinders in a Rabbit Model, Materials Science Forum, Nr. 638-642, S. 742-747, 2010.
-
(2010): The effect of two point mutations in GDF-5 on ectopic bone formation in a γ-tricalciumphosphate scaffold, Biomaterials Vol. 31, Nr. 14, S. 3878-3884, 2010.
-
(2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels Tomographie, Thermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
-
(2010): Kontrolliertes Bainitisieren trumpft in puncto Wirtschaftlichkeit auf, Maschinenmarkt, Nr. 24, S. 58-61, 2010.
-
(2010): Wirtschaftlich Bainitisieren mit neuem Wirbelstrom-Messsystem, Gaswärme International Vol. 59, Nr. 6, S. 472, 2010.
-
(2010): Degradation behaviour and mechanical properties of magnesium implants in rabbit tibiae., Journal of Materials Science (45), S. 624–632.
-
(2010): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach einer induktiven Hochgeschwindigkeitsaustenitisierung mit anschließendem Abschrecken, Journal of Heat Treatment and Materials Vol. 65, Nr. 2, S. 96-101, 2010.
-
(2010): Multi scale physical and numerical modelling of MgCa0,8 alloy tensile test in micro tensile/compression stage for a SEM, Computer Methods in Materials Science Vol. 10, Nr. 2, S. 61-68, 2010.
-
(2010): A model of ductility phenomena of MgCa0,8 alloy in cold forming process, Rudy i metale niezelazne Vol. 55, Nr. 4, S. 200-208, 2010.
-
(2010): Microstructure transformations in tempering steels during continuous cooling from hot forging temperatures, Steel Research Vol. 81, Nr. 3, S. 224-233, 2010.
-
(2010): Investigations into manufacturing composite profiles having local magnesium-foam reinforcements, Advanced Materials Research, Nr. 137, S. 129-160, 2010.
-
(2010): Simulation of gas and spray quenching during extrusion of aluminium alloys, Key Engineering Materials., Nr. 424, S. 57-64, 2010.
-
(2010): Der Forschungsverbund "Geothermie und Hochleistungsbohrtechnik", Geothermische Energie - Mitteilungsblatt des GtV-Bundesverbandes Geothermie e.V. Vol. 19, Nr. 68, S. 21-23, 2010.
-
(2010): Phase diagram of PMMA/PVDF-blends and effect of mixture-intensity on crystallization behavior, Polym. Mater. Sci. Eng, Nr. 239, S. 5951-5952, 2010.
-
(2010): Primäre porcine Nasenepithelzellen als Modell zur Untersuchung der Biokompatibilität von Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 79-81. Berlin: Walter de Gruyter, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, AlumniCampus, Nr. 4, S. 44-46, 2010.
-
(2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, Unimagazin, Nr. 1, S. 48-50, 2010.
-
(2010): The Manufacture of Resorbable Suture Material from Magnesium, Advanced Engineering Materials Vol. 12, Nr. 11, S. 1099-1105, 2010.
-
(2010): Comparison of the Cross Sectional Area, the Loss in Volume and the Mechanical Properties of LAE442 and MgCa0.8 as Resorbable Magnesium Alloy Implants after 12 Months Implantation Duration, Materials Science Forum, Nr. 638-642, S. 675-680, 2010.
-
(2010): Development and application of magnetic magnesium for data storage in gentelligent products, Journal of Magnetism and Magnetic Materials Vol. 322, Nr. 9-12, S. 1134-1136, 2010.
-
(2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen Diamanten, Schweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
-
(2010): Izmenenie mechaniceskich svojstv lista iz splava AZ31 v rezul'tate rolikovoj pravki, Rolling, Nr. 1, S. 3-6, 2010.
-
(2009): Crystallization of supercooled silicon droplets initiated through small silicon nitride particles, Journal of Crystal Growth Vol. 311, Nr. 5, S. 1250-1255, 2009.
-
(2009): Nonvacuum electron beam welding of structural steels, The Paton Welding Journal, Vol. 2009, Nr. 5, pages 22-26.
-
(2009): Entfestigung von Blechen aus der Mg-Legierung AZ31 beim alternierenden Biegen, Deformation & Fracture of Materials, Nr. 5, 2009.
-
(2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im Schutzgasdurchlaufofen, INFO-SERVICE, Nr. 20, S. 16-19, 2009.
-
(2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im Schutzgasofen, INFO-SERVICE, Nr. 20, S. 6-11, 2009.
-
(2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle, Schweißen und Schneiden, Nr. 7, S. 358-368, 2009.
-
(2009): Gießformen mit Kapillareffekt, Gießerei-Erfahrungsaustausch, Nr. 3, S. 22-23. Düsseldorf: Gießerei-Verlag GmbH, 2009.
-
(2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und Korrosionsschutz, Thermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
-
(2009): Manufacturing of Reinforced High Precision Forging Dies, Steel Research International, Nr. 12, S. 878-886, 2009.
-
(2009): New Developments in Non-destructive Testing for Quality Assurance in Component Manufacturing, Steel research int Vol. 80, Nr. 12, S. 916-928, 2009.
-
(2009): Kleine Poren - große Wirkung: Magnesiumschwämme als bioresorbierbare Implantate, Orthopädie im Profil, Nr. 1, S. 14-15, 2009.
-
(2009): Analysis of supra- and subgingival long-term biofilm formation on orthodontic bands, European Journal of Orthodontics, Nr. 31, S. 202-206, 2009.
-
(2009): Surface Hardening Spline Geometries of Heat-Treatable Steel Cf53 using Water-Air Spray Cooling, Materials Working by Pressure - Collection of science papers Vol. 20, Nr. 1, S. 270-275, 2009.
-
(2009): Experimental research of pressing strips made of Mg-Al-Zn-Mn system alloy through precombustion chamber matrixes, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 255, Nr. 3, S. 88-91, 2009.
-
(2009): Das Zwei-in-einem-Prinzip. Integrierte Wärmebehandlung präzisionsgeschmiedeter Bauteile, Technologie-Informationen, Innovation Niedersachsen, Nr. 2, S. 10, 2009.
-
(2009): Manufacturing Surface Hardened Components of 42CrMo4 by Water-Air Spray Cooling, Steel Research International Vol. 80, Nr. 12, S. 906-915, 2009.
-
(2009): Verbundstrangpressen von Titan-Aluminium-Verbindungen, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 12, S. 901-906, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Magnesium-based Resorbable Implants on the Degradation Behaviour in Rabbits, Advanced Engineering Materials Vol. 11, Nr. 5, S. B47-B54, 2009.
-
(2009): Influence of Different Surface Machining Treatments of Resorbable Magnesium Alloy Implants on Degradation: EDX-Analysis and Histology Results, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 88-93, 2009.
-
(2009): Im Fertigungsprozess lassen sich Bauteile spezifisch optimieren, Maschinenmarkt Vol. 44, S. 26-29, 2009.
-
(2009): In-situ high temperature microstructural analysis during tempering of 42CrMo4 using transmission electron microscopy, International Journal of Materials Research Vol. 2009, Nr. 7, S. 991-1000, 2009.
-
(2009): Multiscale modeling and interpretation of tensile test of magnesium alloy in microchamber for the SEM, Computer Methods in Materials Science Vol. 9, Nr. 2, S. 207-214, 2009.
-
(2009): Isothermal Microstructural Transformations of the Heat-treatable Steel 42CrMo4 during Heat-treatment following Hot-forming, Steel Research International Vol. 80, Nr. 12, S. 892-898, 2009.
-
(2009): Simulation of Integrated Heat-treatment of Precision Forged Components, Steel Research International Vol. 80, Nr. 12, S. 899-905, 2009.
-
(2009): Spray cooling of aluminium chassis frames, Sucasni problemy metalurhii Vol. 12, S. 92-99, 2009.
-
(2009): Prediction of continuous cooling diagrams for the precision forged tempering steel 50CrMo4 by means of artificial neural networks, Advances in Materials Science and Engineering, 2009.
-
(2009): Legierungsentwicklung zur Verschleißreduzierung von Schmiedegesenken -Einfluss von Mangan auf die Absenkung der Ac1b-Temperatur, HTM - Journal of Heat Treatment and Materials Vol. 64, Nr. 5, S. 291-296, 2009.
-
(2009): Eddy current technology - a new procedure for the detection of zero-gap grooves during laser welding, Welding and Cutting Vol. 8, Nr. 6, S. 359-364, 2009.
-
(2009): Experimentelle Untersuchungen der Mikrostrukturentwicklung und mechanischen Eigenschaften von Metallen mittels Zug/Druck/Biegemodul im Rasterelektronen-mikroskop, In: Praktische Metallographie 41 (Sonderband zur 43. Metallographie-Tagung), S. 139–144.
-
(2009): In Vitro Testing of Biodegradable Implants, Journal of Veterinary Pharmacology and Therapeutics Vol. 32, Nr. s1, S. 264-265, 2009.
-
(2009): In-Vitro Biocompatibility Testing of Degradable Magnesium-Based Alloys on Murine Fibroblasts L929, Naunyn-Schmiedeberg's Archives of Pharmacology Vol. 379, Nr. Suppl.1, S. 70, 2009.
-
(2009): Structure investigation of austenitic steel after cold rolling deformation, Sucasni problemy metalurhii Vol. 12, S. 107-113, 2009.
-
(2009): Wirbelstromtechnik - ein neues Verfahren zur Detektion von Nullspaltfugen bei Laserstrahlschweißen, Schweissen und Schneiden Vol. 61, Nr. 9, S. 520-527, 2009.
-
(2009): Scale-dependent hierarchy of structural elements in the microstructure of thermomechanical treated ferritic steels with residual austenite, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 9, S. 704-712, 2009.
-
(2009): Comparison of the resorbable magnesium alloys LAE442 und MgCa0.8 concerning their mechanical properties, their progress of degradation and the bone-implant-contact after 12 months implantation duration in a rabbit model, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 1-2, S. 82-87, 2009.
-
(2009): Influence of a magnesium-fluoride coating of magnesium-based implants (MgCa0.8) on degradation in a rabbit model, Journal of Biomedical Materials Research, 2009.
-
(2009): Nanopartikel als Kornfeiner: Jahresbericht Produktionstechnisches Zentrum Hannover 2008, , S. 74, 2009.
-
(2009): Thermographic analysis of AlSi12 during crystallization as a function of cooling rate, International Journal of Materials Research Vol. 100, Nr. 1, S. 97-103, 2009.
-
(2009): Effect of alternating bending on the structure and properties of strips from AZ31 magnesium alloy, Metallovendenie Vol. 646, Nr. 4, S. 20-25, 2009.
-
(2008): Hybrides Walzen am Beispiel von Titan-Aluminium-Verbunden, Materialwissenschaft und Werkstofftechnik Vol. 39, Nr. 9, S. 588-593, 2008.
-
(2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Schweißen und Schneiden, Nr. 4, S. 192-199, 2008.
-
(2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
-
(2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten Pulvern, Schweißen und Schneiden, Nr. 11, S. 625-631, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
-
(2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal spraying, Thermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
-
(2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von Aluminiumwerkstoffen, Materialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
-
(2008): Verfahren zur Einbringung und Wiedergabe von Daten in Sinterbauteilen, Metall - Internationalle Fachzeitschrift für Metallurgie Vol. 62, Nr. 5, S. 298-301, 2008.
-
(2008): Investigation of Load Adapted Gears and Shafts Manufactured by Compound-Forging, Journal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
-
(2008): Analyse der Besonderheiten beim Strangpressen von bimetallischen Aluminium-Magnesium-Verbunden, Theorie und Praxis der Metallurgie, Nr. 5-6, S. 46-50, 2008.
-
(2008): Efficient Modelling and Simulation of Process Chains in Sheet Metal Forming and Processing, Steel Research International Vol. 79, Nr. 10, S. 731-737, 2008.
-
(2008): Supra- and subgingival biofilm formation on implant abutments with different surface characteristics, International Journal of Oral & Maxillofacial Implants Vol. 23, Nr. 2, S. 327-334, 2008.
-
(2008): Influence of the die geometry parameters on the quality of the aluminum thick -wall extruded strips, Herald of the DSEA, Nr. 3E (14), S. 27-39, 2008.
-
(2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Schweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
-
(2008): Analyse der initialen Biofilmbildung auf oberflächenmodifizierten Healing-Abutments, Deutsche Zahnärztliche Zeitschrift Vol. 63, Nr. 9, S. 632-638, 2008.
-
(2008): Einfluss verschiedener Implantate aus Magnesiumlegierungen auf den periostalen Knochenzuwachs in der Kaninchentibia, Biomaterialien Vol. 9, Nr. 1/2, S. 66, 2008.
-
(2008): Bainite Sensor - A new tool for process and quality control of the bainite transformation, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 3, S. 174-180, 2008.
-
(2008): Resorbierbare Marknägel auf Magnesiumbasis, Schweizer Maschinenmarkt, Nr. 1/2, S. 94-99, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Spraykühlung, HMT - Journal of Heat Treatment and Materials - Zeitschrift für Werkstoffe, Wärmebehandlung, Fertigung Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Sprühkühlung., HTM, Härterei-Technische Mitteilungen Vol. 63, Nr. 1, S. 22-26, 2008.
-
(2008): Wärmeübergangs- und Tropfencharakteristik für eine Spraykühlung im Temperaturbereich von 900 °C bis 100 °C, Forschung im Ingenieurwesen Vol. 72, Nr. 3, S. 163-173, 2008.
-
(2008): Herstellung von offenporigen Magnesium-Keramik-Implantaten, Biomaterialien Vol. 9, Nr. 3/4, S. 110, 2008.
-
(2008): Are resorbable implants about to become a reality? , Cardiology in the Young (16), S. 107–116.
-
(2008): The Manufacture and Characterisation of Reinforced Magnesium Foams, Steel Research International Vol. 79, Nr. 3, S. 185-190, 2008.
-
(2008): High Strength 3D Non-Vacuum Electron Beam Weld Joints - Setting of Gradient Material Properties and Testing of Weld Quality, Steel research int Vol. 79, Nr. 3, 2008.
-
(2008): Nachweis von Anrissen in der Randzone von Hochleistungsbauteilen mit Wirbelstromtechnik und induktiv angeregter Thermographie, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 5, S. 284-297, 2008.
-
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, Schweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
-
(2008): Einfluss einer Magnesiumfluoridbeschichtung auf die Degradation von MgCa0,8-Implantaten in vivo, Biomaterialien Vol. 9, Nr. 3/4, S. 99, 2008.
-
(2008): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, Schweissen und Schneiden Vol. 60, Nr. 4, S. 205-210, 2008.
-
(2007): Magnesium sponges as a bioabsorbable Material: Attributes and Challenges, Zeitschrift für Metallkunde: International Journal of Materials Research Vol. 98, Nr. 7, S. 609-612, 2007.
-
(2007): Developments for the Production of Locel Foamed Hollow Sections, Advanced Engineering Materials, Nr. 22, S. 37-47, 2007.
-
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folien, Schweißen und Schneiden, Nr. 2, S. 78-83, 2007.
-
(2007): Schneid- und Dekontiminationstechnologien für den kostengünstigen Rückbau kerntechnischer Anlagen, awt Vol. 52, Nr. 4, S. 256-262, 2007.
-
(2007): The FEM simulation of a magnesium alloy wire drawing for chirurgical applications, Hutnik - Polish Journal of Metallurgy Vol. 74, Nr. 1-2, S. 8-11, 2007.
-
(2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit Kupfer, Materialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
-
(2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal Composites, The Welding Journal, Nr. 86, S. 373-378, 2007.
-
(2007): Zerstörungsfreie Bestimmung von Härtekennwerten zur Qualitätssicherung von Hochleis-tungsbauteilen in der Fertigung, HTM - Journal of Heat Treatment and Materials Vol. 62, Nr. 6, S. 265-273, 2007.
-
(2007): Wasserstrahl erstetzt die Säge, Krankenhaus Technik + Management, Ausgabe 6, Juni 2007, S.40
ISBN: ISSN 1619-4772 B 1494 -
(2007): Wasserabrasivstrahlen als medizinisches Werkzeug, Schweizer Maschinenmarkt, Ausgabe 14/15, 108. Jahrgang, Juli 2007, S. 62-63
-
(2007): Untersuchungen zur Biokompatibilität von Magnesiumlegierungen als degradable Implantatwerkstoffe, Biomaterialien Vol. 8, Nr. 3, S. 183, 2007.
-
(2007): Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron Microscope, Microscopy and Microanalysis, S. 104-105, 2007.
-
(2007): Analysis of early biofilm formation on oral implants in man, Journal of Oral Rehabilitation Vol. 34, Nr. 5, S. 377-382, 2007.
-
(2007): Einfluss unterschiedlicher Oberflächenbearbeitung von resorbierbaren Magnesiumimplantaten: Histologische Ergebnisse, Biomaterialien Vol. 8, Nr. 3, S. 213, 2007.
-
(2007): Application of Ti-6Al-4V for Tissue Engineering, Engineering of Biomaterials, Nr. 69-72, S. 18-22, 2007.
-
(2007): Zellkulturmodelle zur Evaluierung von Magnesiumlegierungen als degradierbare Implantatmaterialien, Biomaterialien Vol. 8, Nr. 3, S. 189, 2007.
-
(2007): ABRASIVE WATER SUSPENSION JET TECHNOLOGY - FUNDAMENTALS; APPLICATION AND DEVELOPMENTS, Welding in the World Vol. 51, Nr. 9/10, 2007.
-
(2007): Entwicklung der mechanischen Eigenschaften von degradablen intramedullären Implantaten auf Magnesiumbasis nach unterschiedlicher Implantationsdauer, Biomaterialien Vol. 8, Nr. 3, S. 180, 2007.
-
(2007): Mit neuen Prozessketten zu wirtschaftlicher Mikrofertigung, Mikroproduktion, Nr. 4, S. 18-22, 2007.
-
(2007): Der Einfluss von Subchondralen Magnesiumimplantaten auf das peri-implantäre Gewebe, Biomaterialien Vol. 8, Nr. 3, S. 188, 2007.
-
(2007): Setting of gradient material properties and quality control of high tension 3D-weld joints, Advanced Materials Research Vol. 22, S. 113-125, 2007.
-
(2007): Vergleich der resorbierbaren MagnesiumlegierungenLAE442 und MGCa0,8 bezüglich der Degradation und Biokompatibilität im Zeitraum von 12 Monaten, Biomaterialien Vol. 8, Nr. 3, S. 182, 2007.
-
(2006): Resorbowalne, metaliczne implanty kostne/Resorbing Metallic Bone Implants, Orthopedic Quarterly, Nr. 2, S. 105-110, 2006.
-
(2006): Magnesium Compound Structures for the Treatment of Bone Defects, Engineering of Biomaterials, Nr. 56-57, S. 58-61, 2006.
-
(2006): Design and Resorption Properties of the Metal bone Implants: Application in-vivo, Engineering of Biomaterials, Nr. 56-57, S. 54-58, 2006.
-
(2006): Particle Image Velocimetry in Thermal Spraying, Advanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.
-
(2006): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, Schweißen und Schneiden, Nr. 2, S. 84-90, 2006.
-
(2006): Simulation des Abschreckhärtens mittels Spraykühlung~- Wärmeübergang, Gefüge und Härte, HTM Vol. 61, Nr. 3, S. 142-147, 2006.
-
(2006): Bestimmung der Streckgrenze und der Hall-Petch-Konstanten des Vergütungsstahles 42CrMo4 unterschiedlichen Gefügezustandes mittels Eindruckprüfungen, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 8, S. 668-673, 2006.
-
(2006): Heat Generation During Abrasive Water-Jet Osteotomies Measured by Thermocouples, Journal of Mechanical Engineering, Vol. 52, No. 7-8, July/Aug.2006, S. 451-457
ISBN: ISSN 0039-2480 -
(2006): New resorbable metal and polymer implants for bone surgery, Materialy i Technologie, Nr. 4, S. 57-62, 2006.
-
(2006): The influence of direct extrusion process parameters on the temperature of profile of aluminium alloy, Metallurgiceskaja i gornorudnaja promyvlennost', Nr. 6, S. 39-42, 2006.
-
(2006): Einfluss der Oberflächenbearbeitung von resorbierbaren Implantaten wus verschiedenen Magnesium-Calciumlegierungen auf die Degradation: Erste Ergebnisse einer Pilotstudie am Kaninchenmodell, Deutsche tierärztliche Wochenschrift Vol. 113, Nr. 10, S. 439-446, 2006.
-
(2006): The Influence of the Surface Machining of Resorbable Implants made of Magnesium Alloys on Degradation in rabbits, Biomaterialien Vol. 7, Nr. 1, S. 122, 2006.
-
(2006): Messung der Spraycharakteristik zur Bestimmung des Wärmeübergangskoeffizienten bei der Spraykühlung, Forschung im Ingenieurwesen, Springer Verlag Vol. 70, Nr. 4, S. 237-242, 2006.
-
(2006): Annealing of the edge-layer of precision forged gears of 42CrMo4 by a two-phase spray cooling, Vestnik NTUU KPI, Nr. 48, S. 33-36, 2006.
-
(2006): Contact-Arc-Metal-Cutting (CAMC) - Eine junge Schneidtechnologie ist den Kinderschuhen entwachsten, awt Vol. 51, Nr. 3, S. 170-172, 2006.
-
(2006): Changes of the surfaces of different magnesium alloys as degradable implants during degradation in rabbit tibiae, Biomaterialien Vol. 7, Nr. 1, S. 92, 2006.
-
(2006): Simulation of the γ-grain size evolution during precision forging of helical gears made of tempering steel 42CrMo4, Vestnik NTUU KPI, Nr. 48, S. 36-41, 2006.
-
(2006): Cartilage repair on magnesium implants as scaffolds used as subchondral bone replacement, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 6, S. 504-508, 2006.
-
(2005): Macroscopic damage by the formation of shear bands during the rolling and deep drawing of magnesium sheets, JOM Journal of the Minerals, Metals and Materials Society 57 (5), S. 57–61.
-
(2005): Joining of Steel-Aluminium Hybrid Structures with Electron Beam on Atmosphere, Advanced Materials Research 6-8, 2005, 143-150
DOI: 10.4028/www.scientific.net/AMR.6-8.143 -
(2005): Elektrochemisch induzierte Abscheidung von Calciumphosphat auf der Oberfläche von kompakten und zellularen Strukturen aus Magnesiumlegierungen, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6)
-
(2005): Resorbierbare Implantate aus Magnesium durch Mikrolegieren mit Calcium, deren Verarbeitung und Eigenschaften, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Calculation of the flow field during contact arc metal cutting under water, Welding and Cutting Vol. 4, Nr. 4, 2005.
-
(2005): Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter Beschichtungen, Materialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.
-
(2005): Ultraschallassistiertes Flammlöten von Aluminiumlegierungen, Schweißen und Schneiden, Nr. 9, S. 482-487, 2005.
-
(2005): Simulation of the microstructure transformation in quenched gears after precision forging of the tempering steel 42CrMo4, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 232, Nr. 4, S. 48-51, 2005.
-
(2005): Außen hart und Innen weich - Randschichtvergüten durch Zweiphasenspray, phi - Produktionstechnik Hannover informiert Vol. 6, Nr. 4, S. 10-11, 2005.
-
(2005): Statistische Beschreibung der Tropfengrößenverteilung bei stationären Zerstäubungsprozessen., Forschung im Ingenieurwesen Vol. 69, Nr. 3, S. 181-186, 2005.
-
(2005): Lasergepulster Reinwasserstrahl zur Erhöhung der Abtragsleistung, Laser Magazin, Ausgabe 5, Okt. 2005, S. 9-12
-
(2005): Selten Erden-haltige Magnesiumlegierungen als degradable, intramedulläre Implantate in Kanninchentibae, Biomaterialien Vol. 6, Nr. 3, S. 190, 2005.
-
(2005): Evaluation verfahrensspezifischer Risikopotentiale der Wasserabrasivstrahl-Osteotomie in-vivo, Biomedizinische Technik, Band 50, Heft 10, Okt. 2005, S. 337-342
ISBN: ISSN 0013-5585 -
(2005): Ionen-Leakage aus Implantaten führt zu Materialversagen und Inflammation des peri-Implantat Gewebes, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Korrosion kardiovaskulärer Implantate auf Wolframbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2004): Non-Vacuum-Electron-Beam-Welding - A BEAM PROCESS FOR WELDING ZINC COATED HIGH-STRENGTH STEELS AND STEEL-ALUMINIUM HYBRID STRUCTURES, Laser Assisted Net Shape Engineering Vol. 4, 2004.
-
(2004): Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work step, Welding and Cutting, Nr. 2, 2004.
-
(2004): Brechnung des Strömungsfelds beim Kontakt-Lichtbogen-Metallschneiden unter Wasser, Welding and Cutting Vol. 56, Nr. 11, S. 586-592, 2004.
-
(2004): Precision brazing processes for MEMS technology, Welding and Cutting, Nr. 6, S. 340-342, 2004.
-
(2004): Particle Image Velocimetry in Thermal Spraying, Materials Science and Engineering A, S. 146-152., 2004.
-
(2004): Mathematical model for the decision of temperature task at production of types from magnesium alloys, Metallurgiceskaja i gornorudnaja promyvlennost', Nr. 5, S. 37-40, 2004.
-
(2004): Schutzschichten für Lötmaschinen zum bleifreien Löten, Schweißen und Schneiden, Nr. 5, S. 244-248, 2004.
-
(2003): Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem Arbeitsschritt, Schweißen und Schneiden, Nr. 10, S. 560-565, 2003.
-
(2003): Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide Matrix, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.
-
(2003): Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, in, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Jahrbuch Schweißtechnik 2003, S. 138-143, 2003.
-
(2003): Präzisionslötverfahren für die MEMS-Technik, Schweißen und Schneiden, Nr. 12, S. 672-674, 2003.
-
(2003): Hartlöten dünner Bauteile aus Titanlegierungen mit partieller Erwärmung, Schweißen und Schneiden, Nr. 8, S. 432-435, 2003.
-
(2003): Partial-heating brazing of thin components made of titanium alloys, Welding and Cutting, Nr. 6, S. 340-342, 2003.
-
(2003): Influence of lithium on hcp magnesium alloys, Trans Tech Publ Materials Science Forum (419-422), S. 1037–1042.
-
(2003): Non vacuum electron beam welding of light sheet metals and steel sheets, Welding in the World 47, 2003 (3-4), 4-10
-
(2003): Oberflächentechnik für moderne Lötanlagen für bleifreie Lote, Der Praktiker, Nr. 4, S. 116ff., 2003.
-
(2002): Magnesiumkorrosion - Prozesse, Schutz von Anode und Kathode, Magnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.
-
(2001): Entwicklung einer neuen Metallgießtechnik für die Mikromechanik, Zeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.
-
(2001): Keramik-HM-Bohrer für kleine Durchmesser, Werkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.
-
(2000): Gießtechnisches Herstellverfahren für Magnesiumschäume, Materialwissenschaft und Werkstofftechnik Vol. 31, Nr. 6, S. 419-421, 2000.
-
(1999): Löten - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.
-
(1999): Gelötete Metall-Keramik-Verbunde, Metallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.
-
(1999): Dünnschichttechnologie - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.
-
(1999): Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von Modellsystemen, Metallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.
Books
-
(2019): Das ENCON-Behälterkonzept – Generische Behältermodelle zur Einlagerung radioaktiver Reststoffe für den interdisziplinären Optionenvergleich, Hannover, ENTRIA-Arbeitsbericht-16
ISSN: 2367-3532 -
(2019): Handbuch Hochtemperatur-Werkstofftechnik. Grundlagen, Werkstoffbeanspruchungen, Hochtemperaturlegierungen und -beschichtungen, 6. Auflage, Springer Vieweg, Wiesbaden, 2019
ISBN: 978-3-658-25313-4 -
(2012): Forschung für die Praxis P 714. Qualifizierung des Nonvakuum-Elektronenstrahlschweißens zum Fügen höherfester Stahlfeinbleche im Automobilbau, Düsseldorf: Verlag und Vertriebsgesellschaft mbH
ISBN: 978-3-942541-20-6 -
(2010): "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme". Vortragsband zum Kolloquium des Graduiertenkolleg 1378/1., LWT, TU Dortmund. Unter Mitarbeit von W. Tillmann, T. Plorin und B. Rüther. Garbsen: PZH Produktionstechnisches Zentrum. Online verfügbar unter http://www.gbv.de/dms/tib-ub-hannover/626868181.pdf. More info
Contribution to Books
-
(2024): Manufacturing and Evaluation of Multimaterial Cylindrical Rolling Bearings by Plasma-Transferred Arc Welding, Bearing and Transmission Steels Technology, West Conshohocken, ASTM International, 2024, 201-226
DOI: 10.1520/STP164920220106 -
(2024): Near Net Shape Turbine Blade Repair Using a Joining and Coating Hybrid Process, Regeneration of Complex Capital Goods, 1. Auflage, Springer, Cham, 2025
DOI: 10.1007/978-3-031-51395-4_7 -
(2024): Improving Repair Braze Gap Strength Through the Development of a Novel Superalloy Filler, Superalloys 2024: The Minerals, Metals & Materials Series, 1. Auflage, Springer, Cham, 2024
DOI: 10.1007/978-3-031-63937-1_90 -
(2023): Wire-and-arc-additive-manufacturing of a component with a pre-defined hardness profile, Springer, Cham. In: Lachmayer, R., Bode, B., Kaierle, S. (eds) Innovative Product Development by Additive Manufacturing 2021
DOI: 10.1007/978-3-031-05918-6_2 -
(2023): Ontology-Based Documentation of Quality Assurance Measures Using the Example of a Visual Inspection, In: Valle, M. et al. (Hrsg.): Advances in System-Integrated Intelligence. Springer International Publishing, Cham, 2023, S. 415-424
-
(2022): Technical Monitoring and Long-Term Governance of Nuclear Waste, Nomos Verlagsgesellschaft mbH & Co. KG, 2022
DOI: 10.5771/9783845286594 -
(2021): Fatigue Behavior of Sheet-Bulk Metal Formed Components, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 412-433
DOI: 10.1007/978-3-030-61902-2_18 -
(2021): Analysis of Path-Dependent Damage and Microstructure Evolution for Numerical Analysis of Sheet-Bulk Metal Forming Processes, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 378-411
DOI: 10.1007/978-3-030-61902-2_17 -
(2021): Numerical Development of a Tooling System for the Co-extrusion of Asymmetric Compound Profiles on a Laboratory Scale, In: Behrens, B.-A. et al. (Hrsg.): Production at the leading edge of technology. WGP2020, Dresden, 23.09.-24.09.2020. Springer, Berlin, 2021, S. 66-75
DOI: 10.1007/978-3-662-62138-7_7 -
(2021): Fatigue Life Compliant Process Design for the Manufacturing of Cold Die Rolled Components, In: Merklein, M.; Tekkaya, A. E.; Behrens, B.-A. (Hrsg.): Sheet Bulk Metal Forming. Research Results of the TCRC73 2020. Springer, Cham, 2021, S. 568-585
DOI: 10.1007/978-3-030-61902-2_26 -
(2020): Erweiterung der Prozessgrenzen bei der Weiterverarbeitung von gewalztem Halbzeug durch Analyse der Ursache-Wirkungs-Beziehungen beim Planrichten, Europäische Forschungsgesellschaft für Blechverarbeitung e.V, Hannover, 2020
ISBN: 978-3-86776-579-4 -
(2020): Manufacturing and Virtual Design to Tailor the Properties of Boron-Alloyed Steel Tubes, In: Wriggers, P.; Allix, O.; Weissenfels, C. (Hrsg.): Virtual Design and Validation. Lecture Notes in Applied and Computational Mechanics 93. Springer, Cham, 2020, S. 21-44
-
(2018): Fluiddurchströmbare, transpirierende thermisch gespritzte Schichten, In: Clausthaler Zentrum für Materialtechnik, C. Z. f. (Hrsg.): Berichtsband Clausthaler Zentrum für Materialtechnik. Shaker, Herzogenrath, 2018, S. 137-147
-
(2017): Storing the load history of a component in the subsurface region, In: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 67-84
ISBN: 978-0-12-811939-6 -
(2017): Data storage within the subsurface of a component by local heat treatment, In: Denkena, B.; Mörke, T. (Hrsg.): Cyber-physical and gentelligent systems in manufacturing and life cycle. Elsevier, London, 2017, S. 85-99
-
(2017): Cardiovascular Applications of Magnesium Alloys, In: Aliofkhazraei, M. (Hrsg.): Magnesium Alloys. InTech, Rijeka, Croatia, 2017, S. 191-217
DOI: 10.5772/66182 -
(2016): Verfahren und Methoden zur Transplantation thermisch gespritzter Schichten für Druckgussteile, In: Biermann, D. (Hrsg.): Spanende Fertigung. Prozesse, Innovationen, Werkstoffe. Vulkan, Essen, 2016, S. 88-93
ISBN: 978-3-8027-2989-8 -
(2015): Development of Magnesium Alloy Scaffolds to Support Biological Myocardial Grafts: A Finite Element Investigation, Lenarz, T.; Wriggers, P. (Hg.): Biomedical Technology, Publishing Lecture Notes in Applied and Computational Mechanics 74, Springer International Publishing, Switzerland, S. 81-100
DOI: 10.1007/978-3-319-10981-7_6
ISBN: 978-3-319-10980-0 -
(2014): Microstructured thermally sprayed surfaces, B. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92
-
(2014): Mess- und Prüftechnik, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 311-430
-
(2014): High Frequency Eddy-Current and Induction Thermography Inspection Techniques, In: Capova, K. (Hrsg.): Electromagnetic nondestructive evaluation (XVII), ISBN 978-1-61499-407-7, S. 226-233
DOI: 10.3233/978-1-61499-407-7-226
ISBN: 978-1-61499-407-7 -
(2014): Werkzeugtechnologie, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 53-125
ISBN: 978-3-642-34663-7 -
(2014): Hot Stamping and subsequent spray cooling: A new manufacturing approach, Prof. O. N. Golovko, Plastic Deformation of Metals, 2014, Akzent PP, Dnipropetrovsk, S. 36-55
ISBN: 978-617-7109-18-0 -
(2014): Wärmebehandlung, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 127–220
-
(2012): Rare Earth Metals as Alloying Components in Magnesium Implants for Orthopaedic Applications, In: W.A Monteiro (Hg.): New Features on Magnesium Alloys: InTech, S. Chapter 4.
-
(2012): Thermal Spraying of Oxide Ceramic and Ceramic Metallic Coatings, In: F. Shi (Hg.): Ceramic Coatings - Applications in Engineering. Rijeka (Kroatien): InTech - Open Access Publisher.
-
(2011): ZrO2-Keramiken mit oberflächennahen Diffusionsschichten zur Anwendung in der dentalen Prothetik, E. Steinhauser und H.-F. Zeilhofer (Hg.): Biomaterialien (1-4, 12), S. 132.
-
(2010): Entwicklung und Herstellung von selbstschützenden Doppelmantel-Fülldrahtelektroden zum kontinuierlichen Unterwasserschweißen, DVS (Hg.): DVS - Jahrbuch Schweißtechnik 2011: DVS-Verl., Verl. für Schweißen und Verwandte Verfahren, S. 183–191.
-
(2010): Stabilisierende Magnesiumstrukturen zur Unterstützung von kardiovaskulärem Gewebeersatz im Hochdrucksystem, Zukunftsfähige bioresorbierbare und permanente Implantate aus metallischen und keramischen Werkstoffen, Sonderforschungsbereich SFB 599, Druckerei der Medizinischen Hochschule Hannover, November 2010
ISBN: 978-3-00-032924-1 -
(2005): Herstellung und Deformationsanalyse zur Qualifizierung einer Schutzschicht aus Magnesiumfluorid zur gesteuerten Degration von Implantatlegierungen auf Magnesiumbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).
-
(2005): Einsatz von Beschichtungsverfahren in der Löttechnik, Fr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Deutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143
-
(2000): Oberflächenbehandlung und thermochemische Stabilität von Magnesiumlegierungen, Magnesium-Taschenbuch, S. 308-311,
ISBN: ISBN-10: 3870172649
Conferences
-
(2025): Trockenschmierung von Wälzkontakten durch atmosphärisch plasmagespritzte selbstregenerative Molybdänoxidschichtsysteme, Tagungsband 6. Symposium Materialtechnik, 2025, 20.-21.02.2025, Clausthal-Zellerfeld
DOI: 10.21268/20250506-0 -
(2025): In-silico modeling of induction heating of hip endoprostheses for facilitated intentional removal, Tagungsband 6. Symposium Materialtechnik, 2025, 15, 227-240, 20.-21.02.2025, Clausthal-Zellerfeld
DOI: 10.21268/20250506-4 -
(2025): Entwicklung eines energieautarken Wirbelstromprüfsystems für die Zustandsüberwachung von Bauteilen und Bauwerken, DGZfP-Jahrestagung 2025, 26.– 28.05.2025, Berlin
DOI: 10.58286/31243 -
(2025): Lochstechen mit Wasserabrasivsuspensionsstrahlschneiden WASS, Deutscher Schneidkongress 2025, 07.05.2025, Essen
-
(2025): Thermodynamic modeling of carbon diffusion in manganese steels, Tagungsband 6. Symposium Materialtechnik, 2025, 15, 155-166, 20.-21.02.2025, Clausthal-Zellerfeld
DOI: 10.21268/20250506-10 -
(2025): Gas absorption and the directional development of mechanical properties of copper alloys produced by GMAW-WAAM, Tagungsband 6. Symposium Materialtechnik, 2025, 15, 83-95, 20.-21.02.2025, Clausthal-Zellerfeld
DOI: 10.21268/20250507-0 -
(2025): Brennschneiden mit Wasserstoff- Gasmischungssimulation und Auslegung der neuen Heizdüse für die autogentechnische Anwendung, Deutscher Schneidkongress 2025, 06.05.2025, Essen
-
(2025): Physical-metallurgical investigations for the in-situ production of Al- and Zn based thin films, 24. Werkstofftechnisches Kolloquium 2025, 02-03.04.2025, Chemnitz
-
(2025): Entwicklung eines Metall-Thermoplast-Verbundwerkstoffes bestehend aus Polyetheretherketon und Silicat beschichteten Kupfermikropartikeln für die direkte Laserbeschriftung, Tagungsband 6. Symposium Materialtechnik, 2025, 20.-21.05.2025, Clausthal-Zellerfeld
ISBN: 978-3-8440-9961-4 -
(2024): Resource-efficient regeneration by generating a digital component image based on different NDT techniques, 20th World Conference on Non-Destructive Testing, 27.05.-31.05.2024, Incheon, Süd-Korea
-
(2024): Characterization and modeling of the inductive heating of CoCrMo hip implants to facilitate intentional removal, IEEE International Symposium on Medical Measurements and Applications, 2024, 1-6
DOI: 10.1109/MeMeA60663.2024.10596835 -
(2024): Entwicklung eines energieautarken Wirbelstromsensorsystems für die in-situ Bauteilüberwachung, DGZfP – 3. Fachseminar Wirbelstromprüfung, 10.-11.09.2024, Schweinfurt
-
(2024): Development of an energy-autonomous eddy current sensor system for in-situ component monitoring, 20th World Conference on Non-Destructive Testing, 27.05.-31.05.2024, Incheon, Süd-Korea, e-Journal of Nondestructive Testing, 2024, 1-8
DOI: 10.58286/29942 -
(2024): Thermo-mechanical Forming of NiTi-related High Entropy Shape Memory Alloys, MSE 2024, 27.09-29.09.2024, Darmstadt
-
(2024): Thermally Sprayed Coatings for Dynamic Data Storage, Thermal Spray 2024: Proceedings from the International Thermal Spray Conference, 29.04.-01.05.2024, Mailand, Italien
DOI: 10.31399/asm.cp.itsc2024p0034 -
(2024): Development of a load-sensitive splined shaft with sensory material, integrated energy harvesting and wireless data transmission, Sensor Integrating Machine Elements (SiME) Congress, 19.-20.09.2024, Garching bei München
-
(2024): Zahnwelle mit konditionierbarem Lastsensor und integriertem Energy Harvesting, 10. VDI-Fachtagung Wellen und Welle-Nabe-Verbindungen 2024, S. 193-200, 06.-07.11.2024, Garching bei München
ISBN: 978-3-18-092443-4 -
(2024): Auswirkung der Variation des Fußrundungsradius und des Bohrungsdurchmessers in einer sensorintegrierenden Zahn-Hohlwelle auf die Kerbspannungen im Zahnfuß, Tagungsband zur DMK2024, 14.05.-15.05.2024, Dresden
-
(2024): A new approach for the application of highly reactive metals, International Thermal Spray Conference (ITSC) Proceedings, 2024, 278-283, Mailand, Italien
DOI: 10.31399/asm.cp.itsc2024p0278 -
(2024): Assessment of hydrogen-induced material degradation using electromagnetic testing technology, 20th World Conference on Non-Destructive Testing, 27.05.-31.05.2024, Incheon, Süd-Korea
-
(2023): Kaltwalzpattieren unter XHV-adäquaten Bedingungen, Tagungsband 5. Symposium Materialtechnik. Clausthal-Zellerfeld, 2023
DOI: 10.21268/20230628-4 -
(2023): Herstellung dichter Yttriumoxidbeschichtungen durch atmosphärisches Plasmaspritzen als Schutzschichten für die Halbleiterindustrie, Tagungsband 5. Symposium Materialtechnik, 2023, 810
ISBN: 978-3-8440-9105-2 -
(2023): Schwingfestigkeit von unter Wasser nass geschweißten Konstruktionsdetails, DVS-Berichte Band 390, Unterwassertechnik beim DVS CONGRESS, 12-13.09.2023, Essen, 2023, S. 56-67
-
(2023): Charakterisierung von im Kokillenguss hergestellten Aluminium-Kupfer-Verbunden hinsichtlich der Wärmeleitfähigkeit, In: referierten Tagungsband im Rahmen der CZM-Schriftenreihe „Fortschrittsberichte der Materialforschung und Werkstofftechnik“, 2023, S. 1-11
-
(2023): Erzeugung von künstlichen Rissen mittels der Wasserstrahltechnologie, DGZfP DACH-Jahrestagung 2023, 15.07.-17.07.2023, Friedrichshafen, 2023, 1-11
-
(2023): CO2-neutrales autogenes Brennschneiden mit Wasserstoff als Weg zur klimafreundlichen Produktionstechnik in der Stahlbearbeitung, Deutscher Schneidkongress 2023, 25.-27.04.2023, Essen
-
(2023): Overcoming Limits of High Entropy Shape Memory Alloys by Thermo-mechanical Forming, ICHEM 2023, 18.07.-22.07.2023, Knoxville, USA
-
(2023): In-situ Process Monitoring of Contact Arc Metal Grinding (CAMG) for Underwater Use in Nuclear Decommissioning, 13.11.2023, Aachen, 2023
-
(2023): Funktionale thermisch gespritzte Schichten für biomedizinische Anwendungen, Schriftenreihe Oberflächentechnik, 17. Aachener Oberflächentechnik Kolloquium 2023, 59-71
ISBN: 978-3-8440-9305-6 -
(2023): Potentiale und Eigenschaften des Lichtbogenspritzens in silandotierten Inertgasen, Tagungsband 5. Symposium Materialtechnik, 2023, 78-86
DOI: 10.21268/20230711-3 -
(2023): Anwendung des Elektrokontakttrennens unter Wasser mittels additiv gefertigten Elektroden im kerntechnischen Rückbau, In: Tagungsband des 15. Internationalen Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle“ (Kontec), Mannheim, 2023, 1-9
-
(2023): Zerstörungsfreie Bewertung der Härte an Wärmeeinflusszonen von Schweißnähten unterhalb der Wasserlinie, DVS Berichte 2023, 49-55
-
(2023): Elektromagnetische Härteprüfung für die Wärmeeinflusszone von Unterwasser-Schweißnähten, DGZfP DACH-Jahrestagung 2023, 15.07.-17.07.2023. Friedrichshafen, 2023, 1-10
-
(2023): Advantages of oxygen-free wire-arc sprayed titanium coatings, DPG-Frühjahrstagung der Sektion Kondensierte Materie, 26.03.-31.03.2023, Dresden
-
(2022): Coating Materials Under Oxygen-Free Silane Atmosphere for Hot Stamping, In: Behrens, B.-A., Brosius, A., Drossel, W.-G., Hintze, W., Ihlenfeldt, S., Nyhuis, P. (Hrsg.): Production at the Leading Edge of Technology. Proceedings of the 11th Congress of the German Academic Association for Production Technology (WGP), Dresden, September 2021. Cham: Springer International Publishing, 3-10
-
(2022): Nominal Stress Fatigue Assessment on Underwater Wet SMAW Fillet Welded Non-load-carrying Attachments of Construction Steel, 32st International Ocean and Polar Engineering Conference. Shanghai (CN). Virtuelle Konferrenz. 05.-10.06.2022, S. 2976–2983
-
(2022): In silico model of inductive heating for tissue-conserving hip and knee arthroplasty removal, MSE 2022, Darmstadt, 27.09.2022-29.09.2022
-
(2022): Prozessparameter und Werkzeuge zum Unterwasserkleben von Halterungssystemen, DVS Congress 2022, Koblenz, 19.09.2022-21.09.2022
-
(2022): Volumetric Characterization of an Aluminum and Copper Composite by X-Ray Microscopy, MSE 2022, Darmstadt, 27.09.2022-29.09.2022
-
(2022): PoD-Studie für die Wirbelstromprüfung von Ermüdungsrissen an Stumpfnähten, DGZfP – 2. Fachseminar Wirbelstromprüfung, Schweinfurt, 14.-15.09.2022
-
(2022): Sauerstofffreie Produktion in fünf von sechs Fertigungshauptgruppen, In: T. Königstein, A. W. (Hrsg.): Tagungsband 8. GTV Kolloquium Thermisches Spritzen & Laser Cladding. GTV Verschleißschutz GmbH, Luckenbach, 2022, S. 31-41
-
(2022): Hybride Schneidverfahren zum thermischen trennen dickwandiger Reaktorbauteile unter Wasser (HugeCut und CAMGproFit), FORKA Statusseminar des BMBF (Projektträger GRS), Berlin, 23.-25.05.2022
-
(2022): Study of the electron-temperature and -density distribution in the silane-doped thermal plasma on the basis of optical emission spectroscopy, MSE 2022, Darmstadt, 27.09.2022-29.09.2022
-
(2022): Microstructure Improvement of High Entropy Shape Memory Alloys by Thermo-mechanical Forming, MSE 2022, 27.06.-29.09.2022, Darmstadt
-
(2022): Microstructure Improvement of High Entropy Shape Memory Alloys by Thermo-mechanical Forming, MSE 2022, Darmstadt, 27.09.2022-29.09.2022
-
(2022): Nickel-braze coated stainless steel sheets for the production of complex brazed assemblies, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 27-31
-
(2022): Development of copper-aluminium composite brazing wires for brazing stainless steels, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 38-43
-
(2022): Process Integrated Closed-loop Control in Wire-Arc-Additive- Manufacturing, IIW 2022 International Conference on Welding and Joining: Innovative Welding and Joining Technologies to achieve Carbon Neutrality and promote Sustainable Development, 2022 (75), 83-86
-
(2022): Influence of Hydrogel Coatings on Corrosion and Fatigue of Iron in Simulated Body Fluid, Posterbeitrag, EUROCORR 2022, Berlin, 28.08.2022-01.09.2022
-
(2022): Fortschritte beim nassen Unterwasserschweißen durch den Einsatz von Doppelmantel-Fülldraht, In: DVS Berichte (Hrsg.): DVS CONGRESS 2022. 19.09.2022 – 21.09.2022, Koblenz, 2022, 230-236
-
(2022): Yttria Coatings as Wear Protection Layer in the Semiconductor Industry, Thermal Spray 2022: International Proceedings, S 939-944, 04.-06.05.2022, Wien, Österreich
DOI: 10.31399/asm.cp.itsc2022p0939 -
(2022): Untersuchung des Kristallisationsverhaltens mittels Lumineszenzanregungsspektroskopie, In: Maier, A. (Hrsg.): AWT magazin. Jubiläumsausgabe zur 60. Sitzung. TEWISS Verlag, Garbsen, 2021, S. 8-12
-
(2022): Yttria coatings as wear protection layer in the semiconductor industry, DVS-Berichte, Band 380, DVS Media GmbH, Düsseldorf, S. 939-944
-
(2022): Potentials of thermal spraying processes in silane-doped inert gases, In: DVS (Hrsg.): Thermal Spray 2022: Proceedings from the International Thermal Spray Conference. Wien. 04.05.2022-06.05.2022. DVS Media, Düsseldorf, 2022, S. 199-204
DOI: 10.31399/asm.cp.itsc2022p0199 -
(2022): The ECARP Process and Its Influence on the Microstructure of Pure Mg and the Mg Alloy AZ31, Proceedings of the Twelfth International Aluminum Extrusion Technology Seminar (ET '22), May 3-5, Orlando, Florida 1, 2022, 723-731
-
(2022): Lateral Angular Co-Extrusion of Aluminum and Steel for the Manufacturing of Coaxial Composite Profiles, Proceedings of the Twelfth International Aluminum Extrusion Technology Seminar (ET '22), May 3-5, Orlando, Florida 1, 2022, 183-193
-
(2022): Direct energy deposition additive manufacturing of Fe-Mn-Al-Ni: On the challenges of producing polycrystalline material for the use in damping applications, MSE 2022, Darmstadt, 27.09.2022-29.09.2022
-
(2022): Development of an optical inspection method for evaluating the surface condition of metal surfaces to be brazed, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 235-244
-
(2022): Ermüdungsfestigkeit von nass geschweißten Offshore-Stählen, In: DVS Berichte (Hrsg.): DVS CONGRESS 2022. 19.09.2022 – 21.09.2022, Koblenz, 2022
-
(2021): WAAM von Großbauteilen, DVS Congress 2021. DVS - Deutscher Verband für Schweißen und verwandte Verfahren e. V., Essen, 15.09.2021
-
(2021): Inspection concept for the detection of fatigue cracks in welds of offshore structures below the waterline, WESC 2021 – Wind Energy Science Conference. Virtuelle Konferenz. 25.05.2021 - 28.05.2021.
-
(2021): Ein Jahr DIPRO – Lessons learned aus ingenieurswissenschaftlicher Perspektive zur inter- und transdisziplinären Arbeit, In: Smeddinck, U. (Hrsg.): Transdisziplinäre Entsorgungsforschung am Start – Basis-Texte zum transdisziplinären Arbeitspaket „DIPRO – Dialoge und Prozessgestaltung in Wechselwirkung von Recht, Gerechtigkeit und Governance, Karlsruhe, 2021, S. 26-30
DOI: https://doi.org/10.21268/20210609-0 -
(2021): Wasserstoff beim nassen Schweißen – Warum ist das eigentlich ein Problem und ist das lösbar?, 8. Fachtagung Unterwassertechnik 2021, Hamburg, 16.11.2021, 30-35
ISBN: 978-3-96144-159-4 -
(2021): Workshop Safety and Uncertainty, Saf. Nucl. Waste Disposal 1, 2021, 309-310
DOI: 10.5194/sand-1-309-2021 -
(2021): Detektion der deformationsinduzierten martensitischen Umwandlung von metastabilem Austenit in 1.4301 beim kryogenen Drehen mittels Wirbelstromprüfung, In: DGZfP-Jahrestagung 2021 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Virtuelle Konferenz. 10.05.2021 - 11.05.2021
-
(2021): Doppelmantelfülldraht – Eine Entwicklung zum kontinuierlichen nassen Schweißen unter Wasser, 8. Fachtagung Unterwassertechnik 2021, Hamburg, 16.11.2021, 24-29
ISBN: 978-3-96144-159-4 -
(2021): Stoffschlüssige Grenzflächenübergänge beim thermischen Beschichten mit Lichtbogen- und Plasmaspritzprozessen, In: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 4. Symposium Materialtechnik. Clausthal-Zellerfeld (virtuell). 25.02.-26.02.2021. Shaker, Aachen, 2021, S. 258-268
-
(2021): Lumineszenzanregungsspektroskopie von wässrigen CaCO3 Lösungen unter Hochdruck, 60. AWT Sitzung, Oelde, 11.10.2021
-
(2021): Applikation von Nickel- und Titanbasisloten durch thermisches Spritzen zur Regeneration komplexer Investitionsgüter, Tagungsband 4. Symposium Materialtechnik. Clausthal-Zellerfeld (virtuell), 2021, 245-253
DOI: 10.21268/20210519-22 -
(2021): Sauerstofffreie Produktion: Von der Vision zur Anwendung, In: Bobzin, K. (Hrsg.): Schriftenreihe Oberflächentechnik. 15. Aachener Oberflächentechnik Kolloquium 2021. Aachen. Shaker Verlag, Düren, 2021, S. 17-26
-
(2021): Die Verwendung der CASTOR Behälterfamilie als Endlagerbehälter in einem Tiefenlager – die kritische Sicht aus der Behälterperspektive, BMWi Arbeitskreis HAW-Produkte zur 100. Sitzung (online), 4.-5. März 2021
-
(2021): Dismantling of nuclear facilities in Germany with a view to digitalisation of dismantling technologies, NEA Workshop – Digital Transformation: Opportunities and Challenges for the Nuclear Sector (online), 27-28 May 2021, S. 17-30
-
(2021): Die Rolle des Endlagergebindes im Standortauswahlverfahren und die Verantwortung der Ingenieure, 2. Fachkonferenz Teilgebiete AG I1: Endlagerbehälter, technische Barrieren und mögl. Bergung, Rückhaltevermögen des Endlagersystems für langlebige Zerfallsprodukte in hochradioaktiven Abfällen (online), 11. Juni 2021
-
(2020): Kaltpressschweissen unter XHV-adäquater Atmosphäre beim Walzplattieren, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 151
-
(2020): Tailored Forming of Hybrid Bevel Gears with Integrated Heat Treatment, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 301-308
DOI: 10.1016/j.promfg.2020.04.234 -
(2020): Prozessintegrierte metallische Sinterbeschichtung für das Formhärten mit konduktiver Erwärmung, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 152-153
-
(2020): Development of a Modified Tool System for Lateral Angular Co-Extrusion to Improve the Quality of Hybrid Profiles, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 224–230
DOI: 10.1016/j.promfg.2020.04.200 -
(2020): Ermüdungsprüfung von blechmassivumgeformten Bauteilen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020. TEWISS, Garbsen, 2020, S. 100-104
-
(2020): Investigation of the temporal rearrangement behaviour of zirconium hydride precipitates in interim and final storage, In: GRS Forschungszentrum (Hrsg.): 4th Workshop on Safety of Extended Dry Storage of Spent Nuclear Fuel. Online-Konferenz. 202003.06.-04.06.2020
-
(2020): Testing of Formed Gear Wheels at Quasi-Static and Elevated Strain Rates, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 623-628
DOI: 10.1016/j.promfg.2020.04.191 -
(2020): Manufacturing of Large-Diameter Rolling Element Bearings by Steel-Steel Multimaterial Systems, In: J. M. Beswick (Hrsg.): Bearing Steel Technologies: 12th Volume, Progress in Bearing Steel Metallurgical Testing and Quality Assurance. 12th International Symposium on Rolling Bearing Steels. Denver, USA. 15.05.-17.05.2019. ASTM International, West Conshohocken, 2020, S. 277-299
DOI: 10.1520/STP162320190064 -
(2020): Herstellung von Großwälzlagern durch Stahl-Stahl-Werkstoffsysteme, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 143-144
-
(2020): Casting Manufacturing of Cylindrical Preforms Made of Low Alloy Steels, In: 23rd International Conference on Material forming - ESAFORM 2020. online. 04.05.-08.05.2020, Procedia Manufactoring 47, 2020, S. 445-449
DOI: 10.1016/j.promfg.2020.04.333 -
(2020): Influence of the Material on the Measurement of Surface Roughness Using Eddy Current Technology, In: 2020 IEEE International Instrumentation and Measurement Technology Conference (I2MTC). Dubrovnik, Croatia. 25.5.-28.5.2020, S. 1-6
DOI: 10.1109/I2MTC43012.2020.9128881 -
(2020): Analyse der belastungspfadabhängigen Schädigungs- und Mikrostrukturentwicklung zur numerischen Auslegung von Blechmassivumformprozessen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 185-186
-
(2020): Sonderforschungsbereich 1368 „Sauerstofffreie Produktion“: Prozesse und Wirkzonen in sauerstofffreier Atmosphäre zur Entwicklung zukunftsfähiger Produktionstechniken und Fertigungsverfahren, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag. TEWISS, Garbsen, 2020, S. 154-155
-
(2020): Functional Properties and Fatigue Behavior of Nickel-Titanium High Entropy Shape Memory Alloys, ICHEM 2022, 27.09.-01.10.2020, Berlin
-
(2020): Wärmebehandlung für belastungsangepasste Werkstoffeigenschaften von Tailored- Forming-Komponenten, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 117-118
-
(2020): Temperaturgesteuerte Werkstoffaufmischung beim Laser-Draht- sowie Plasma-Pulver Auftragschweißen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 121
-
(2020): Zirkoniumbearbeitung mit dem Wasserstrahl, In: Maier, A. (Hrsg.): AWT magazin. Ausgabe zur Oktobersitzung 2020. TEWISS Verlag, Garbsen, 2020, S. 16-19
-
(2020): Einfluss von Silan dotierten Umgebungsatmosphären auf die tribologischen Eigenschaften von Titan, In: Gesellschaft für Tribologie (Hrsg.): 61. Tribologie-Fachtagung. 28.09.-30.09.2020, 2020, S. 12/1–12/10
-
(2020): Herstellung koaxialer Verbundprofile mittels Lateral Angular Co-Extrusion, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020, Posterbeitrag, TEWISS, Garbsen, 2020, S. 115-116
-
(2020): Innovative Verfahrenskombination zur Steigerung der Haftzugfestigkeit thermischer Spritzschichten, In: Manufacturing Innovations Network (Hrsg.): Unter Span. Das Magazin des Manufacturing Innovations Network e. V, 2020, 15
-
(2020): Entwicklung und Analyse der duktilen Schädigung beim Kaltgesenkwalzen, In: Behrens, B.-A. (Hrsg.): Aktuelle Entwicklungen im Bereich der Umformtechnik; 23. Umformtechnisches Kolloquium Hannover. 04.03.-05.03.2020. TEWISS, Garbsen, 2020, 27-34
-
(2019): Characterization of a modified hot-working steel with increased wear resistance, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P63
-
(2019): Deep Cryogenic Treatment of X153CrMoV12 Cold-work Tool Steel, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P31
-
(2019): Influence of Increased Manganese Content on the Precipitation Behaviour of AISI H10 in Thermomechanical Fatigue Tests, In: WGP (Hrsg.): WGP Kongress 2019. Hamburg. 29.09.-02.10.2019, S. 189-197
-
(2019): In-vivo Vergleich der Degradation und Osseointegration von LAE442-Magnesiumschwämmen mit zwei verschiedenen Porengrößen, In: Osteologie 2019. Frankfurt am Main. 28.05.-30.05.19. Georg Thieme Verlag KG, Stuttgart, 2019, S. 60-61
DOI: 10.1055/s-0039-1680000 -
(2019): Dry sheet metal forming through selective oxidized tool surfaces, In: TMS 2019, 148th Annual Meeting. San Antonio, USA. 10.03.-14.03.2019, S. 719-731
DOI: 10.1007/978-3-030-05861-6_71 -
(2019): Numerical modeling of the development of intermetallic layers between aluminium and steel during co-extrusion, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05. – 10.05.2019, S. 40029
DOI: 10.1063/1.5112563 -
(2019): Development of an intelligent hot-working steel to increase the tool wear resistance, In: Broeckmann, C. (Hrsg.): Tooling 2019 conference & exhibition. 13.05.-16.05.2019, P64
-
(2019): Investigation into the bond strength of the joining zone of compound forged hybrid aluminium-steel bearing bushing, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05. – 10.05.2019, S. 40028
DOI: 10.1063/1.5112562 -
(2019): Investigation of the temporal rearrangement behaviour of zirconium hydride precipitates in interim and final storage, In: GRS Forschungszentrum (Hrsg.): 3rd Workshop on Safety of Extended Dry Storage of Spent Nuclear Fuel. Garching, Germany. 04.06.-07.06.2019
-
(2019): Induktion als Wärmetechnologie beim nassen Unterwasserschweißen höherfester Stähle, In: 7. Tagung Unterwassertechnik. DVS Berichte Band 359. Hamburg. 12.11.-13.11.2019. DVS Media GmbH, Düsseldorf, 2019, S. 5-13
-
(2019): Analyse und Modellierung von Schädigung und Versagen in der Blechmassivumformung, In: Merklein, M.; Behrens, B.-A.; Tekkaya, A.E. (Hrsg.): 4. Workshop Blechmassivumformung. Hannover, 12.03.2019. FAU University Press, Erlangen, 2019, S. 33-60
DOI: 10.25593/978-3-96147-280-2 -
(2019): Influence of process atmosphere on the fatigue behavior of brazed stainless steel joints before and after corrosive attack, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 137-141
-
(2019): Integration von Wirbelstromsensoren in eine Drehmaschine als Grundlage für eine prozessbegleitende Regelung – Eine Übersicht über resultierende Störeinflüsse, In: Berichtsband zur DGZfP-Jahrestagung 2019. Friedrichshafen. 27.05.–29.05.2019, S. 58
-
(2019): Investigations on the development of process emissions during oxy-fuel flame cutting of plated thick-walled unalloyed materials, In: 72nd IIW Annual Assembly and International Conference. Bratislava, Slovakia. 07.07.-12.07.2019
-
(2019): Properties and anisotropy behaviour of a nickel base alloy material produced by robot based wire and arc additive manufactured (WAAM), In: 72nd IIW Annual Assembly and International Conference. Bratislava, Slovakia. 07.07.-12.07.2019
-
(2019): Investigation of residual stresses in high-temperature-brazed hybrid Cr-CrNi-steel joints, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 149-155
-
(2019): In situ Chromium carbide formation in carbon modified brazed NiCrP-coatings, In: Brazing, high temperature brazing and diffusion bonding. In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 228-234
-
(2019): In-vivo Vergleich der Osseointegration und des Degradationsverhaltens der Magnesium-Scaffolds La2 und LAE442, In: Osteologie 2019. Frankfurt am Main. 28.05.-30.05.19. Georg Thieme Verlag KG, Stuttgart, 2019, S. 50
DOI: 10.1055/s-0039-1679977 -
(2019): Verminderung des Risikos wasserstoffinduzierter Kaltrisse beim hyperbar nassen Schweißen durch den Einsatz austenitbildender Schweißzusätze, In: 7. Tagung Unterwassertechnik. DVS Berichte Band 359. Hamburg. 12.11.-13.11.2019. DVS Media GmbH, Düsseldorf, 2019, S. 39-44
-
(2019): Cross-wedge rolling of PTA-welded hybrid steel billets with rolling bearing steel and hard material coatings, In: Lander Galdos, L. et al. (Hrsg.): Proceedings of the 22nd international ESAFORM conference on material forming: ESAFORM 2019. Vitoria-Gasteiz, Spanien. 08.05.–10.05.2019, S. 40019
DOI: 10.1063/1.5112553 -
(2019): Kinetic investigations for brazing Zn-surfaced AlSi dublex braze metal coatings with NH4Cl-doped process gas, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 306-314
-
(2019): Feasibility of soft tissue preparation using high-pressure water jet technology, In: WJTA-IMCA Conference & Expo 2019. New Orleans, 2019
-
(2019): Application of Ni-based filler metal repair coating by thermal spraying for high pressure turbines – A hybrid coating, brazing and aluminizing process, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 71-76
-
(2019): Neue Verfahren der Oberflächenvorbehandlung zur Steigerung der Haftfestigkeit von thermisch gespritzten Schichten, In: K. Bobzin (Hrsg.): Tagungsband 14. Aachener Oberflächentechnik Kolloquium. Aachen. Shaker Verlag, Aachen, 2019, 69-79
-
(2019): Ultrasonic evaluation of tailored forming bearing components, In: 12th International Symposium on Rolling Bearing Steels – Progress in Bearing Steel Metallurgical Testing and Quality Assurance. Denver. 15.05.-17.05.2019
DOI: 10.13140/RG.2.2.28034.53443 -
(2019): Automatable splicing method for steel cord conveyor belts using high-pressure water jetting, 13th International Conference on Bulk Materials Storage, Handling and Transportation (ICBMH 2019), 2019, 312-329
-
(2019): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, In: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 3. Niedersächsisches Symposium Materialtechnik. Clausthal-Zellerfeld. 14.02.-15.02.2019. Shaker, Aachen, 2019, S. 483-494
-
(2019): Development an application of thermoplastic-coated particles for joining with powdered brazing alloys, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Lectures and Posters of the 12th International Conference taking place in Aachen on 21th to 23th May. Aachen. 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 215-221
-
(2019): Surface deoxidation mechanisms of stainless steels in vacuum brazing processes, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 247-251
-
(2019): Hot Forming of Cast Steel Cylinders, In: Conference Proceedings of the 28th International Conference on Metallurgy and Materials, METAL2019. Brno, Czech Rep. 22.05.-24.05., 2019
-
(2018): Einfluss einer Kryobehandlung auf das Ausscheidungsverhalten von Nanocarbiden im Kaltarbeitsstahl X153CrMoV12, Workshop NanoDay2018. 27.09.2018, Posterbeitrag
-
(2018): Advanced high pressure turbine blade repair technologies, In: 10th CIRP Conference on Photonic Technologies (LANE 2018), Procedia CIRP 74, 2018, S. 214-217
DOI: 10.1016/j.procir.2018.08.097 -
(2018): Entwicklung einer Bainit-Sensortechnik zur Charakterisierung gradierter Gefügeausbildungen in der Bauteil-Rand und Kernzone, In: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
-
(2018): Investigation of the composite strength of hybrid steel-steel semi-finished products manufactured by laser beam welding and friction welding, In: 5th International Conference Recent Trends in Structural Materials, COMAT2018. Pilsen, Czech Rep. 14.11.-16.11.2018. IOP Conf. Ser.: Mater. Sci. Eng. 461, 2018, S. 12049
DOI: 10.1088/1757-899X/461/1/012049 -
(2018): Numerical investigations on the lateral angular co-extrusion of aluminium and steel, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 30001
DOI: 10.1063/1.5034844 -
(2018): Wear investigation of selective α-Fe2O3 oxide layers generated on surfaces for dry sheet metal forming, In: 17th International Conference on Metal Forming. Toyohashi, Japan. 16.09.-19.09.2018, S. 923-930
DOI: 10.1016/j.promfg.2018.07.404 -
(2018): Micro-Scale Residual Stress Measurement Using Focused Ion Beam Techniques and Digital Image Correlation, In: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 32
-
(2018): Anwendung der Induktion für schweißtechnische Erwärmung beim nassen Lichtbogenhandschweißen unter Wasser, In: 2. Kolloquium Induktionserwärmung in der Schweißtechnischen Fertigung. Halle. 17.10.2018
-
(2018): Halbnasses Lichtbogenbolzenschweißen großer Dimensionen mit Hubzündung im Unterwasserbereich, In: DVS Berichte Band 344. DVS Congress 2018. DVS Media GmbH, Düsseldorf, S. 420-427
-
(2018): Ball end milling of titanium TIG weld material and the effect of SiC addition – process forces and shape deviations, 6th International Conference on Through-life Engineering Services, Bremen, 7.11.-8.11.2017. Procedia Manufacturing 19, 2018, 74-81
DOI: 10.1016/j.promfg.2018.01.011 -
(2018): Technology-based re-contouring of blade integrated disks after weld repair, In: Proceedings of the ASME Turbo Expo 2018. Oslo, Norway. 11.06.-15.06.2018
-
(2018): The effects of stress-induced martensite ageing on shape memory behavior in Co35Ni35Al30 single crystals, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Strategies for high entropy shape memory alloy design - from motivation to structure and properties, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Entwicklung einer Hochfrequenz-Induktionsthermografie und -Wirbelstromtechnik zur Fehlerprüfung und Charakterisierung der Schichtsysteme von Triebwerksbeschaufelung im Schaufelkanal, In: Berichtsband zur DGZfP-Jahrestagung 2018. Leipzig, 07.05.-09.05.2018
-
(2018): Near-Wing Multi-Sensor Diagnostics of Jet Engine Components, In: American Society of Mechanical Engineers (ASME) (Hrsg.): ASME Turbo Expo 2018: Turbomachinery Technical Conference and Exposition. Oslo, Norway. 11.06.-15.06.2018, V006T05A026
ISBN: 978-0-7918-5112-8 -
(2018): Evaluation of micro-damage by acoustic methods, In: 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan, 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 527-534
DOI: 10.1016/j.promfg.2018.07.273 -
(2018): Manufacturing of seamless tubes of the alloy Al-5Mg-0,2Sc by direct extrusion and sink drawing, In: Materials Science and Engineering, MSE 2018. European Congress and Exhibition on Advanced Materials and Processes. Darmstadt. 26-28.09.2018
-
(2018): Experimental setup to characterize flow-induced anisotropy of sheet metals, In: IOP Conf. Series: Materials Science and Engineering 418. International Deep Drawing Research Group 37th Annual Conference. Waterloo, Kanada. 03.06.-07.06.2018, S. 12085
DOI: 10.1088/1757-899X/418/1/012085 -
(2018): Beam extraction using non vacuum electron beam by reduced acceleration voltage, Journal of Physics: Conference Series 1109, 2018 More info
DOI: 10.1088/1742-6596/1109/1/011001 -
(2018): Chracterization of Heat Transfer in Complex Air-Water Spray Quenching Set-Ups, In: QDE2018, International Conference on Quenching and Distortion Engineering. Nagoya, Japan, 27.11.-29.11.2018, S. 21
-
(2018): Microstructure-Functional Behavior-Relationships in High Entropy Shape Memory Alloys, MSE 2018, 26.08.-28.08.2018, Darmstadt
-
(2018): Phase transformations in a boron-alloyed steel at high heating rates, In: Mori, K.-I.; Abe, Y.; Maeno, T. (Hrsg.): Proceedings of the 17th International Conference on Metal Forming. Metal Forming 2018. Toyohashi, Japan. 16.09. - 19.09.2018, Procedia Manufacturing 15, 2018, S. 1062-1070
DOI: 10.1016/j.promfg.2018.07.386 -
(2018): Influence of heat-pretreatments on the microstructural and mechanical properties of galfan-coated metal bonds, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 40007
DOI: 10.1063/1.5034861 -
(2018): Schweißen unter Wasser als Fertigungs- und Reparaturverfahren, und was der Werkstoff dazu sagt, In: 22. Kolloquium Reparaturschweißen. Halle (Saale), 2018, S. 37-42
-
(2018): Fluxless Brazing of aluminum alloys using non vacuum electron beam by 60kV acceleration voltage, Journal of Physics: Conference Series 1109, 2018 More info
DOI: 10.1088/1742-6596/1109/1/011001 -
(2018): Effect of the heating-cooling rate on the functional properties of Ti-Ta-Al HT-SMAs, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Simulation of bone ingrowth into bone substitutes on implant level length scale, In: 89th Annual Meeting of the International Association of Applied Mathematics and Mechanics (GAMM). München. 19.3.- 23.3.2018, Proc. Appl. Math. Mech. 18, 2018 (1), e201800297
DOI: 10.1002/pamm.201800297 -
(2018): Synchrotron radiation and transmission electron microscopy investigations on the formation and dissolution temperatures of the w -phase in Ti-Ta high temperature shape memory alloys, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Influence of ultrasonic amplitude and position in the vibration distribution on the microstructure of a laser welded aluminum alloy, In: International Congress on Applications of Lasers & Electro-Optics, ICALEO 2018. Orlando, Fl. USA. 14.10.-18.10.2018
-
(2018): Stress-induced martensite ageing in single crystals of Ni-based Heusler alloy: processing, effect of orientation and functional properties, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2018): Entwicklung eines numerischen Simulationsmodells für das nasse Unterwasserschweißen von höherfesten Spundwandstählen, In: Schafstall, H.; Wohlmuth, M. (Hrsg.): Tagungsband 19. RoundTable Simulating Manufacturing. Marburg, 16.05. -17.05.2018. Simufact Engineering GmbH, Hamburg, S. 122-132
-
(2018): Cold pressure welding of aluminium-steel blanks: Manufacturing process and electrochemical surface preparation, In: Fratini, L. et al. (Hrsg.): Proceedings of the 21st International ESAFORM Conference on Material Forming. ESAFORM 2018. Palermo. AIP Conference Proceedings 1960, 2018 (1), S. 50007
DOI: 10.1063/1.5034880 -
(2018): Selective oxidation of tool steel surfaces under a protective gas atmosphere using inductive heat treatment, In: Vollertsen, F. et al. (Hrsg.): 5th International Conference on New Forming Technology, ICNFT 2018. Bremen, 18.09.-21.09.18. MATEC Web Conf. 190, 2018, S. 14003
DOI: 10.1051/matecconf/201819014003 -
(2018): Effect of Manganese on Nitriding and Softening Behaviour of Steel AISI H10 Under Cyclic Thermal Loads, In: Schmitt, R.; Schuh, G. (Hrsg.): Advances in Production Research. WGP 2018. Aachen. 19.11.-20.11.2018, S. 423-432
DOI: 10.1007/978-3-030-03451-1_42 -
(2018): Two-way shape memory effect in [001]-oriented Ni49Fe18Ga27Co6 single crystals, ESOMAT 2018, 11th European Symposium on Martensitic Transformations. Metz, France. 27.08. - 31.08.2018
-
(2017): Erzeugung hybrider Umformhalbzeuge durch Auftragschweißen und Evaluierung der Fügezone vor und nach dem Umformen, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 195
-
(2017): Local stress investigation of periprosthetic fractures by total hip replacement - a finite element analysis, BMTMedPhys 2017. Poster session 11: Modelling and simulation I. Dresden, 10.09. - 13.09.2017, S. 152
DOI: 10.1515/bmt-2017-5032 -
(2017): Full automatization of waterjet cutting, WJTA-IMCA Conference & Expo 2017. New Orleans. 24.-27.10.2017
-
(2017): Wear Behavior of MoS2 Lubricant Layers During Sheet Metal Forming, In: Proceedings of the 17th International Conference on Sheet Metal SHEMET17, Procedia Engineering 183, 357-362
-
(2017): Aktuelle Forschungsschwerpunkte in der Massivumformung, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017. TEWISS, Garbsen, 2017, S. 15-32
-
(2017): Clinchen für Anwendungen mit zyklisch thermischer und mechanischer Belastung, In: Gemeinsame Forschung in der Mechanischen Fügetechnik. Tagungsunterlagen des 7. Fügetechnischen Gemeinschaftskolloquiums. Dresden. 12-13 Dezember, 2017, S. 91-96
-
(2017): Fatigue Behavior of Sheet-Bulk Metal Formed Components, In: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 859–864
DOI: 10.7449/2017/MST_2017_859_864 -
(2017): Ermüdungsverhalten blechmassivumgeformter Bauteile, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 221
-
(2017): JoiningTWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologies, 7. Fügetechnisches Gemeinschaftskolloquium, EFB, FOSTA und DVS Forschung, 12.-13.12.2017
-
(2017): Modernization Of An Electric-Weld Plant For Performing Combined Roll Forming And Heat-Treatment Processes, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 28
-
(2017): Qualifizierung des Unterwasserbolzenschweißens für M16/M24, In: Unterwassertechnik. Vorträge der gleichnamigen 6. Fachtagung in Hamburg, 14.-15.11.2017. DVS-Berichte Band 338, DVS Media GmbH, Düsseldorf, 2017, S. 25-31
ISBN: 978-3-96144-012-2 -
(2017): Influence of high-current-density impulses on the plasticity of single crystal nickel-based super alloy CMSX-4, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
-
(2017): Methodical procedure for investigating the influence of electric impulses on the deformation behavior of the single crystal nickel-based alloy CMSX-4 and dynamics of grain boundaries in aluminum bicrystals, In: Bannykh, O. A. (Hrsg.): VII international conference „Deformation and destruction of materials and nanomaterials“. Moskau. 7.-10.11.2017. IMET RAN, Moskau, 2017, S. 57-58
-
(2017): Mechanical Properties and Fatigue Strength of Extruded Cobalt-Containing Magnetic Magnesium Alloys, In: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 537-542
DOI: 10.1007/978-3-319-52392-7_74 -
(2017): Biocompatible Magnesium Alloy ZNdK100 - Adaptation of Extrusion Parameters to Tailor the Mechanical Properties to Different Implant Applications, In: Solanki, K. N. et al. (Hrsg.): Magnesium Technology 2017. Springer International Publishing, 2017, S. 323-327
DOI: 10.1007/978-3-319-52392-7_46 -
(2017): Joining TWIP-Steel Simulation Models, In: Procedia Structural Integrity, International Conference on Structural Integrity, ICSI 2017, 04.-07.09.2017, S. 516–523
DOI: 10.1016/j.prostr.2017.07.154 -
(2017): Water-Air Spray Cooling At Heat Treatment Of Cylindrical Samples, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 13
-
(2017): Fem Analysis Of Multilayer And Polygonal Pipes Designed For Subsea Umbilical Pipelines, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 10
-
(2017): FEM analysis of multilayer pipes designed for subsea umbilicals, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 159-171
-
(2017): Analysis of Dislocation Structures in Ferritic and Dual Phase Steels Regarding Continuous and Discontinuous Loading Paths. , In: The Minerals, Metals & Materials Society TMS (Hrsg.): TMS 2017. 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer, Cham, Switzerland, 2017, S. 203-210
DOI: 10.1007/978-3-319-51493-2_20 -
(2017): Properties Of An Intelligent Hot-Working Tool Steel With Alloy Adapted Nitriding Layers, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 49
-
(2017): Influence of Sticking on the Roll Topography at Twin-Roll Casting of Aluminum Alloys., In: Ratvik, A. P. (Hrsg.): Light metals 2017, The Minerals, Metals & Materials Society (TMS). San Diego. 26.02. - 02.03.17. Springer, Cham, Switzerland, 2017, S. 827-831
DOI: 10.1007/978-3-319-51541-0_100 -
(2017): Vorhersage von Schädigung in der Blechmassivumformung, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 220
-
(2017): Development of the generic ENCON container concept based on the aspects of the three ENTRIA options, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 166
-
(2017): Technical concepts for maintenance and repair of HLW-storage containers in the framework of long-term-interim storage, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 156
-
(2017): Monitoring in the deep geological disposal - Technical and social requirements for implementing monitoring of HLW containers, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 56
-
(2017): Long term monitoring of the technical barrier in deep geological disposal, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 168
-
(2017): Handling techniques for HLW retrieval considering the influence of generic container concepts, Final ENTRIA Conference - Research on Radioactive Waste Management. Braunschweig. 26.-29. September 2017, S. 74
-
(2017): MIG-basierte, robotergestützte Additive Fertigung von Aluminiumbauteilen, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 311-319
-
(2017): Automatable splicing method for steel cord conveyor belts - Finding a suitable preparation process, In: AST 2017 – Scientific Symposium on Automated Systems and Technologies. St. Petersburg, Russland. 14.06.-15.06.2017, S. 17-24
-
(2017): Heat Treatment of Steel-Aluminum Hybrid Components, In: Materials Science and Technology 2017. Pittsburgh, 08.-12.10.2017, S. 53-60
DOI: 10.7449/2017/MST_2017_53_60 -
(2017): Heat Treatment of Steel-Aluminium Tailored Forming-Components, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
-
(2017): Wärmebehandlung für belastungsangepasste Werkstoffeigenschaften von Tailored Forming-Komponenten, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 193
-
(2017): Manufacturing of tailored tubes with a process integrated heat treatment, In: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 190003
DOI: 10.1063/1.5008216 -
(2017): Heat-Treatment Of Coated Steel Sheets Before And After A Cold Roll Bonding Process, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 48
-
(2017): Properties Of Clinched Stainless Steel Sheets As A Result Of Thermal Loading, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 47
-
(2017): Development of Sponge Structure and Casting Conditions for Absorbable Magnesium Bone Implants, In: TMS 2017 146th Annual Meeting & Exhibition Supplemental Proceedings. Springer International Publishing; Springer, Cham, 2017, S. 307-317
DOI: 10.1007/978-3-319-51493-2_29 -
(2017): New bainite sensor technology allows for a detailed view on material transformation, Proceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 133-140
-
(2017): Plasmaschneiden – der nächste Schritt, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 250-256
-
(2017): Simulation of the change in Mechanical Properties of Degradable Bone Implants, In: Proceedings of the 7th GACM Colloquium on Computational Mechanics for Young Scientists from Academia and Industry. Stuttgart. 11.10.- 13.10.2017
-
(2017): Robustes Laserstrahlschneiden unter Wasser, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 32-38
-
(2017): Untersuchung einer automatisierbaren Methode zur Verbindungsvorbereitung von Stahlseilfördergurten, 53. AWT Sitzung, Lübeck, 09.10.2017
-
(2017): Technical inheritance: Information basis for the identification and development of product generations, In: Maier, A. et al. (Hrsg.): Proceedings of the 21st International Conference on Engineering Design (ICED17). Vol 6: Design Information and Knowledge. 21.08.-25.08.2017, Vancouver, Canada, S. 91-100
-
(2017): Modeling of nickel-based superalloys in a crystal plasticity framework, In: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, 2017, S. 121
-
(2017): Regeneration of High Pressure Turbine Blades. Development of a Hybrid Brazing and Aluminizing Process by means of Thermal Spraying, The 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 72-76
DOI: 10.1016/j.procir.2016.09.041 -
(2017): Heat treatment of the thermally sprayed coating system NiCrSi/NiCoCrAlY/Al for repair brazing high pressure turbine blades, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 462-466
-
(2017): Fügezonenbeeinflussung beim Laserstrahlschweißen von Stahl-Aluminium- Mischverbindungen zur Verbesserung der Umformeigenschaften, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 194
-
(2017): Beeinflussung des Schmelzbades von Mischverbindungen im Laserstrahl-schweißprozess durch Ultraschall., In: Fortschrittsberichte der Materialforschung und Werkstofftechnik, Tagungsband 2. Niedersächsisches Symposium Materialtechnik. Shaker, Herzogenrath, 2017, S. 259-268
-
(2017): Influence of beam position and ultrasonic amplitude on the micro-structure of laser welded dissimilar steel-steel joints, In: 36th International Congress on Applications of Lasers & Electro-Optics - ICALEO® 2017. Atlanta, 22.10.-26.10.2017
-
(2017): Changes of the metal temperature at the axial water-air cooling of cylindrical samples, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 32-38
-
(2017): Change of metal temperature at heat treatment with water-air spray cooling, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, S. 27-31
-
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses, Deutscher Gießereitag 2017, Posterbeitrag, Düsseldorf, 17. - 18.05.2017
-
(2017): Tribological Investigations on Tailored Formed Axial Bearing Washers, In: 6th World Tribology Congress. Beijing, China. 17.09.-22.09.2017
-
(2017): Inline application of bainite sensor technology for characterizing phase transformation during cooling, Proceedings of: Bainite - from nano to macro. Wiesbaden, 01.06. - 02.06.2017, S. 141-150
-
(2017): Data acquisition for stress analysis by Digital Image Correlation of nickel-based superalloys under tensile load at high temperatures, In: Creep 2017. Proceedings of the International Conference on Creep and Fracture of Engineering Materials and Structures. Sankt Petersburg, 19.06.-21.06.2017, S. 38
-
(2017): Investigation Of The Sign-Variable Low-Cyclic Bending Deformation Influence On Sheet Properties Of Materials With A Hexagonal Crystal Lattice, In: Ya. V. Frolov (Hrsg.): Plastic deformation of metals. Accent PP, Dnipro, 2017, Seite 47
-
(2017): Enhanced corrosion resistance of magnesium alloys by transplantation of thermally sprayed coatings, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 665–668
-
(2017): Transpiring thermally sprayed alumina layers with integrated fluid flow tubes, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 47-50
-
(2017): Advanced characterization techniques for turbine blade wear and damage, The 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 83-88
DOI: 10.1016/j.procir.2016.09.005 -
(2017): Development of a Cu-Sn based brazing system with a low brazing and a high remelting , 19th Chemnitz Seminar on Materials Engineering, IOP Conf. Ser.: Mater. Sci. Eng. 181, 2017, 12005
DOI: 10.1088/1757-899X/181/1/012005 -
(2017): Herausforderungen bei der numerischen Simulation des nassen Unterwasserschweißens, In: DVS Congress 2017. DVS Berichte Band 337. DVS Media GmbH, Düsseldorf, 26. bis 29. September 2017, S. 47-53
-
(2017): Beitrag zur Finite-Elemente-Modellierung des nassen Unterwasserschweißens, In: Schafstall, H.; Wohlmuth, M. (Hrsg.): 18. RoundTable Simulating Manufacturing. Tagungsband 30. Mai - 1. Juni 2017, Marburg. Simufact Engineering GmbH, Hamburg, 2017, S. 225-239
-
(2017): Einfluss der lokalen Mikrostruktur auf die Umformbarkeit stranggepresster Werkstoffverbunde, In: Behrens, B.-A. (Hrsg.): Innovationspotenziale in der Umformtechnik. 22. Umformtechnisches Kolloquium Hannover, 15.03.-16.03.2017, Posterbeitrag. TEWISS, Garbsen, 2017, S. 192
-
(2017): Co-extrusion of semi-finished aluminium-steel compounds, In: Brabazon, D.; Naher, S.; Ahad, I. U. (Hrsg.): Proceedings of the 20th International ESAFORM Conference on Material Forming: ESAFORM 2017. 26-28 April 2017, Dublin, Ireland. AIP Publishing LLC, Melville, New York, 2017, S. 140002
DOI: 10.1063/1.5008158 -
(2017): Intercritical Annealing – New Heat Treatment Strategies for Tailoring the Stress-Strain Behavior of 22MnB5, In: Oldenburg, M.; Prakash, B.; Steinhoff, K. (Hrsg.): Hot Sheet Metal Forming of High-Performance Steel CHS2. 6th International Conference, 4-7 June 2017, Atlanta, GA., USA. Verlag Wissenschaftliche Scripten, Auerbach, 2017, S. 433-440
-
(2017): In-situ examination of Cr-Ni steel surfaces heat treated under N2 by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 13th DELTA User Meeting & Annual Report 2017. Dortmund. 29.11.2017, S. 27-28
-
(2016): Fügen von Casingsegmenten mit dem MIAB-Schweißverfahren für die Anwendung am Bohrturm, In: DGMK/ÖGEW-Frühjahrstagung des Fachbereiches Aufsuchung und Gewinnung am 21. und 22. April 2016 in Celle. Deutsche Wissenschaftliche Gesellschaft für Erdöl, Erdgas und Kohle e.V, Hamburg, 2016, S. 139-148
-
(2016): Inherent Load Measurement and Component Identification by multi-dimensional Coded Data in the Component's Subsurface Region, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 537-543
DOI: 10.1016/j.protcy.2016.08.067 -
(2016): Joining TWIP – TWIP-Steels for multi material design in automotive industry using low heat joining technologies, In: Gemeinsame Forschung in der mechanischen Fügetechnik. Tagungsunterlagen mit CD des 6. Fügetechnischen Gemeinschaftskolloquiums am 7. und 8. Dezember 2016 in München. Europäische Forschungsgesellschaft für Blechverarbeitung e.V, Hannover, 2016
-
(2016): Commissioning of a high temperature heater cell for in-situ ReflEXAFS studies of steel surfaces under variable reductive gas atmospheres, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 11-13
-
(2016): Applications of high frequency eddy current technology for material characterization of thin coatings, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 37-43
-
(2016): In-Situ Monitoring of the Microstructure Evolution, In: ATZK - Association for the Heat Treatment of Metals (Hrsg.): Proceedings of the European Conference on Heat Treatment 2016 and 3rd International Conference on Heat Treatment and Surface Engineering in Automotive Applications. 10.05. - 13.05.2016, Prague, Czech Republic
-
(2016): In-Situ Monitoring of the Microstructure Evolution Using Eddy Current Technology, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Material Characterization of Thin Coatings Using High Frequency Eddy Current Technology, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Mechanisms of surface deoxidation of stainless steels in vacuum brazing processes, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 181-185
-
(2016): Microstructure and Magnetic Properties of Cobalt and Zinc Containing Magnesium Alloys, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 35-42
DOI: 10.1016/j.protcy.2016.08.006 -
(2016): The Concept of Technical Inheritance in Operation: Analysis of the Information Flow in the Life Cycle of Smart Products, In: Procedia Technology. 3rd International Conference on System-Integrated Intelligence. Paderborn. 13.06. - 15.06.2016. Elsevier, Amsterdam, 2016, S. 79-88
DOI: 10.1016/j.protcy.2016.08.012 -
(2016): Degradation of MgF2-Coated and Uncoated MgNd2 Specimens in Contact with Nasal Mucosa, In: 145. TMS Annual Meeting & Exhebition, Magnesium technology 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 331-335
-
(2016): Fluxfree brazing of copper based alloys and steels at temperatures between 650 °C and 850 °C in monosilane-doped nitrogen, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 186-191
-
(2016): Applications of high frequency induction thermography in themegahertz range for material characterization of turbine components, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 31-36
-
(2016): Non-Destructive Damage Detection and Material Characterization of Turbine Components Using Megahertz Range Induction Thermography in Pulsed Mode, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Evolution of void shape anisotropy in deformed bcc steels, In: 145. TMS Annual Meeting & Exhebition, Proceedings of the Epd Congress 2016. John Wiley & Sons, Inc., Hoboken, New Jersey, 2016, S. 173-179
-
(2016): Development of intelligent hot forging tools with increased wear resistance by cyclic edge-zone hardening, In: Proceedings of the 10th TOOL Conference 2016. Bratislava, Slowakei. 04.10. - 07.10.2016, S. 316-325
-
(2016): MagnetArc Schweißen - Moderne Fügetechnik zum Verschweißen dickwandiger Rohre in der Bohrindustrie, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 37-42
-
(2016): Gefüge und mechanische Eigenschaften impfbehandelter Schweißnähte an Titan, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 49-53
ISBN: 978-3-945023-74-7 -
(2016): Anwendungspotentiale der atmosphärischen Elektronenstrahltechnik als universelles Fertigungsverfahren für die Blechbearbeitung, In: DVS Congress 2016. Große Schweißtechnische Tagung, Leipzig, 19. und 20. September 2016, S. 399-403
-
(2016): Automated Underwater Arc Welding, In: Overmayer, L.; Shkodyrev, V. (Hrsg.): AST - Symposium on Automated Systems and Technologies. Hannover, 12.10.-13.10.2016. PZH Verlag, Garbsen, 2016, S. 21-26
ISBN: 978-3-95900-102-1 -
(2016): Transplantation of Micro- and Nanostructured Coatings by Means of Thermal Spraying and PVD, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 3-11
-
(2016): Introducing Selective Laser Melting to Manufacture Machine Elements, In: Marjanović, D. et al. (Hrsg.): Proceedings of the DESIGN 2016 14th International Design Conference. Dubrovnik, Croatia. 16.05.-19.05.2016, S. 831-842
-
(2016): Development of copper and nickel based brazing solders with a low brazing and a high remelting temperature, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 272-277
-
(2016): Herstellung von innenbeschichteten Druckgussbauteilen durch das Schichttransplantationsverfahren, 16. Internationaler Deutscher Druckgusstag, Nürnberg, 12.01. - 14.01.2016
-
(2016): Construction of an experimental set-up for brazing stainless steel samples in low vacuum atmosphere consisting monosilane-doped argon, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 311-315
-
(2016): Cold pressure welding by incremental rolling: Deformation zone analysis, In: Chinesta, F.; Cueto, E.; Abisset-Chavanne, E. (Hrsg.): Proceedings of the 19th International ESAFORM Conference on Material Forming: ESAFORM 2016. Nantes, France. 27-29 April 2016. AIP Publishing LLC, Melville, New York, S. 100013
-
(2016): Development of a combined brazing-nitriding process for the production of bipolar plates made of chromium coated metal sheets, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 174-180
-
(2016): Manufacturing of multiphase steel with adapted material properties, In: Special Workshop Multiscale Modeling of Heterogeneous Structures. 21.-23. Sept. 2016, Dubrovnik, Kroatien
-
(2016): Adapted multi-phase microstructures by intercritical annealing and press hardening, In: Furuhara, T.; Nishida, M.; Miura S. (Hrsg.): The Ninth Pacific Rim International Conference on Advanced Materials and Processing (PRICM9). Kyoto, Japan. 01.-05. Aug. 2016. Wiley-VCH, 2016, S. 295-298
-
(2016): Short-time nitridation of electroplated chromium coatings in SiH4-doped N2- atmosphere analysed by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 53-54
-
(2016): Selectively Oxidised Tool Steel Surfaces for Sheet Metal Forming, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 179-185
ISBN: 978-3-95900-072-7 -
(2015): Spectral measurement of element solubility in water up to 300 MPa, WJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
-
(2015): Characterisation of native stomach tissue of swine by uniaxial tensile testing, Biomed Tech 2015, DGBMT, 60 (s1), 108-109
DOI: 10.1515/bmt-2015-5004 -
(2015): Hot forming and subsequent cooling outside the press for adjusted tailored properties of 22MnB5 steel sheets, In: Steinhoff, K.; Oldenburg, M.; Prakash, B. (Hg.): Hot Sheet Metal Forming of High Performance Steel. 5th International Conference Proceedings CHS2. Verl. Wiss. Scripten, Auerbach; S. 35-44.
ISBN: 978-3-95735-023-7 -
(2015): Sensor-controlled bainitic transformation and microstructure formation of forgings during the cooling process, In: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 319–328.
-
(2015): Non-destructive in situ monitoring of the microstructural development in high performance steel components during heat treatment, In: Associazone Italiana di Metallurgia (AIM) (Hg.): Proceedings of the European Conference on Heat Treatment 2015 & 22nd IFHTSE Congress, 20.-22.05.2015, Venice, Italy
ISBN: 978-88-98990-03-0 -
(2015): Non-destructive Testing of Longitudinal and Charge Weld Seams in Extruded Aluminum and Magnesium Profiles, Materials Today: Proceedings. Aluminium Two Thousand World Congress and International Conference on Extrusion and Benchmark ICEB 2015, 2015, S. 4866-4873
DOI: 10.1016/j.matpr.2015.10.037 -
(2015): Präparation plastisch umgeformter Stahlproben durch Ionenstrahlbearbeitung für die Untersuchung von duktiler Schädigung, In: Petzow, W. (Hg.): Fortschritte in der Metallographie. Berichte der 49. Metallographie-Tagung Dresden, 16. bis 18. September 2015; S. 153–158
ISBN: 978-3-88355-410-5 -
(2015): Comparsion of the mechanisms of void formation by plastic deformation in single- and dual-phase bcc-steels, Proceedings of the TMS 2015 Annual Meeting 2015, Characterization of minerals, metals, and materials, Orlando, Florida, 15.-19.03.2015. Hoboken, New Jersey: John Wiley & Sons, Inc, S. 75–81
DOI: 10.1002/9781119093404.ch9
ISBN: 978-1-119-08246-0 -
(2015): A process chain using a non-vacuum electron beam as a universal tool for material processing, Proceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
-
(2015): Trennen von Spundwänden mittels CAMG-Technik, In: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 10-15
ISBN: 978-3-945023-43-3 -
(2015): Aus der Forschung in die Praxis – Entwicklung einer neuen Stabelektrode zum nassen Unterwasserschweißen, In: DVS-Berichte Band 318, Unterwassertechnik. Hamburg, 10. und 11. November 2015, S. 4-9
ISBN: 978-3-945023-43-3 -
(2015): Determination of heat transfer coefficients for complex spray cooling arrangements, In: Zoch, H.-W.; Lübben, T. (Hg.): Proceedings of the 5th International Conference on Distortion Engineering, 2015; S. 247–256
-
(2015): Inkrementelles Umformen dünnwandiger Funktionsbauteile unter Einsatz prozessangepasster Halbzeuge durch Verfahren der Blechmassivumformung, Tekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 149-170
ISBN: 978-3-8440-3434-9 -
(2015): Entwicklung einer korrosions- und verschleißbeständigen Eisenbasisschicht, In: Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Tagungsband 1. Niedersächsisches Symposium Materialtechnik, 12. bis 13. Februar 2015. Shaker, Herzogenrath, 2015, S. 101-112
-
(2015): Gelötete Metall-Keramik-Verbunde in Werkzeugen, In: DVS-Berichte Bd. 315, Tagungsband des DVS Congress und Expo in Nürnberg. DVS-Media, Düsseldorf; S. 559-562
-
(2015): Schnell und sicher Bauteile aus Zirkalloy trennen / Cutting Zircaloy components quickly and safely, In: Tagungsband KONTEC 2015 - 12. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle“, Dresden, 25.-27. März 2015, S. 598-616
-
(2015): Smart System Integration: Moulding of Magnetic Field Sensors into AlSi9Cu3(Fe)-Alloys, In: SMTA, Pan Pacific Symposium Conference Proceedings, 2015.
-
(2015): Microstructure and Properties of Cobalt- and Zinc-Containing Magnetic Magnesium Alloys Processed by High-Pressure Die Casting, In: Manuel, M. V. et al. (Hg.): Magnesium Technology 2015. Proceedings of a symposium sponsored by Magnesium Committee of the Light Metals Division of The Minerals, Metals & Materials Society (TMS), 144th Annual Meeting & Exhibition, 15.-19.03.2015, Orlando, Florida. John Wiley & Sons, Inc., Hoboken, New Jersey, 2015; S. 451-454
-
(2015): Transplantation of Thermal Sprayed Coatings, ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 753-755
ISBN: 978-1-62708-093-4 -
(2015): Stress-induced transformation on Ni-Mn-In alloy and the concomitant change of resistivity, 10th European Symposium on Martensitic Transformations (ESOMAT 2015), Poster presentation, 14. - 17. September 2015, Antwerpen.
-
(2015): Lichtbogenschweißen von Titanlegierungen – Einfluss von Impfmitteln auf das Schweißgefüge von TiAl6V4, Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Fortschrittsberichte der Materialforschung und Werkstofftechnik; Tagungsband zum 1. Niedersächsischen Symposium Materialtechnik. 12. bis 13. Februar 2015. Herzogenrath: Shaker, S. 176–185
ISBN: 978-3-8440-3403-5 -
(2015): Formhärten und Spraykühlung – Potenziale und Anwendungsmöglichkeiten, In: Merklein, M. (Hrsg.): 10. Erlanger Workshop Warmblechumformung 2015. Meisenbach GmbH-Verlag, Bamberg, 2015, S. 59-78
-
(2015): Robot-based non-vacuum electron beam technology with a plasma cathode EB emitter, Proceedings of VIII International Conference on Beam Technologies and Laser Application, BTLA2015. St. Petersburg. 20.-24.09.2015
-
(2015): Development of a two-stage hybrid Technology for repairing Turbine Blades, In: ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 37-40
-
(2015): Future regeneration processes for high pressure turbine blades, Deutscher Luft- und Raumfahrtkongress, Rostock, 22.09.-24.09.2015 More info
-
(2015): Sensorkontrollierte Bainitumwandlung aus der Schmiedewärme bei modernen Hochleistungsbauteilen im Leichtbau, Werkstoffwoche 2015, Dresden, 14. - 17.09.2015
-
(2015): Hochleistungsbauteile für den Leichtbau mit sensorkontrollierter Bainitumwandlung aus der Schmiedewärme, In: Borsutzki, M. (Hrsg.): Fortschritte in der Werkstoffprüfung für Forschung und Praxis. Verl. Stahleisen, Düsseldorf, 2015, S. 221-228
-
(2015): Characterisation of selective oxidised steel surfaces by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 11th DELTA User Meeting & Annual Report 2015, 2015; S. 70-71
-
(2015): Particle Disintegration in the Abrasive Water Injection Jet, WJTA-IMCA Conference and Expo, 2.-4. November 2015, New Orleans, Louisiana
-
(2015): Möglichkeiten der simulativen Vorhersage von Temperaturentwicklung und Bauteilversagen infolge plastischer Deformation bei DP600 Bauteilen, Tekkaya, A. E.; Liewald, M.; Merklein, M.; Behrens, B.-A. (Hg.): Tagungsband zum 18. Workshop Simulation in der Umformtechnik & 3. Industriekolloquium Blechmassivumformung 2015 - DFG Transregio 73, Dortmund, 26. - 27. Februar. Aachen: Shaker Verlag, S. 113–128
-
(2015): Homogenization of Coating Properties in Three-Cathode Atmospheric Plasma Spraying by Use of Advanced Diagnostics and Numerical Simulation - Investigations of Suspension Plasma Spraying (SPS), In: ASM International (Hrsg.): Proceedings from the International Thermal Spray Conference 2015; S. 452-459
-
(2014): New valve technology for AWSJ cutting, Proceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 99-106
-
(2014): Characterization of native and decellularised aortic tissue by using uniaxial tensile test, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.115
DOI: 10.1515/bmt-2014-4509 -
(2014): Acoustic process monitoring during transient precision forging of high strengh components, Ludger Overmeyer und Vyacheslav P. Shkodyrev (Hg.): AST - Symposium on Automated Systems and Technologies. Proceedings, Hannover, 15-16 October 2014. 1. Aufl. Garbsen: TEWISS (Berichte aus dem ITA, 2014, Bd. 4), S. 105–110
-
(2014): EcoForge - Prozessintegrierte Wärmebehandlung bainitischer Stähle , Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 245-264
ISBN: 978-3-00-045166-9 -
(2014): Material-inherent data storage using magnetic magnesium-cobalt alloys, Procedia Technology 5, 2nd International Conference of System-Integrated Intelligence: Challenges for Product and Production Engineering Bremen, 2.-04.07.2014, S. 188-197
DOI: 10.1016/j.protcy.2014.09.071 -
(2014): Changes on a platinum electrode surface during acoustic stimulation of a cochlear implant – in vitro approach, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S. 1144–1147
DOI: 10.1515/bmt-2014-5014 -
(2014): Biocompatibility of MgF2-coated MgNd2 alloys in contact with nasal mucosal tissue – in vivo approach, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.108
DOI: 10.1515/bmt-2014-5000 -
(2014): In vivo study of a biodegradable nasal stent (MgF2-coated MgNd2 alloy) in a minipig for up to six months, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1203
DOI: 10.1515/bmt-2014-5014 -
(2014): Drawing and Stranding of Magnesium Wires for use as a Resorbable Suture Material, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1186
DOI: 10.1515/bmt-2014-5014 -
(2014): Experimental investigations on forming limits for aluminium alloy sheet metal at various strain rates, In: H. Huh und A. E. Tekkaya (Hg.): High Speed Forming 2014. Proceedings of the 6th International Conference. Organizing committee of the 6th International Conference on High Speed Forming, May 26–29 2014, Korea Advanced Institute of Science and Technology, Department of Mechanical Engineering. Daejeon, Korea. pp. 11–20.
-
(2014): Magnetizable implants as tool for improved magnetic drug targeting, In: Tissue Engineering & Regenerative Medicine International Society (Hrsg.): Termis, European Chapter Meeting. Special issue, Journal of Tissue Engineering and Regenerative Medicine. Genova, Italy. 10.-13.06.2014, S. 59-60
DOI: 10.1002/term.1931 -
(2014): Development and Analysis of Microstructures for the Transplantation of Thermally Sprayed Coatings, Procedia CIRP Vol. 14, 6th CIRP International Conference on High Performance Cutting, HPC2014, S. 245 -250
DOI: 10.1016/j.procir.2014.03.054 -
(2014): A novel process for producing large scale Mg-sheets, Magnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 289-292
ISBN: 978-1-118-88816-2 -
(2014): Influence of the twin-roll casting parameters on the microsegregation in thin strips of the aluminium alloy EN AW-6082, Wiley, TMS, 2014, Light Metals 2014, P. 411-414 More info
-
(2014): Study of magnesium fluoride and self-assembled organosilane coatings of AZ31 and MgCa0.8 alloys, 6th Symposium on Biodegradable Metals, University Politecnico di Milano, Maratea, Italien, 24.-29. August 2014
-
(2014): Entwicklung und Test eines Prüfverfahrens zur Bewertung von Lötverbindungen bei kombinierter mechanisch-korrosiver Belastung, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 164-171
ISBN: 978-3-00-046877-3 -
(2014): Transparent PVD-coatings on zirconia for dental applications, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014
-
(2014): Decellularized aortic allograft stabilized by an absorbable magnesium scaffold for substitution of the descending aorta, Thorac cardiovasc Surg (The Thoracic and Cardiovascular Surgeon)
DOI: 10.1055/s-0034-1367288 -
(2014): Transfer of Micro-structures by Transplantation of Thermal Sprayed Coatings, ITSC 2014 Conference proceedings, lectures and posters, 21. - 23.5.2014, Barcelona, Spanien, S. 142–145
ISBN: 978-3-87155-574-9 -
(2014): Ex-situ EXAFS investigations of steel deoxidation processes, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 10th DELTA User Meeting & Annual Report 2014. Dortmund, 26.11.2014, S. 105-106
-
(2014): Blechmassivumformung - vom Halbzeug zum Funktionsbauteil, Behrens, B. A. (Hg.): 21. Umformtechnisches Kolloquium Hannover, Industrie und Wissenschaft – Gemeinsam die Zukunft gestalten, 2014; S. 265-280
-
(2014): Common application of Ni-based fillermetals and hotgascorrosion protection coatings by means of thermal spraying with subsequent heat treatment for near net shape turbineblade repairing, In: Bouzakis, K.-D. et al. (Hrsg.): Proceedings / 11th International Conference THE "A" Coatings in Manufacturing Engineering, 1 - 3 October 2014, Thessaloniki, Greece. Ed. Ziti, Thessaloniki, 2014, S. 179-184
ISBN: 978-960-98780-8-1 -
(2014): Spray Cooling of Early Extracted Hot Stamped Parts, TMS 2014, 143. Annual Meeting Supplemental Proceedings, John Wiley & Sons, Inc., Hoboken, NJ, 16.–20.02.2014, in San Diego, California USA More info
DOI: 10.1002/9781118889879.ch116
ISBN: 9781118889879 -
(2014): Sensorkontrollierte Umwandlung aus der Schmiedewärme zur Prozesssteuerung und Bauteiloptimierung , Behrens, B.-A. (Hg.): Tagungsband zum 21. Umformtechnisches Kolloquium Hannover, S. 338
ISBN: 978-3-00-045166-9 -
(2014): Coating Systems for Biodegradable Magnesium Applications, Magnesium Technology 2014, TMS (The Minerals, Metals & Materials Society), Wiley Published by John Wiley & Sons, Inc., Hoboken, New Jersey. Published simultaneously in Canada, (2014), S. 371-374
ISBN: 978-1-118-88816-2 -
(2014): Heat Treatment of Aluminum-Titanium-Compounds Made by Co-Extrusion and Friction Welding, Aluminium Alloys 2014 - ICAA14, Materials Science Forum, 794-796, S. 839–844
DOI: 10.4028/www.scientific.net/MSF.794-796.839 -
(2014): Finite element simulations for development of cardiovascular implants to support biological grafts, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.984
DOI: 10.1515/bmt-2014-4422 -
(2014): In vitro degradation and biomechanical testing of magnesium alloys, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.16
DOI: 10.1515/bmt-2014-5000 -
(2014): Roboterassistierte Umstellungsosteotomie mittels Wasserabrasivstahltechnik, Deutsche Gesellschaft für Computer‐ und Roboter Assistierte Chirurgie, Session XV
-
(2014): Robot Guided Water Jet Cutting to Assist Osteotomies of Human Bones, Video-Proceedings - IEEE, International Conference on Robotics and Automation, Hong Kong, May/June 2014, Video
-
(2014): Aufbau einer RF-PVD Anlage zur Abscheidung sauerstoffaffiner Materialien für die Herstellung wärmegenerierender Systeme, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 247–254
ISBN: 978-3-00-046877-3 -
(2014): Method for the material-specific repair preparation of carbon fiber reinforced plastic structures, Proceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 45-56.
-
(2013): Process Time Reduction of Hot Stamping by Means of Early Extraction from the Press, In: Mats Oldenburg und Kurt Steinhoff (Hg.): Proceedings / 4th International Conference Hot Sheet Metal Forming of High Performance Steel. June 9 - 12, 2013, Luleå, Sweden. Auerbach: Verl. Wiss. Scripten (CHS 2 series, 4), S. 259-266 (8).
-
(2013): Untersuchung und Qualifizierung thermisch gespritzter Korrosionsschutzschichten für dickwandige Behälterbauteile, Internationales Symposium Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle, In: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Dresden. 13.-15.03.2013, S. 555-562
-
(2013): Influence of different storage durations on the properties of degradable magnesium based implants, European Cells and Materials Vol. 26. Suppl. 5, 2013 (page 17) More info
-
(2013): Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology, 9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013
-
(2013): Abbildung des Werkstoffverhaltens von ferritischem Stahl in numerischen Modellen zur Darstellung von Blechmassivumformprozessen bei zyklischen Belastungspfaden, In: M. Merklein, B.- A. Behrens und A. E. Tekkaya (Hg.): 2. Workshop Blechmassivumformung. Umformtechnische Herstellung von komplexen Funktionsbauteilen mit Nebenformelementen aus Feinblechen - Blechmassivumformung -. Erlangen, 13.11.2013. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 69–84.
-
(2013): High Frequency Eddy-Current and Induction Thermography Inspection Techniques for Turbine Components, In: 18th International Workshop on Electromagnetic Non-destructive Evaluation (ENDE). Bratislava, SK, 25.-28.06.2013.
ISBN: 978-80-554-0713-5 -
(2013): Nutzung von Beschichtungen aus Zinklegierungen zur Steigerung der Wärmeleitfähigkeit beim Verbundguss von Kupfer und Aluminium im Druckgussprozess, In: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 9
-
(2013): Herausforderung beim Reparaturschweißen an Spundwandbauwerken im nassen und halbnassen Bereich, In: Wirtschaftsvereinigung Stahl (Hrsg.): Fachseminar „Stahlspundwände – Neues für Planung und Anwendung“. Hannover. 12. Dezember 2013
-
(2013): Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVER, In: 66th IIW Annual Assembly. Commission XII „Arc Welding Processes and Production Systems“. Unter Mitarbeit von International Institute of Welding
-
(2013): Three-Dimensional Crack Propagation in Ductile Media Using The XFEM, CFRAC 2013 Prag, Erschienen in: Computational Modeling of Fracture and Failure of Materials and Structures (Editoren: M. Jirasek, O. Allix, N. Moes, J. Oliver), ISBN: 978-80-01-05279-2; 2013; Seite 125
-
(2013): Injection molding, characterization and application of polymer bonded nickel based braze metal preforms for high temperature brazing processes, Proceedings of 10th International Conference on Brazing, High Temperature Brazing and Diffusion Brazing, Aachen, Juni 2013, S. 11-16
-
(2013): Zerlegen metallischer Strukturen im kerntechnischen Umfeld durch Verwendung von Schneidladungen / Cutting of metal structures with linear cutter charges in nuclear power plants, In: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 513–545.
-
(2013): Zirkoniumlegierungen universell und sicher Schneiden – ZIRKUSS Universal and safe cutting techniques for zirconium alloys - ZIRKUSS, In: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 612–626.
-
(2013): Evaluating a novel class of biomaterials: Magnesium-containing layered double hydroxides, BMT 2013, 3-Ländertagung D-A-CH, Graz, 19-21.09.2013
-
(2013): Injection molding and application of ring-shaped polymer-bonded braze metal preforms, Tagungsband: Design of/with composites, Composites Week @ Leuven, Leuven (Belgien), September 2013
-
(2013): Sensorische Werkstoffe - Erfassen und Nutzen mechanischer Beanspruchungsdaten im Lebenszyklus gentelligenter Bauteile, In: 8. Aachener Oberflächentechnik Kolloquium 2013. Herzogenrath (K. Bobzin (Hg.)), Shaker, 2013, S. 59–66
-
(2013): Measurement of static and dynamic loads utilizing sensory magnesium components, In: Euro Intelligent Materials 2013 (E. Quandt und C. Selhuber-Unkel (Hg.)), DGM, 2013, S. 57
-
(2013): Transfer of Micro-structures by Transplantation of Thermal Sprayed Coatings, In: Proceedings of the 10th International Conference THE “A“ Coatings (K.-D. Bouzakis, K. Bobzin, B. Denkena und M. Merklein (Hg.)), Shaker, Aachen, 2013, S. 193–204
-
(2013): Hydrophobierung von Stabelektroden zum nassen Lichtbogenhand-schweißen unter Wasser – Wo liegen die Möglichkeiten?, In: DVS-Berichte Band 296, Große Schweißtechnische Tagung, Essen, 16. bis 21. September 2013, S. 56–62
DOI: 978-3-87155-614-2 -
(2013): Development of flux free filler metals and processes for brazing of aluminum, In: Brazing, high temperature brazing and diffusion bonding. LÖT 2013, lectures and posters of the 10th international conference taking place in Aachen on 18th to 20th June 2013. Als Ms. gedr. Düsseldorf: DVS Media (DVS-Berichte, 293), 2013, S. 205–211
-
(2013): EcoForge – Resource-efficient process chains for high-performance components, Liewald (Hg.): Tagungsband Neuere Entwicklungen in der Massivumformung, Fellbach, 4. - 5.6.2013, S. 117–147
ISBN: 978-3-88355-395-5 -
(2013): Untersuchung der mikro- und makroskopischen Abbildungsgenauigkeit von im Schichttransplantationsprozess übertragenden Oberflächenbeschichtungen, In: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 10
-
(2013): Hot-Wire-Plasmaschneiden: Zerlegen von komplexen Bauteilen und Verbundwerkstoffen / Hot-Wire plasma arc cutting: Cutting of complex structures and composite materials, In: Kontec Gesellschaft für technische Kommunikation (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle. Hamburg, S. 463–486
-
(2013): Sensorkontrollierte Umwandlung von Hochleistungsbauteilen aus der Schmiedewärme, In: Christ, H.-J. (Hrsg.): Tagung Werkstoffprüfung – Fortschritte in der Werkstoffprüfung für Forschung und Praxis, 28.11.-29.11. 2013, Neu-Ulm, S. 271-277
ISBN: 978-3-514-00806-9 -
(2013): Bond quality investigation of ultrasonic assisted composite casting, In: 10th International Workshop on Piezoelectric Materials and Applications in Actuators and 8th Annual Energy Harvesting Workshop More info
-
(2013): Zeiteffiziente Prozesskettenmodellierung und-berechnung in der Blechumformung und -verarbeitung, In: R. Kawalla (Hg.): MEFORM 2013. Simulation von Umformprozessen. ACATRAIN e.V., Institut für Metallformung. Freiberg: TU Bergakademie Freiberg, S. 314–326.
-
(2013): Partielles Vergüten mittels verkürztem Formhärteprozess und nachgeschalteter Spraykühlung, In: M. Merklein (Hg.): 8. Erlanger Workshop Warmblechumformung. Bamberg, Germany: Meisenbach GmbH-Verlag, S. 65–84.
-
(2013): Robot-Assisted Displacement Osteotomy by the Abrasive Waterjet – Concept and Technical Realization, In: M. Hashish (Hg.): Proceedings of the 2013 WJTA-IMCA Conference and Expo. September 9-11, 2013, George R. Brown Convention Center, Houston, Texas. WaterJet Technology Association. Houston, USA, S. E3.
-
(2012): Herstellung von nachbearbeitungsarmen Innenbeschichtungen auf Druckgussteilen durch Transplantation thermischer Spritzschichten, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 129–139.
-
(2012): Thermische Spritzschichten zur dynamischen Datenspeicherung auf technischen Bauteilen, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 110–119.
-
(2012): Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen, In: FOSTA-EFB-DVS (Hg.): Gemeinsame Forschung in der Mechanischen Fügetechnik. 2. Fügetechnisches Gemeinschaftskolloquium 2012, S. 59–71.
-
(2012): Bauteilpanzerung und Oberflächenstrukturierung durch PVD-Schichttransplantation, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Chemnitz: Eigenverlag, S. 452–457.
-
(2012): Influence of Process Fluctuations on Weld Seam Properties in Aluminum Alloy Extrusion, In: H. Weiland, A. D. Rollet und W. A. Cassada (Hg.): ICAA13: 13th International Conference 2012. Hoboken, NJ, USA: John Wiley & Sons, Inc., S. 1843–1850.
-
(2012): Development of a Pneumatic High-Speed Nakajima Testing Device, In: A. E. Tekkaya, G. Daehn und M. Kleiner (Hg.): High Speed Forming 2012. Proceedings of the 5th International Conference. Organizing committee of the 5th International Conference on High Speed Forming, April 24 – 26 2012, Technische Universität Dortmund, Faculty of Mechanical Engi-neering, Institute of Forming Technology and Lightweight Construction and De-partment of Materials Science and Engineering of the Ohio State University. Dortmund, S. 155–164.
-
(2012): Distortion analysis of air hardened deep drawn parts of the air-hardened steel LH800, In: D.S MacKenzie (Hg.): Quenching Control and Distortion. Proceedings of the 6th International Quenching and Control of Distortion Confer-ence including the 4th International Distortion Engineering Conference. ASM International. Materials Park, Ohio 44073-0002: ASM International, S. 829–838.
-
(2012): Physikalisch-chemische Betrachtungen zur Oxidschichtauflösung beim Hartlöten von Stählen mit Cu- und AgCu-Loten, In: Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Unter Mitarbeit von B. Wielage. Chemnitz: Eigenverlag, S. 465–472.
-
(2012): Production and Comparison of Adapted Load-sensitive Magnesium Alloys, In: B. Denkena, J. Gausemeier und B. Scholz-Reiter (Hg.): SysInt - 1st Joint International Symposium on System-integrated Intelligence. New Challenges for Production Engineering 27.-29.06.2012. CIRP The International Academy for Production Engineering. Garbsen: PZH Verlag, S. 56–58.
ISBN: 978-3-943104-59-2 -
(2012): The physical and numerical modeling of intergranular fracture in the mg-ca alloys during cold plastic deformation, In: K. Mori, M. Pietrzyk, J. Kusiak, J. Majta, P. Hartley und J. Lin (Hg.): Steel Research International. Special Edition: 14th International Conference Metal Forming. Weinheim, Germany: WILEY-VCH Verlag GmbH & Co. KGaA, S. 863–866.
-
(2012): New advances in non-vacuum electron beam cutting, In: Wilfried Behr (Hg.): International Electron Beam Welding Conference. Lectures of the 2nd IEBW Conference taking place in Aachen on March 26 - 30, 2012. Düsseldorf: DVS Media (DVS-Berichte, 285).
-
(2012): A New Hybrid Process for Repair Brazing and Coating of Turbine Blades, In: R.S Lima, A. Agarwal, M.M Hyland, Y.-C Lau, C. Li, A. McDonald und F.-L Toma (Hg.): International Thermal Spray Conference and Exposition (ITSC 2012). Conference Proceedings, 20.05. – 24.05.2012, Houston, TX, USA. ASM International. Novelty, OH, USA: ASM International, S. 110–113.
-
(2012): Grundlagenuntersuchungen und Emissionsmessungen beim Hot-Wire-Plasmaschneiden, In: Deutscher Verband für Schweißen und Verwandte Verfahren (DVS) (Hg.): DVS-Berichte Band 286. Tagungsband des DVS-Congress 2012. Düsseldorf: DVS Media, S. 137–142.
-
(2012): Zeitbereichsanalyse transienten Umformverhaltens zur Qualitätsbewertung beim Präzisionsschmieden von Hochleistungsbauteilen, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
-
(2012): Prüfung hochbeanspruchter Sohlverankerungslaschen in Wehranlagen auf Rissanzeigen unter Wasser, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
-
(2012): Nachweis von lokalen Schädigungen an Hochleistungsbauteilen mit Hochfrequenz Wirbelstromtechniken und Induktions-Thermografie, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.
-
(2012): Ultrasonic Assisted Simultaneous Composite Casting – A feasibility study, 2012 IEEE International Ultrasonics Symposium, S. 775-777
DOI: 10.1109/ULTSYM.2012.0193
ISBN: 978-1-4673-4562-0 -
(2012): Implementation of Heat Treatment into the Aluminum Extrusion Process, Materials Science & Technology 2012. ACerS, AIST ASM TMS NACE. Pittsburgh, Pennsylvania, USA, 07.10.2012
-
(2012): Numerical simulation methods for complex induction hardening processes, In: International Union for Electricity Applications (UIE) (Hg.): XVII Congress UIE Proceedings. Energy efficient, economically sound, ecologically respectful, educationally en-forced electrotechnologies, S. 98–103.
-
(2012): Magnesium Wire Materials, In: J. Grigoleit (Hg.): Wrought Magnesium Alloys - Resource-efficient Production and Applications. Proceedings: 63rd Freiberg Research Forum for Mining and Metallurgy. Freiberg: Eigenverlag, S. 28–31.
-
(2012): Casing connection method with improved Strength and Reliability for Monobore Wellbore Constructions, In: GeoEnergy Celle e.V Celle Drilling (Hg.): Celle Drilling 2012. International Conference for Advanced Drilling Technology
-
(2011): Herstellung von Druckgussteilen mit mikrostrukturierten Funktionsschichten, durch die Transplantation von thermischen Spritzschichten, In: Tagungsband zum Werkstofftechnischen Kolloquium (14. Werkstofftechnisches Kolloquium), S. 24–33
-
(2011): Cost-efficient Monobore Well Construction for Geothermal Energy, Proceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE
-
(2011): Erhöhung des verschleißwiderstandes von Werkzeugen der Warmmassivumformung durch Ausnutzung der zyklischen Randschichthärtung, 20. Umformtechnisches Kolloquium Hannover. Hannover, 23.02.2011.
-
(2011): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK - Ein Überblick zum Abschluss des Projektes, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 608-621
-
(2011): Design of Interference Screws for the Cruiciate Ligament Reconstuction: A Finite Element Study, 4th International Conference on the Mechanics of Biomaterials and Tissues (ICOMBT)
-
(2011): Tissue Engineering of magnesium stabilized, vascularized, autologus gastric tissue for cardiac muscle replacement, ESAO-Kongress Oktober 2011
-
(2011): Numerische und metallurgische Analyse der Werkstoffschädigung in der Blechmassivumformung, M. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 33–50.
-
(2011): Finite-element Simulation of the Evolution of Plastic Anisotropy, Steel Research International: ICTP 2011 Special Issue, September 2011
-
(2011): Modeling and characteriziation of the evolution of the dislocation structure during non-monotonic loading. Part 2: Modeling transient behavior, Proceedings of 17. International Symposium on Plasticity and its current Applications 2011. Macro to Nano-scale, Inelastic Deformation and Failure of Materials & Multi-scale Modeling. 03.-08.01.2011, Puerto Vallarta, Mexico, S. 172–174.
-
(2011): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Wielage (Hg.) 2010 – Tagungsband 13. Werkstofftechnisches Kolloquium Chemnitz
-
(2011): Quality Control of High Tension 3D-NVEB-Weld Joints, Proceedings of the International Symposion on Digital Industrial Radiology and Computed Tomography
-
(2011): Effect of waterjetsdrilling in bone, Annual meeting of the Dutch Orthopaedic Society (NOV), Groningen, January 2011
-
(2011): Tribological behaviour of suspension plasma sprayed coatings for hot extrusion tools, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
-
(2011): Three anodes compared to three cathodes: Evaluation of gun concepts for high performance plasma spraying operation, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
-
(2011): Achieving new thermal spray coatings by usage of multielectrode plasma guns, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 353–360.
-
(2011): Suspension Plasma Spraying of oxide ceramic coatings on massive forming tools, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 337–346.
-
(2011): Modeling and characteriziation of the evolution of the dislocation structure during non-monotonic loading. Part 1: Electron-microscopic analysis, Proceedings of 17. International Symposium on Plasticity and its current Applications 2011. Macro to Nano-scale, Inelastic Deformation and Failure of Materials & Multi-scale Modeling. 03.-08.01.2011, Puerto Vallarta, Mexico, S. 163-165
-
(2011): A Study of Structure Evolution in Pearlitic Steel Wire at Increasing Plastic Deformation, Steel research int. 82 (2011) No. 12, p.p. 1368-1374
-
(2011): Verbundstrangpressen von Titan-Aluminium Verbindungen, Tagungsband zum 18. Symposium Verbundwerkstoffe und Werkstoffverbunde Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 41. Chemnitz: Eigenverl., 2011.
ISBN: 978-3-00-033801-4 -
(2011): Entwicklung von Stabelektroden für das nasse Lichtbogenschweißverfahren unter Wasser mittels Simulation von Tauchtiefen durch unbemannte Druckkammersysteme, Deutscher Verband für Schweißen und verwandte Verfahren e.V, Unterwassertechnik 2011, S. 21-27
-
(2011): Hot-Wire-Plasmaschneiden mit exotherm abreagierendem Zusatzwerkstoff zur Erhöhung der Schneidleistung, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011
-
(2011): Systematische Untersuchung von Lichtbogenschweißprozessen unter Wasser, Deutscher Verband für Schweißen und verwandte Verfahren e.V., Unterwassertechnik 2011, S. 16-20
ISBN: 978-3-87155-270-0 -
(2011): Thermal treatment of contaminated concrete surfaces as a decommissioning method for Nuclear Power Plant Buildings, Proceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011, S. 129–135.
-
(2011): Stabilizing structures for the aorta replacement - Static and dynamic testing, BMT 2011, Freiburg, 27.-30. September 2011
-
(2011): Korrosions- und Verschleißschutz von Magnesiumbauteiloberflächen mittels PPA von Titanschichten, DVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275), S. 280–283.
-
(2011): Korrosionsschutzgerechte Konstruktion und Handhabung langzeitstabiler Behälter für die Lagerung schwach- und mittelradioaktiver Abfälle, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 622–628
-
(2011): MMC based materials as an alternative cutting material for cutting densely filled and heavily reinforced concrete structures, Proceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011.
-
(2011): Entwicklung eines LSI-Brenners: Wiederentdeckung des Lichtbogen-Sauerstoff-Impuls-Schneidens, DVS-Berichte Band 275; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Ham-burg vom 27. bis 29. September 2011, S. 122-129
-
(2011): Combined Quasi-Static-Dynamic Forming Processes - Material Modelling, Experimental Validation and Finite Element Technology, In: G. Hirt (Hg.): Special edition: 10th International Conference on Technology of Plasticity, ICTP 2011. [held in Aachen, Germany on September 25th - 30th, 2011]. Düsseldorf: Verl. Stahleisen GmbH (Steel research international Special edition), S. 865–870.
-
(2011): Schneidladung als Zerlegeverfahren beim Rückbau von kerntechnischen Anlagen und Qualifizierung im kerntechnischen Umfeld, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 22-42
-
(2011): Identifikation eines Materialmodells für den DC04 basierend auf dernumerischen Modellierung der c und experimentellen Daten, M. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 13–32.
-
(2011): Development and Validation of a Mathematical Model of Warm Drawing Process of Magnesium Alloys in Heated Dies, 2011 Conference proceedings of the Wire Association International Inc. InterWire2011. Atlanta, Georgia, USA.
-
(2011): Repair Brazing of Turbine Blades using Thermal Spraying, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 347–352.
-
(2011): Reparaturlöten von Turbinenschaufeln mittels Thermischen Spritzens, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen, Bd. 43, pp. 231–236, Chemnitz, Eigenverlag, ISBN 978-3-00-035117-8
-
(2011): Herstellung ultraleichter Magnesium-Verbundprofile, Heinz Palkowski (Hg.): Abschlusskolloquium des Sonderforschungsbereichs 675: Erzeugung hochfester metallischer Strukturen und Verbindungen durch gezieltes Einstellen lokaler Eigenschaften. TU Clausthal, Institut für Metallurgie. Clausthal-Zellerfeld. S. 129 - 134.
-
(2011): Hochtemperatur-Prüftechnik ermöglicht Einblick in die Werkstoffumwandlung und Phasenausbildung bei Hochleistungsbauteilen, In: DGZfP-Jahrestagung 2011 Zerstörungsfreie Materialprüfung. 30. Mai - 1. Juni 2011, Bremen ; Berichtsband. Berlin: DGZfP (Berichtsband / Deutsche Gesellschaft für Zerstörungsfreie Prüfung e.V, 127), S. Di3C2.
-
(2011): Correlation between morphology of dislocation structures and macroscopic loadings, Proc. ICTP 2011, 2011
-
(2011): Vergleichende Überprüfung des Einwachsverhaltens von biologischen Implantaten aus boviner Knochenkompakta und Polylalktidschrauben für die orthopädische Chirugie, Deutscher Kongress für die Orthopädie und Unfallchirugie, Berlin, 25.-28. Oktober
-
(2011): Materialoptimierung und Funktionalisierung dentaler Implantat-Abutments, In: Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK) (Hg.): Spitzenforschung in der Zahnheilkunde. Innovationen und Auszeichnungen 2011. Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK). Lampertheim: ALPHA Informations-GmbH, S. 158–165.
-
(2011): Schweißfalttechnik, Untersuchungen und Prozessentwicklung zur Herstellung faltbarer Tragstrukturen, DVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275).
-
(2011): Joining and coating by the combination of welding and plasma spraying to define metallurgical conditions and produce protective layers with powder and nanoscale materials., 2nd International Symposium on Functional Surfaces in Aachen. Aachen, 13.09.2011.
-
(2011): Design of Folded Tubulars for Expandable Casing Applications, Proceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE
-
(2011): Experimental evaluation of jetting methods for the surface preparation of fiber-reinforced plastics, 11th International Conference on Management of Innovative Technologies and 2nd International Conference on Sustainable Life in Manufacturing, Fiesa, Slovenia, 25–27 September 2011.
-
(2010): Mechanical Surface Treatment to Obtain Optically Cooperative Surfaces vis-à-vis Fringe Projection, Reflection, scattering, and diffraction from surfaces II Proceedings of SPIE Vol. 7792, S. 77920V-77920V-9. Bellingham, Wash.: SPIE, 2010.
ISBN: 9780819482884 -
(2010): Berührungslose Geometrieprüfung endbearbeiteter Bauteile mit optisch nicht kooperativen Oberflächen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 313-317. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Production of Magnesium Implants with Adapted Properties, Product Property Prediction, S. 93-99. Dortmund, 2010.
-
(2010): In-process generation of water ice particles for cutting and cleaning purposes, 20th International Conference on Water Jetting, Graz, Austria, 20.-22. Oktober 2010, S. 275-283
ISBN: 978-1-85598-121-8 -
(2010): Beitrag zum Auftraglöten und -schweißen von Panzerungen mit hoher Verschleißreserve, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 55-63. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Qualitative Vorausberechnungen der Benetzungsvorgänge beim Löten mittels Methoden der klassischen Molekulardynamik (MD), Hart- und Hochtemperaturlöten und Diffusionsschweißen. LÖT 2010 ; Vorträge und Posterbeiträge des 9. internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2010 & Brazing, high temperature brazing and diffusion bonding. Löt; Deutscher Verband für Schweißen und Verwandte Verfahren. Düsseldorf: DVS Media (DVS-Berichte, 263), S. 248–254.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System AlSiZn, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 117-121. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Hartlöten von Edelstahl im Schutzgasdurchlaufofen mit modifizierten Ni-Hartloten, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 266-271. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Fügen von Aluminium-Stahl-Hybridwerkstoffen mit zinkhaltigen Loten unter Einsatz reaktiver Gaszusätze im Schutzgasofen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 318-324. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Neue Lösungswege für das Reparaturlöten und -beschichten von Turbinenschaufeln: Machining Innovations Conference Tagungsband 23. und 24. November 2010 Hannover, Neue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 435-447. Garbsen: PZH Produktionstechn. Zentrum, 2010.
ISBN: 978-3-941416-78-9 -
(2010): Entwicklung einer Fertigungstechnik für Metall-Kapillardruckgießprozesse, Maschinen-, Werkzeug- und Prozessentwicklung für neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, S. 3-8. Erlangen-Tennenlohe: Lehrstuhl für Kunststofftechnik Univ. Erlangen-Nürnberg, 2010.
ISBN: 978-3-931864-49-1 -
(2010): Metall-Kapillardruckgießen - Gießen im Mikrometermaßstab, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 307-312. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Homogenization of Coating Properties in Atmospheric Plasma Spraying - Current Results of a DFG (German Research Foundation)-Funded Research Group, Thermal spray: global solutions for future application DVS-Berichte Vol. 264. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-590-9 -
(2010): Prozesskettenverkürzte Fertigung von Leichtmetall-Druckgussverbundbauteilen durch Transplantation thermisch gespritzter Schichten, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 110-120. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Computation of the Isothermal Transformation Diagrams of 42CrMo4 Steel from Dilatometer Measurements with Continuous Cooling, {Conf. Proc.}. Shanghai, China, 31.03.-02.06. 2010.
-
(2010): Experimental and Numerical Investigations on Microstructural Evolution during a Hot Stamping Process, Tools and technologies for the processing of ultra high strength steels, S. 81-90. Graz: Verl. der Techn. Univ. Graz, 2010.
DOI: 10.3217/978-3-85125-108-1-010
ISBN: 978-3-85125-108-1 -
(2010): AWIJ Cutting of cortical bone screws, 20th International Conference on Water Jetting. Graz, Austria 20th – 22nd October 2010, S. 201-212
ISBN: 978-1-85598-121-8 -
(2010): Werkstoffe mit sensorischen Eigenschaften für optimierte Wartungsintervalle, Neue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 478-486. Garbsen: PZH Produktionstechn. Zentrum, 2010.
ISBN: 978-3-941416-78-9 -
(2010): Arbeiten des Institutes für Werkstoffkunde auf dem Gebiet der MMCD., Sitzung des DGM-Fachausschusses "Metallische Verbundwerkstoffe". Karlsruhe, 10.11.2010.
-
(2010): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 86-91. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Characterization and Simulation of High-Speed-Deformation-Processes, ICHSF 2010, S. 229-238. Columbus, Ohio, USA, März 2010.
-
(2010): Einfluss von Umformung und Abkühlung auf die Mikrostruktur des presshärtbaren Stahles 22MnB5, Fortschritte in der Metallographie Sonderbände der praktischen Metallographie Vol. 42, S. 69-74. Frankfurt: MAT-INFO Werkstoff-Informationsges., 2010.
ISBN: 9783883553825 -
(2010): Sonderlösungen zum thermischen Trennen im Bereich des Rückbaus kerntechnischer Anlagen, 4. Symposium "Stilllegung und Rückbau kerntechnischer Anlagen". Hannover, 02.11.2010.
-
(2010): Untersuchung der Gesetzmäßigkeiten der Kontaktwechselwirkungen beim Zusammenfügen von metallischen Materialien mittels Walzen, "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme", S. 2-8. Garbsen: PZH Produktionstechnisches Zentrum, 2010.
ISBN: 978-3-941416-59-8 -
(2010): In-vitro Testung von Stützstrukturen zur Stabilisation von xenogenen Aortenprothesen im kardiovaskulären Hochdruckberech, Jahrestagung der deutschen Gesellschaft für Biomaterialien (DGBM), Heilbad Heiligenstadt, November 2010
-
(2010): Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen, GfKorr-Tagung. Dresden, 28.04.2010.
-
(2010): Eigenschaften der Werkstoffverbunde durch Druckguss hergestellter Verbundgussteile aus Aluminium und Magnesium, In: Tagungsband zum Symposium Verbundwerkstoffe und Werkstoffverbunde (18. Symposium Verbundwerkstoffe und Werkstoffverbunde), S. 422–432
-
(2010): Tribrid-Stenting - Eine neue operative Methode zur Erweiterung und Offenhaltung der Nasennebenhöhlen, In: 81. Jahresversammlung der Deutschen Gesellschaft für Hals-Nasen-Ohren-Heilkunde, Kopf- und Hals-Chirurgie. Wiesbaden, 12.-16.05.2010. Düsseldorf: German Medical Science GMS Publishing House; 2010
DOI: 10.3205/10hnod607 -
(2010): Production of thin wires of magnesium alloys for surgical applications, 2010 Conference Proceedings of The Wire Association, Inc, S. 61-70, 2010.
-
(2010): Development of a Therapeutic Device Supporting Real-Time Dynamic Verical Force Unload, 55. IWK - Internationales Wissenschaftliches Kolloquium, 2010, S. 468-479
ISBN: 978-3-938843-53-6 -
(2010): Herstellung und Charakterisierung lokal ausgeschäumter Rollprofile, 7. Fachtagung Walzprofiliern & 3. Zwischenkolloquium SFB 666. Darmstadt, 2010.
-
(2010): Zerstörungsfreie Charakterisierung von Schicht- und Bauteilzuständen , 4. Internes Repair Kolloquium. München, 28.-29.01.2010.
-
(2010): Gentelligente Bauteilidentifikation und Integritätsbewertung, Genetik und Intelligenz, S. 11. Garbsen: PZH Produktionstechn. Zentrum, 2010.
ISBN: 9783941416482 -
(2010): Sensorkontrolliertes Bainitisieren zur Prozesssteuerung und Qualitätssicherung in der Wärmebehandlung , 83. Tagung des Wissenschaftlichen Rates der AiF. Berlin-Adlershof, 09.11.2010.
-
(2010): Modellierung des Werkstoffverhaltens beim Warmumformen höchstfester Stähle auf der Basis mikrostruktureller Vorgänge, Merklein (Hg.) – Warmumformung von höchstfesten Vergütungsstählen: Tagungsband zum 5. Erlanger Workshop Warmblechumformung, S. 141-160. Bamberg: Meisenbach GmbH-Verlag, 2010.
ISBN: 978-3-87525-311-5 -
(2010): Biokompabilität von Magnesiumgittern zur Unterstützung von regenerativen Therapien in der kardiovaskulären Chirugie, 44. Jahrestag der DGBMT, BMT 2010, Rostock Supplement zur Biomedizinische Technik / Biomedical Engineering, De Gruyter Verlag ISSN 0939-4990
-
(2010): Stabilizing autologus intestine vascularized cardiac patch material by magnesium alloys, 39th Annual Meeting German Society for Thoracic and Cardiovascular Surgey 2010, 14.-17. February 2010
-
(2010): Plasma keyhole welding of mild steel plates for ship yard productions, Istanbul IIW 2010, S. 479-483. Istanbul: GEV, 2010.
ISBN: 978-6-05-614191-1 -
(2010): Flussmittelfreies Ofenlöten von Aluminium-Stahl-Hybridstrukturen in reaktiven Prozessgasen, "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme", S. 10-17. Garbsen: PZH Produktionstechnisches Zentrum, 2010.
ISBN: 978-3-941416-59-8 -
(2010): Dynamic processes at high speed laser and electron beam treatment of materials, Results of joint research activity of scientists from Saint-Petersburg State Polytechnical University and Leibniz University of Hannover., S. 91-101. Saint-Petersburg: Polytechn. Univ. Publ. House, 2010.
ISBN: 978-5-7422-2652-9 -
(2010): Konstruktion gefaltete und aufweitbare Rohre zur Bohrlochauskleidung, 3. Nano und Material Symposium Niedersachsen. gebo Forschungsverbund Geothermie und Hochleistungsbohrtechnik. Celle, 07.10.2010.
-
(2010): Simulation der Eigenspannungsentwicklung beim Abschrecken von Ritzelwellen aus 42CrMo4 mittels Spraykühlung, ANSYS Conference & 28th CADFEM Users' Meeting 2010, 2010.
-
(2009): Influence of Alloy Composition and Heat Treatment on Damping Characteristics of Magnesium Alloys, 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 270–281
ISBN: 3-527-32732-0 -
(2009): Integrierte Wärmebehandlung komplexer Präzisionsschmiedebauteile mittels einer prozess- und geometrieangepassten Zwei-Phasen-Spraykühlung, Proceedings Berichte aus dem IWU Vol. 52, S. 283-301. Auerbach: Verl. Wiss. Scripten, 2009.
ISBN: 978-3-937524-93-1 -
(2009): Non-vacuum electron beam diagnostics, 9-th International Conference on Electron Beam Technologies, 1-4 June, Varna, Bulgaria; ISSN 0861-4717, S.52-58, Band 44, 5-6/2009
-
(2009): Non-vaccum electron beam diagnostics, Proceedings of 9th International Conference on Electron Beam Technologies, 1-4 June 2009, Varna, Bulgaria, p.52-58, ISSN 0861-4717
-
(2009): Materialbearbeitung mit Hochdruckwasserstrahlen - Anwendungsgebiete und Entwicklungstrends, Vortragsband zum Fachkolloquium „Innovative Technologien für die Bearbeitung metallischer und nichtmetallischer Werkstoffe“. Technische Universität Dresden, Dresden, 25. September 2009.
ISBN: 978-3-86780-133-1 -
(2009): Herstellung von beschichteten Druckgussbauteilen durch prozessintegrierte Applikation thermisch gespritzter Schichten in Gussformen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 36, S. 79-86. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 397-402. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): PVD-Schichtabformung im µm-Bereich, Tagungsband des zweiten Workshops für Optische Technologien, 17.11.2008, S. 167-169. Garbsen: Verlag PZH Produktionstechnisches Zentrum GmbH, 2009.
ISBN: 978-3-941416-17-8 -
(2009): Suspensionsplasmaspritzen thermisch aktivierbarer triboaktiver Schichtverbunde, Tagungsband zum 17. Symposium Verbundwerkstoffe und Werkstoffverbunde, 01.-03.04.2009, Bayreuth, S. 627-634. Bayreuth, 2009.
-
(2009): Achieving Thin Functional Coatings by Mixing of Nanosized Feedstock Powders in the Suspension Plasma Spraying Process, Proceedings of the 4´th International conference on Spray Deposit in and Melt Atomization, 2009.
-
(2009): Basic Principles to Obtain Oxide Ceramic Coating Systems with Reduced Sliding Wear by Suspension Plasma Spraying, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 200-206, 2009.
ISBN: -13978-1-61503-004-0 -
(2009): Werkstoffkundliche und Prozesstechnische Aspekte zum Hartlöten im Schutzgasdurchlaufofen, Tagungsband des 4. Aachener Oberflächenkolloquium Schriftenreihe Oberflächentechnik, S. 29-44. Aachen: Shakerverlag, 2009.
ISBN: 1864-0796 -
(2009): Schutzgasofenlöten von Aluminium und Stahl in reaktiven Prozessgasen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 418-423. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsverfahren, Beiträge zum Abschlusskolloquium des SPP 1138, Bonn 11.-12.02.2009, S. 79-95. Bremen: BIAS Verlag, 2009.
ISBN: 978-3-933762-29-0 -
(2009): Löten von hochlegierten Stählen, Nickel- und Titanlegierungen unter Ausbildung stängelkristallitverstärkter Lötnähte, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 403-409. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Homogenization of Coating Properties in Atmospheric Plasma Spraying - New Results of a DFG (German Research Foundation)-Funded Research Group, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 762-767, 2009.
ISBN: -13978-1-61503-004-0 -
(2009): Hochleistungsplasmaschweißen im Schiffbau: 10. Fachtagung "Schweißen im Schiffbau und Ingenieurbau", Schweißen im Schiffbau und Ingenierbau. 10. Sondertagung 22. und 23. April 2009 in Hamburg, S. 105–113
-
(2009): Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme., Kolloquium Graduiertenkolleg 1378/1. Leibniz Universität Hannover; Technische Universität Dortmund; PZH Produktionstechnisches Zentrum. Garbsen: PZH Produktionstechnisches Zentrum GmbH; PZH Produktionstechn. Zentrum.
-
(2009): Investigation of the Mechanical Properties of Magnesium Alloy AZ31 Sheets due to a Straightening Process, 8th International Conference on Magnesium Alloys and their Applications, S. 830-835. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Increasing the Wear Resistance of Hot Working Tool Steel by Lowering the Eutectoid Temperature, Sovremennye metalliceskie materialy i technologii, S. 46-56. Sankt-Peterburg: Izdat. Politechn. Univ., 2009.
ISBN: 978-5-7422-2308-5 -
(2009): Simulation of the fixation of a cruciate ligament reconstruction with interference srews, Proceedings of the XXXVI European Society for Artificial Organs (ESAO) Congress, 2.-5. September 2009, Compiègne, France
-
(2009): Testing of Stabilizing Structures Made of Magensium Alloys for the Cardiovascular Surgery, 8th International Conference on Magnesium Alloys and their Applications, S. 1149-1155., Weimar, Germany, 26.-29. October 2009
ISBN: 978-3-527-32732-4 -
(2009): AWIJ of cutting structures made of magnesium alloys for the cardiovascular surgey, American WJTA Conference and Expo 2009, Houston, USA, 18.-20. August 2009, paper 1A
-
(2009): Strength of zirconia after mechanical, thermal, and hydrothermal loading, In: International Association for Dental Research (Hg.): 87th General Session of the International Association for Dental Research and Ex-hibition. International Association for Dental Research. Alexandria, VA, USA: International Association for Dental Research, S. 532.
-
(2009): Soft and Hardmagnetic Magnesium Materials as Components of Structural Elements, Kainer, K. U. (Hrsg.): Magnesium; 8th International Conference on Magnesium Alloys and their Applications, S. 27-32. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Joint synthesis of components in the system TiC-TiB2, In: Deutsche Gesellschaft für Kristallographie (Hg.): 17. Jahrestagung der Deutschen Gesellschaft für Kristallographie. München: Oldenbourg Verlag, S. 116–117
-
(2009): Investigations on Extruded Seams in Magnesium Alloy Hollow Sections, K. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 608–614.
-
(2009): Extrusion of Split Strips for Roll Forming, 8th International Conference on Magnesium Alloys and their Applications, S. 503-508. Weimar, Germany 26.-29. October
ISBN: 978-3-527-32732-4 -
(2009): Mathematische Modellierung des Gießens von dünnen Blechen nach dem Zwei-Rollen-Verfahren, ANSYS Conference & 27th CADFEM Users' Meeting, 2009.
-
(2009): Analysis of microstructure evolution during cold deformation of air-hardening steel LH800, EPD congress 2009, S. 91-98. Warrendale, Pa.: TMS, 2009.
ISBN: 978-0-87339-732-2 -
(2009): Entwicklung von Stabelektroden für das nasse Unterwasserschweißen - Untersuchung über den Einfluss der Umhüllung, DVS-Deutscher Verband f. Schweißen u. verwandte Verfahren e. V, D. V.S. (Hg.) (2009): Unterwassertechnik. Tagung in Hamburg 03.-04.03.2010: DVS Media.
-
(2009): Protection of Magnesium Welds by the Combination of TIG Welding with a Simultaneous Suspension Plasma Spraying Process for the Application of Nanoscaled Magnesium Fluoride Layers to Prevent Corrosion, K. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH.
-
(2009): Walzplattierte Leichtmetallverbunde, Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme, S. 1-6. Garbsen: PZH Produktionstechnisches Zentrum GmbH and PZH Produktionstechn. Zentrum, 03.05.2009.
ISBN: 978-3-941416-14-7 -
(2009): Upward Direct Chill Casting of Magnesium Alloys, 8th International Conference on Magnesium Alloys and their Applications, S. 424-430. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen, GfKorr-Tagung. Ottobrunn, 22.04.2009.
-
(2009): Influence of form, surface and subsurface areas on the corrosion behaviour and the mechanical properties of magnesium alloys, 8th International Conference on Magnesium Alloys and their Applications, S. 1288-1294. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsprozessen, S. 79-95, 2009.
ISBN: 978-3-933762-29-0 -
(2009): Observation of hydrothermal induced phase transformation of ZrO2 ceramics for dental applications, 11th International and Interdisciplinary Symposium Biomaterials and Biomechanics, 05-07.März 2009, Essen, S. 127-128
-
(2009): Quantiative X-ray analysis of hydrothermal induced phase transformation of ZrO2 ceramics, 17. Jahrestagung der Deutschen Gesellschaft für Kristallographie,, Hannover. Deutsche Gesellschaft für Kristallographie. Hannover, 09.03.2009.
-
(2009): Beobachtung der hydrothermalen Alterung von ZrO2 Keramiken mittels mikroskopischer und röntgenographischer Verfahren, Fortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 219-225. Frankfurt: Werkstoff-Informationsges., 2009.
ISBN: 978-3-88355-376-4 -
(2009): Compound Casting of Aluminium and Magnesium-Alloy by High Pressure Die Casting, 8th International Conference on Magnesium Alloys and their Applications, S. 390-397. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Vibration Treatment for Microstructural Grain Refinement of Magnesium Alloys using the Low Pressure Die Casting Process, 8th International Conference on Magnesium Alloys and their Applications, S. 275-281. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach SDPR - Hochhochgeschwindigkeits-Austenitisieren mit anschließendem Abschrecken, Werkstofftechnik, Fertigungs- und Verfahrenstechnik. 65. Kolloquium für Wärmebehandlung. Rhein-Main-Hallen Wiesbaden, 2009.
-
(2009): Grain Refinement of AZ91 with Hexagonal Boron Nitride, 8th International Conference on Magnesium Alloys and their Applications, S. 302-307. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): EBWC-006 Non Vacuum EB Cutting, AWS - American Welding Society (Hg.): 2009 CD IEBW Proceedings.
-
(2009): Modellierung einer prozessintegrierten Spraykühlung beim Strangpressen von aushärtbaren Aluminiumlegierungen, ANSYS Conference & 27th CADFEM Users' Meeting. 18.-20.11.2009 Congress Center Leipzig
-
(2009): Manufacture and characterization of magnesium foams for ultra-lightweight applications, Proceedings Materials Science and Technology (MS&T), S. 2366-2374. Red Hook, NY: Curran, Oktober 2009.
-
(2009): Ausgeschäumte Profile: Magnesiumschäume für den Einsatz in Verbundprofilen, Potenziale metallischer Werkstoffe lokal nutzen, S. 153-159. Clausthal Zellerfeld: Oberharzer Druckerei Fischer & Thielbar GmbH, 2009.
-
(2009): Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen, 7. Industriekolloquium "Potenziale metallischer Werkstoffe lokal nutzen", S. 93-107. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2009.
ISBN: 3923605242 -
(2009): Einstellung beanspruchungsgerechter Werkstoffeigenschaften durch Verfestigung und strukturierte Wärmebehandlung, Fortschritte der Kennwertermittlung für Forschung und Praxis, S. 391-398. Düsseldorf: Stahleisen, 2009.
ISBN: 9783514007697 -
(2009): Bauteilinhärente Belastungssensoren und Informationsspeicherung in der Randzone, In: Michael Borsutzki (Hg.): Fortschritte der Kennwertermittlung für Forschung und Praxis. Bad Neuenahr. Tagung Werkstoffprüfung. Düsseldorf: Stahleisen, S. 383–390.
ISBN: 9783514007697 -
(2009): Sensortechnik zur diskreten Erfassung von Umwandlungsvorgängen beim Bainitisieren, Fortschritte der Kennwertermittlung für Forschung und Praxis, S. 299-308. Düsseldorf: Stahleisen, 2009.
ISBN: 9783514007697 -
(2009): Entwicklung einer Wirbelstromtechnik zur Nullspaltfindung und Prozessführung von Hochleistungs-Strahl-Schweißverfahren, DGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 881-891. Münster, 2009.
-
(2009): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, DGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 984-995. Münster, 2009.
-
(2009): Analysis of surface strains and leakage behaviour in composite pipes and vessels using digital image correlation technique, Proceedings of the ASME 2009 Pressure Vessels & Piping Division Conference Vol. PVP2009-77522, S. 449-455. New York: ASME, July 2009.
-
(2009): The Potential for Magnesium Alloys Containing ~Neodymium in Medical Engineering, 8th International Conference on Magnesium Alloys and their Applications, S. 1189-1194. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2009): Untersuchung des Deformationsreliefs an Oberflächen metallischer Werkstoffe mittels konfokaler Mikroskopie zur Beschreibung des Fließverhaltens, Fortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 145-149. Frankfurt: Werkstoff-Informationsges., 2009.
ISBN: 978-3-88355-376-4 -
(2009): Transmissionselektronenmikroskopische Bestimmung der Phasenanteile von pressgehärtetem Vergütungsstahl 22MnB5 zur Verwendung in der numerischen Prozessanalyse, Tagungsband zum 4. Erlanger Workshop Warmblechumformung. 11. November 2009, S. 33-44. Bamberg: Meisenbach, 2009.
ISBN: 9783875252989 -
(2009): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach SDPR – Hochhochgeschwindigkeits-Austenitisieren mit anschließendem Abschrecken , M. Merklein und J. Lechler (Hg.): Tagungsband zum 4. Erlanger Workshop Warmblechumformung. 11. November 2009. DFG ortsverteilte Forschungsgruppe 552 Erlangen 11. November 2009. Bamberg: Meisenbach, S. 33–44
-
(2009): Flussmittelfreies Ofenlöten in reaktiven Prozessgasen, Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme, S. 7-12. Garbsen: PZH Produktionstechnisches Zentrum GmbH and PZH Produktionstechn. Zentrum, 03.05.2009.
ISBN: 978-3-941416-14-7 -
(2009): Simulation of microstructure and residual stress development in cylinders of AISI 4140 during quenching by spray cooling and following tempering, Materials Science & Technology Conference and Exhibition 2009 Vol. 4, S. 2422-2433. Red Hook, NY: Curran, 2009.
ISBN: 978-161567636-1 -
(2008): Influence of Forming Rate on the Microstructure and Properties of Materials subjected to Electromagnetic Forming: A Synopsis, ICHSF 2008, S. 55-64. Dortmund: Technische Universität Dortmund, 2008.
-
(2008): Thermally sprayed coatings with stochastic microstructures for thermomechanically high stressed surfaces, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaf-ten von thermisch gespritzten Schichten, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 66-72. Chemnitz: Eigenverlag, 2008. Online verfügbar unter http://www.worldcat.org/oclc/318648539 More info
ISBN: 978-3-00-025648-6 -
(2008): Oberflächenbehandlungen von Polymeren und Werkzeugen zur Polymerbearbeitung, Fahlbusch, Pfalz (Hg.) 2008 – Tagungsband Hannoversches Zentrum für Optische Technologien; Workshop Optische Technologien
-
(2008): Development of near net shape coatings for wear and corrosion protection, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Characterisation of thermally sprayed near net shape oxide ceramic and cermet coatings by acoustic emission analysis, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Optimierung von Eisenbasisfülldrähten für das Lichtbogenspritzen mittels statistischer Methoden, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 73-79. Chemnitz: Eigenverlag, 2008.
ISBN: 978-3-00-025648-6 -
(2008): Homogenization of coating properties in Atmospheric Plasma Spraying - technical objectives and first results of a DFG funded research group, Proc. International Thermal Spray Conference, June 2-4, 2008, Maastricht, The Netherlands, 2008.
-
(2008): Neue Entwicklungen beim Hartlöten im Schutzgasdurchlaufofen, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 209-214. Chemnitz: Eigenverlag, 2008.
ISBN: 978-3-00-025648-6 -
(2008): Verfahrenskombinationen und Hybride aus thermischem Beschichten und Fügen, 3. Aachener Oberflächentechnik-Kolloquium 12.12.2008, S. 31-50. Aachen: Shaker Verlag, 2008.
ISBN: 978-3-8322-7831-1 -
(2008): Investigation of magnetic magnesium alloys, 4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.
-
(2008): Efficient modeling and calculation of sheet metal forming using steel LH800, Steel Research int., Special Edition to 12th International Conference "Metal Forming" Vol. 2008, S. 99-105, 2008.
-
(2008): Rückbau kerntechnischer Anlagen, Tagungsband des 6. Steinkolloquiums des Instituts für Fertigungstechnik und Werkzeugmaschinen. Hannover
-
(2008): Nachweis von Härterissen im Verzahnungsbereich von Zahnrädern mit Thermographie und Wirbelstromtechnik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2008): Cutting perfomance comparison of the AWIJ technique with intake of abrasive/air-mixture or supsension as well as the AWSJ, 19th International Conference on Water Jetting, Nottingham, UK, 15.-17. Oktober 2008, S. 155-168
-
(2008): Klassifizierung von Getriebeschäden mit Schwingungsanalyse und Wirbelstromtechnik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2008): Influence of cutting and non-cutting processes on the corrosion behavior and the mechanical properties of magnesium alloys, Supplemental proceedings, TMS 2008 137th annual meeting & exhibition. : [held March 9 - 13, in New Orleans, Louisiana, USA]. Warrendale, Pa.: TMS, S. 383–388
ISBN: 9780873397179 -
(2008): Herstellung und Entwicklung von selbstschützenden Doppelmantelfülldrahtelektroden zum kontinuierlen Unterwasserschweißen, Die Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl., S. 83–88
-
(2008): Influence of different surface machining treatments of resorbable magnesium alloy implants on degradation: EDX-analysis and histology results, Biomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutschen Gesellschaft für Biomaterialien. Duisburg, S. 48–49
-
(2008): 3D-Darstellung des embryonalen Herzen mittels Mikro-Computer-Tomographie (Mikro-CT): Erste Ergebnisse einer Machbarkeitsstudie, Jochen Weil (Hg.): 40. Jahrestagung der Deutschen Gesellschaft für Pädiatrische Kardiologie, 01.09.2008. Clinical Research in Cardialogy. Sonderdruck. Steinkopff (97), S. 674.
-
(2008): Bainite sensor - A new tool for process and quality control of the bainite transformation, Proc. European Conf. on Heat Treatment 2008, Innovation in Heat Treatment for Industrial Competetiveness (ECHT 2008), 07.-09.05.2008, Verona, Italien, Associazione Italiana di Metallurgia/AIM (Hrsg.), 2008, auf CD-ROM. – ISBN 88-85298-64-8
-
(2008): Einfluss des Abrasivmediums bei der Dentinbearbeitung mittels Wasserabrasivstrahlverfahren, Jahrestagung der Deutschen Gesellschaft für Zahn-, Mund- und Kieferheilkunde, Poster3, Stuttgart, Oktober 2008.
-
(2008): Untersuchungen der Eignung des Elektronenstrahlschweißens an Atmosphäre zur Verarbeitung von höherfesten, verzinkten Karosseriebaustählen, Die Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl.
-
(2008): Influence of magnesium fluoride coating of degradable magnesium implants (MgCa0,8%) on the degradation behavior, 54th Annual Meeting of the Orthopaedic Research Society Vol. 33, 2008.
-
(2008): Acquisition of Discrete Component and Loading Information in the Component's Edge Re-gion Using Innovative Sensor Technology, 4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.
-
(2008): Simulation der Eigenspannungsentwicklung beim Abschrecken von Zylindern aus 42CrMo4 mittels Spraykühlung, ANSYS Conference & 26th CADFEM Users' Meeting, 2008.
-
(2008): Process Analysis and Physical Simulation of Electromagnetic Joining of Thin-walled Parts, Proceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 181–190
ISBN: 3-9809535-3-X -
(2008): Entwicklung und Qualifizierung von Prüftechniken zur Prozessüberwachung und Qualitäts-sicherung in der Fertigung, 9. DELTA TEST Fachtagung 2008, 12.-14. November 2008
-
(2008): Gentelligente Bauteilidentifikation und Integritätsbewertung, Genetik und Intelligenz - neue Wege in der Produktionstechnik, S. 10. Garbsen: PZH Produktionstechnisches Zentrum, 2008.
ISBN: 9783939026815 -
(2008): Entwicklung einer prozessfähigen Prüftechnik zum sensorkontrollierten Bainitisieren in der Wärmebehandlung, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2008): Design and Analysis of a Deep Drawing and Inprocess Electromagnetic Sheet Metal Forming Process, Proceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 201–212
ISBN: 3-9809535-3-X -
(2008): Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavlet-Transformation., DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2008): Zeiteffiziente Prozesskettenmodellierung und -berechnung in der Blechumfor-mung und -verarbeitung, In: MEFORM 2008. Simulation von Umformprozessen. Institut für Metallformung, TU Bergakademie Freiberg. Freiberg, Deutschland: ACATRAIN e.V., S. 262–274.
-
(2008): Comparison of the resorbable magnesium alloys LAE442 and MgCa0,8 concerning their mechanical properties, gradient of degradation and bone-implant-contact after 12 months implantation in rabbit model, Biomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutschen Gesellschaft für Biomaterialien. Duisburg, S. 107–108
-
(2008): Zerstörungsfreie Untersuchungen an explantierten Herzklappenprothesen, M. Lange (Hg.): Biomaterials NRW. Fundamentals and Clinical Applications. 10. Jahrestagung der deutschen Gesellschaft für Biomaterialien 12. - 14.03.2008 Essen. Universität Duisburg-Essen; Deutsche Gesellschaft für Biomaterialien. Duisburg, S. 87.
-
(2007): Proceedings of the 6th International Conference THE Coatings 2007, Hannover, 25.-26. Oktober 2007. Garbsen: PZH Produktiontechnisches Zentrum GmbH More info
-
(2007): Wear reducing measures on forging dies by application of technical surfaces, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 23-32, 2007.
ISBN: 978-3-939026-64-8 -
(2007): Investigation of the Abrasive Water Injection Jet Drilling Process in Cortical Bone, Proceedings of the 2007 American WJTA Conference and Expo, Aug 2007, Houston, USA, paper 1-D
-
(2007): Absorbable Hybrid Implants, 1st Symposium on Intelligent Implants. Biometrology, Telemetry, Manufacturing. Garbsen, 9. - 10.Mai 2007. Produktionstechnisches Zentrum Hannover; Medizinische Hochschule Hannover. Hannover
-
(2007): Lokal ausgeschäumte, profilgewalzte, geschlossene Profile, Hochfeste Strukturen, S. 35-42. Clausthal Zellerfeld: Technische Universität Clausthal, 2007.
-
(2007): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 125-129. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Keramik-Metall-Verbundwerkzeuge für die Metallbearbeitung, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 52-58. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Thermally Sprayed Coatings with Stochastic Microstructure for Improved Lubricant Retention, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 317-322, 2007.
ISBN: 978-3-939026-64-8 -
(2007): Diamantimprägnieren durch Thermisches Spritzen als Verfahren zur Schleifwerkzeugbeschichtung, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 286-291. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Metall-Kapillardruckgießen und Dampfphasen-Schmelzinfiltration: Zwei innovative Verfahren für das Herstellen metallischer Mikrobauteile, Thomas Gessner (Hg.): Proceedings / Mikrosystemtechnik-Kongress 2007. 15. - 17. Oktober 2007 in Dresden ; gemeinsame Veranstaltung von: Bundesministerium für Bildung und Forschung (BMBF), VDE Verband der Elektrotechnik Elektronik Informationstechnik. Berlin, Offenbach: VDE-Verl, S. 123–126
ISBN: 978-3-8007-3061-2 -
(2007): Flammlöten von Aluminiumschmiedeteilen, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 202-212. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Gas/Solid-TLP-Bonding Ein neues Verfahren zum Herstellen und Fügen von Miniatur- und Mikrobauteilen, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 319-324. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Entwicklung eines neuen Produktionsverfahrens für die Fertigung komplexer Metallverbunde- Gas/Solid-TLP-Bonding, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 231-236. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -Drähte und -Folien, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 393-397. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): SCIB - Self-Cleaning Inert-Gas Brazing? Ein neues Verfahren zum flussmittelfreien Hartlöten korrosionsbeständiger Konstruktionswerkstoffe, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 235-241. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Elektrochemische Messmethoden zur Online-Bestimmung des Kupfergehaltes in bleifreien Sn-Basis-Lotbädern, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 261-267. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Untersuchungen zur Spritzwerkstoffeinbringung beim Dreikathoden-Plasmaspritzprozess, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 136-142. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Gentelligente Bauteilidentifikation und Integritätsbewertung, Gentelligente Bauteile im Lebenszyklus, S. 31-38. Garbsen: PZH Produktionstechnisches Zentrum, 2007.
ISBN: 978-3-939026-46-4 -
(2007): Magnetische Magnesiumlegierungen. Entwicklung von Magnesiumlegierungen mit magnetischen Ausscheidungen., Gentelligente Bauteile im Lebenszyklus, S. 7-12. Garbsen: PZH Produktionstechnisches Zentrum, 2007.
ISBN: 978-3-939026-46-4 -
(2007): Magnesium with Magnetic Properties for Sensory Use, Kainer, K.U. ; DGM, Oberursel: Magnesium. Proceedings of the 7th International Conference on Magnesium Alloys and their Applications 2006 : 06-09. November 2006, Dresden, pp. 992-996. Weinheim: Wiley-VCH, 2007.
ISBN: 978-3-527-31764-6 -
(2007): Use of a TiBN multilayer coating for wear reduction, Proceedings of 9th International Conference on Numerical Methods in Industrial Forming Processes - numiform'07, S. 1047-1052. Porto, Portugal, 2007.
ISBN: 978-0-7354-0416-8 -
(2007): Reduction of Wear by a TiBN Multilayer Coating, 31st Int. Cocoa Beach Conference ICACC Jan. 2007 // Proceedings of the 31st International Conference on Advanced Ceramics and Composites, January 21-26, 2007, Daytona Beach, Florida, USA. Westerville, Ohio: American Ceramic Soc
ISBN: 978-0-470-24679-5 -
(2007): Zerstörungsfreie Bestimmung der Randzoneneigenschaften hoch beanspruchter Maschinenbauteile, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
-
(2007): Prozessfähige Randhärte- und Einhärtungstiefenbestimmung an dick- und dünnwandigen Bauteilen, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
ISBN: 9783514007536 -
(2007): Manufacturing of ceramic reinforced high precision forging dies, Proceedings of 4th International Conference and Exhibition on Design and Production of Machines and Dies/Molds, Cesme, Turkey, June 21-23, 2007, 2007.
-
(2007): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End-und Zwischenlagerbauteilen zur Reduktion von Reparaturen, In: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2007 – Tagungsband. 8. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“. Dresden, 21.-23.03.2007, S.534- 539
-
(2007): Mathematical model for simulation of steel behavior during integrated heat treatment on the base of software ANSYS, Computational Mechanics & Enhancement and Promotion of Computational Methods in Engineering and Science. Kyoto, Japan, 3.-6.12.2007.
-
(2007): Hot Cracks in Pulsed Laser Beam Welds of Cr-Ni-alloyed Steels ? Detection methods and Prevention by using Predeposited Plasma Spray Layers, Proc. of the Third International Conference on Laser Technologies in Welding and Materials Processing, Katsiveli (Crimea, UA), 29 May - 2 June, 2007, 2007.
-
(2007): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen? Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Vortragsband zu 7. Int. Konf. Strahltechnik 17.-19.4.2007 in Halle (Saale). SLV Halle, GSI: DVS, 2007.
-
(2007): Cell Culture Models for the Evaluation of Magnesium Alloys as Degradable Implant Materials, Jahrestagung DGBM Biomaterialien, 2007, Vol. 8, S. 189
-
(2007): Neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, MikroSystemTechnik Kongress 2007 Proceedings, 15. - 17. Oktober 2007 in Dresden, S. 635-638. Berlin und Offenbach: VDE Verlag GmbH, 2007.
ISBN: 978-3-8007-3061-2 -
(2007): Entwicklung von Sensortechnik zur Erfassung diskreter Bauteil und Belastungsinformationen in der Bauteilrandzone, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
-
(2007): Erfassung diskreter Bauteil- und Belastungsinformationen in der Bauteilrandzone mit inno-vativer Sensortechnik, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
ISBN: 9783514007536 -
(2007): Qualifizierung zerstörungsfreier Prüftechniken zur wiederkehrenden Prüfung austenitischer Rohre hinsichtlich chloridinduzierter Lochkorrosion, M. Pohl (Hg.): Konstruktion, Qualitätssicherung und Schadensanalyse. [Tagung "Werkstoffprüfung 2007", 29. und 30. November 2007 in Neu-Ulm]. Deutsche Gesellschaft für Materialkunde; Deutscher Verband für Materialforschung und -prüfung; Stahl-Institut VDEh. Düsseldorf: Verl. Stahleisen
ISBN: 9783514007536 -
(2007): Anwendung von Simulationsverfahren zur Entwicklung von zerstörungsfreien Prüftechniken im Rahmen der Qualitätsprüfung von Schweißverbindungen, 1. Fachtagung „Prüfen in der Schweißtechnik“. 30. und 31. Januar 2007, Halle (Saale). Gesellschaft für Schweißtechnik International mbH, Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH. Halle (Saale), S. 4–15
-
(2007): Zerstörungsfreie Fehlerprüfung und Fehlertiefenbestimmung chlorinduzierter Lochkorrosion in austenitischen Rohren, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth
-
(2007): Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen, 6. Industriekolloquium "Hochfeste Strukturen", S. 89-98. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2007.
ISBN: 3923605242(2) -
(2007): Frühzeitige Schadenserkennung an rotierenden Bauteilen mittels Schallemissionsanalyse und einer Wirbelstromtechnik unter Anwendung der Wavelet-Transformation, Schwingungsüberwachung und Diagnose von Maschinen VDI-Berichte Vol. 1982, CD-ROM, S. 39-55. Düsseldorf: VDI-Verl., 2007.
ISBN: 978-3-18-091982-9 -
(2007): Entwicklung und Qualifizierung einer Fernfeld-Wirbelstromtechnik zur Fehlerprüfung von Schweißnähten und dickwandigen Bauteilen, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.
-
(2007): Beurteilung des Entschichtungszustands beim Trockeneisstrahlen mittels Analyse und Or-tung von Schallemissionssignalen, 16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.
-
(2007): Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavelet-Transformation, 16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.
-
(2007): Early fault detection at gear units by acoustic emission and wavelet analysis, 5th International Conference on Acoustic Emission, Lake Tahoe, Nevada, USA, October 29 to November 2, 2007
-
(2007): Schwingungsdiagnostische Beurteilung des Lauf- und Verschleißverhaltens von präzisionsgeschmiedeten und konventionellen Zahnrädern im Vergleich, Schwingungsüberwachung und Diagnose von Maschinen. VDI-Schwingungstagung 2007 ; Tagung Würzburg, 27. und 28. Februar 2007. Schwingungstagung; Gesellschaft Entwicklung, Konstruktion, Vertrieb. Düsseldorf: VDI-Verl. (VDI-Berichte, 1982, CD-ROM), S. 185–204
ISBN: 978-3-18-091982-9 -
(2007): Schallemissions- und Waveletanalysen zur frühzeitigen Schadenserkennung an hochbelas-teten rotierenden Bauteilen, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.
-
(2007): Frühzeitige Erfassung und Klassifizierung der Schadensentwicklung in hochbeanspruchten rotierenden Bauteilen mittels Schallemissions- und Wavelet-Analysen, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.
ISBN: 9783514007536 -
(2007): Sensorkontrolliertes Bainitisieren zur Prozesssteuerung und Qualitätssicherung, 63. Kolloquium für Wärmebehandlung, Werkstofftechnik, Fertigungs- und Verfahrenstechnik, HK 2007, Wiesbaden, 10.-12. Oktober 2007
-
(2006): CAMC und CAMG als Schneidtechnik für den Rückbau kerntechnischer Anlagen, Internationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und G. Kremer. KONTEC Gesellschaft für technische Kommunikation.
-
(2006): Möglichkeiten und Grenzen der Wasserstrahltechnik zur Bearbeitung von spongiösem Hartgewebe, Jahrestag der Schweizerischen, Deutschen und Österreichischen Gesellschaft für Biomedizinische Technik, Zürich, Schweiz, September 2006, S. 70
-
(2006): Temperature measurement during abrasive waer jet cutting of cortical bone blocs measured by thermocouples, 18th International Conference on Water Jetting, Danzig, Polen, September 2006, S. 203-212
ISBN: 1-85598-081-9 -
(2006): Ceramic-Metal Composites in Forging Applications in, Proceedings of the 3rd International Soldering and Brazing Conference IBSC2006, S. 73-78. Materials Park, OH 44073-0002: ASM International, 2006.
ISBN: 0-87170-838-8 -
(2006): Maßnahmen zur Erhöhung der Verschleißresistenz von Gesenkmatrizen zum Präzisionsschmieden von Zahnrädern, Bernhard Wielage (Hg.): Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 // Verbundwerkstoffe und Werkstoffverbunde. Tagungsband zum 9. Werkstofftechnischen Kolloquium in Chemnitz, 7. bis 8. September 2006, Bd. 24. Chemnitz: TU, Lehrstuhl für Verbundstoffe, S. 505–511
ISBN: -10-3-00-019101-1 -
(2006): Untersuchungen zum Hochgeschwindigkeitsflammspritzen von MCrAlY-Schichtsystemen mit angepasster Oberflächenrauheit, Tagungsband zum 3. GTV Kolloquium "Thermisches Spritzen", 09.06.2006, Luckenbach, 2006, S. 24-32, 2006.
-
(2006): Thermal Spray Joining - Soldering and Filling of Aluminum Substrates under Atmospheric Conditions by a Combined Thermal Spray / Fusing Technique, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
ISBN: 0-87170-836-1 -
(2006): Roughness Enhancement of HVOF Sprayed MCrAlY Bond Coatings for Adhesion Improvement of Ceramic Top Layers, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
ISBN: 0-87170-836-1 -
(2006): Niedrig schmelzende Glaslote auf Phosphatbasis zum Fügen von Aluminium-Keramik-Verbunden, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 430-435. Chemnitz: Eigenverlag, 2006.
ISBN: -10-3-00-019101-1 -
(2006): Heating behaviour of differently tempered forged aluminium alloy components in a flame brazing process, Tagungsband zum "4. International Congress Aluminium Brazing, 16t - 18th May 2006". Düsseldorf: Aluminium-Verlag, 2006.
-
(2006): Modellierung der Stängelkristallitbildung beim Hartlöten am Beispiel des Werkstoffsystems Fe-C-Cu, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 400-406. Chemnitz: Eigenverlag, 2006.
ISBN: -10-3-00-019101-1 -
(2006): Abrasive Water jet Cutting: Technology and Applications, International Conference on Cutting Technologies 2006, Hannover (D), 10th and 11th October 2006
-
(2006): Increase of erosive potential of water jets by laser pulsing, 18th International Conference on Water Jetting, Danzig, Polen, 13.-15. September 2006, S. 357-366
-
(2006): Qualifizierung der Wasserabrasivinjektorstrahlverfahren für den Rückbau kerntechnischer Anlagen, Internationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und D. Peter. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover; RWE Power AG.
-
(2006): Plasma-Autogen-Pulver-Schneiden - Ein experimentelles Verfahren, International Conference on Cutting Technologies 2006. Unter Mitarbeit von Fr.-W. Bach, Th. Rümenapp und Thomas [Dipl -Ing ]. Joszko. Leibzig Universität Hannover, Institut für Werkstoffkunde; RWE Power AG.
-
(2006): Strukturanalyse von orthopädischen und kardivaskulären Implantaten mittels Micro-Computertomographie, Aktuelle Implantatentwicklung - Funktionalisierung von Materialien, S. 12-13: DECHEMA, Februar 2006.
-
(2006): Matematiceskaja model' prognozirovanija struktury i mechaniceskich svojstv stali posle gorjacej deformacii i termoobrabotki, Udoskonalennja Procesiv i Obladnannja Obrobky Tyskom v Metalurhiï I Mašynobuduvanni. Tematyčnyj zbirnyk naukovych prac'. Donbas'ka deržavna mašynobudivna akademija. Kramators'k, S. 36–41
ISBN: 966-379-070-9 -
(2006): Investigation of the mechanical properties and the corrosion behaviour of low alloyed magnesium–calcium alloys for use as absorbable biomaterial in the implant technique, Magnesium Technology in the global age. 45th Annual Conference of Metallurgists of CIM. Montreal, S. 359–370
-
(2006): Abtragen mit lasergepulsten Wasserstrahlen, Internationale Schneidtechnische Tagung 2006, Hannover, Deutschland, Oktober 2006, S.70-75
ISBN: 3-9806415-7-0 -
(2006): Mechanical Properties of Degradable Magnesium Implants in Dependance of the Implantation Duration, International Symposium on Magnesium Technology in the Global Age, S. 329-343. Montreal, Quebec, Canada: CIM, 2006.
-
(2006): Resorbable Composite Based on Magnesium and Bioglass for Treating the Osseous Tissue, Biomaterials in Regenerative Medicine. Proceedings of the International Conference. Wien, 22. - 25.10.2006. Polish Academy of Sciences; Scientific Centre in Vienna. Wien, S. 109–112
-
(2005): Non- vakuum Elektronenstrahlschweißen von dünnwandigen Strukturbauteilen, DVM Tag 2005 "Dünnwandige Strukturbauteile" Berlin. DVM.
-
(2005): Nonvakuum-Elektronenstrahlfügen von Stahl-Aluminium-Hybridstrukturen, Berichtskolloquium der DFG-Forschergruppe 505 Hochleistungsfügetechnik für Hybridstukturen. Forschergruppe Grundlagen der Warmblechumformung von Höchstfesten Vergütungsstählen. Garbsen: PZH, Produktionstechnisches Zentrum
-
(2005): Production and Properties of Foamed Magnesium, R. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 77–80
-
(2005): Detachable Fasteners for Aluminium Foams, R. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 181–184
-
(2005): Herstellung und Eigenschaften von Magnesiumschäumen, E. Lugscheider (Hg.): Innovative Werkstofftechnologie. 12. Werkstoffwissenschaftliches Kolloquium. Aachen 10.12.2004. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie. Aachen, S. 72–77
-
(2005): Elektronenstrahlschweißen von Feinblechen an Atmosphäre, : Heinz Palkowski (Hg.): Fünftes Industriekolloquium SFB 362 "Fertigen in Feinblech". Abschlusskolloquium Werkstoffe - Verfahren - Konzepte, 23. und 24. November 2005, Aula der Technischen Universität Clausthal. Industriekolloquium Fertigen in Feinblech. Clausthal-Zellerfeld: Techn. Univ. Clausthal.
-
(2005): Development of a technique for hard coating of component parts by synthesis of silicon carbide in thermal spray processes, Erich Lugscheider (Hg.): Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Verbindungsspritzen - ein hybrides Fügeverfahren aus thermischem Spritzen und Umschmelzen, Univ.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 157–163
-
(2005): Properties of thermally sprayed coatings on magnesium parts for enhancement of wear and corrosion resistance, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Qualification of a Modified Triplex II Plasma Gun for Processing of Liquid Precursors and Wire- or Powder Shaped Spray Materials under Controlled Atmosphere, Conference Proceedings ITSC 2005. Düsseldorf: DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Self propagating high temperature synthesis of aluminium-matrix-composite coatings by means of atmospheric plasma spraying, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Simulation von Gefügeumwandlungen beim Abschreckhärten aus der Schmiedewärme mittels Zweiphasenströmung, Univ.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 117–122
-
(2005): Casting of Magnesium alloys with magnetic properties, First International Conference and Exhibition Magnesium - Broad Horizons, S. 16-19. Moscow, Russia, 2005.
-
(2005): Heat treatment of precision forged steel gears by usage of the forging heat, Sučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 488–493
-
(2005): Simulation of the microstructure transformation during quenching, Sučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 27–31
-
(2005): Bearbeitung von Hybridmaterialien mit dem Wasserstrahl, Congress Intelligente Leichtbau Systeme
-
(2005): Heat generation during abrasive water jet oesteotomies measuered by thermocouples, 8th International Conference on Management of Innovative Technologies, Fiesa, Slovenia, 2005
ISBN: 961-6238-96-5 -
(2005): Erste klinische Überprüfung der Andwendbarkeit des Wasserabrasivstrahls als Osteotomiewerkzeug im Tierversuch, Biomechanica 2005, Hamburg, Deutschland, März 2005, S. 173
-
(2005): CT Investigations: Mechanical and Structural Properties of Magnesium Sponges, Internationales Kolloquium des SFB599 4./5.11.2005
-
(2005): Corrosion protection and repassivation after the deformation of magnesium alloys coated with a protective magnesium fluoride layer, Neal R. Neelameggham, Howard I. Kaplan und Bob Ross Powell (Hg.): Magnesium technology 2005. Proceedings of the symposium. Warrendale, Pa: TMS, S. 485–490.
-
(2005): Water Jet Technology - State of the art and futher developments, Conference on Water Jetting, Perspectives 2005-2015. Unter Mitarbeit von H. Louis, A. Schenk und R. Versemann.
-
(2005): New approaches concerning the enhancement of wear and corrosion resistance of magnesium parts by thermally sprayed coating systems, K.-D Bouzakis (Hg.): Tagungsband zur Konferenz THE Coatings, 5.-7. Oktober 2005, Thessaloniki, Griechenland // 5th International Conference "the coatings" on Manufacturing Engineering and Eureka partnering event. Thessaloniki: Ed. Ziti, S. 241–248
-
(2005): Experimentelle Untersuchungen zu degradablen metallischen Osteosynthese-Materialien auf Magnesiumbasis, Jahrestagung der Arbeitsgemeinschaft Osteosynthese, Veterinärmedizin, 30.9. - 2.10.2005, Hannover.
-
(2005): Qualitätssicherung und Produktivitätssteigerung in Produktionsanlagen am Beispiel Wasserabrasivstrahlschneiden, 15. Kolloquium Schallemission. DGZfP
-
(2005): Biomechanical properties of osseous interference screws, Poster, 7th European Federation of National Associations of Orthopaedics and Traumatology Congress, Lisabon, Portugal, 2005
-
(2005): Research and Development Results for Dismantling and Decontamination Application, Proceedings: 2005 Waste Management Symposium. Global Accomplishments in Environmental and Radioactive Waste Management: Cost Effectiveness, Risk Reduction and Technology Implementation. 2005 Waste Management Symposium, 02.03.2005.
-
(2004): Neue Lotapplikationstechniken mittels Thermischer Spritzverfahren, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 35-37. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Hochleistungswerkzeuge aus Keramik-Metall-Werkstoffverbunden, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 300-303. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Thermally Sprayed Coatings on Mg Alloys for Improved Wear and Corrosion Resistance, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 425-434. Friedrich-Alexander-Universität Erlangen-Nürnberg: Verlag, 2004.
ISBN: 3-87525-201-2 -
(2004): State of the Art and Future Trends in Thermal Spraying, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 41-55. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
ISBN: 3-87525-201-2 -
(2004): Thermally sprayed filler metal coatings for high temperature brazing, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004 // Thermal spray 2004. Advances in technology and application, 10-12 May 2004, Osaka, Japan : proceedings of the International Thermal Spray Conference. Materials Park, Ohio: ASM International
-
(2004): Beschichtungsverfahren als leistungsfähige Alternative zu konventionellen Lotapplikationstechniken, Tagungsband zu "Oberflächentage 2004", 7. Mehrländertagung der Deutschen Gesellschaft für Galvano- und Oberflächentechnik e. V. am 22.-24.09.2004 in Dresden, S. 13-19, 2004.
ISBN: 3-9806061-2-0 -
(2004): An Alternative Coating Process Underwater Plasma Spraying, Tagungsband zum 12. Plasma Technik Workshop Ilmenau, S. 81-88, 2004.
-
(2004): Thermisch gespritzte Schichtsysteme zur Erhöhung des Verschleiß- und Korrosionsschutzes von Magnesiumbasis-Legierungen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18, S. 17-23. Chemnitz: Eigenverlag, 2004.
ISBN: 3000135537 -
(2004): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 353-357. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Flussmittelfreies Hartlöten dünnwandiger Titanlegierungen mit partieller Erwärmung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 362-364. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Flussmittelfreies Flammlöten von Aluminiumlegierungen durch Ultraschallunterstützung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 358-361. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Corrosion Protective Coatings by Modified Underwater Plasma Spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
-
(2004): Aspects of PVD-Coatings of Plasma Nitratet Tool Steels, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 103-109. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
ISBN: 3-87525-201-2 -
(2004): Verarbeiten von kolloidal gelösten Nanopartikeln durch Thermisches Spritzen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18. Chemnitz: Eigenverlag, 2004.
ISBN: 3000135537 -
(2004): Machining of bony interference srews by means of an abrasive waterjet, Paper, 17th International Conference on Water Jetting, Deutschland, September 2004, pp 231-243
-
(2004): Laser- und Nonvakuum-Elektronenstrahlschweißen von höherfesten Stahlwerkstoffen., 4. Industriekolloquium SFB 362. DFG
-
(2004): Ossäre Interferenzschrauben - Herstellung und biomechanische Testung, 21.Kongress der Deutschsprachigen Arbeitsgemeinschaft für Arthroskopie (AGA), Luzern, Schweiz, Oktober 2004
-
(2004): Herstellung und biomechanische Testung von Interferenzschrauben aus Knochenmaterial, Deutscher Orthopädenkongress, Berln, Deutschland, Oktober 2004
-
(2004): Manufacturing diamond impregnated tools for stone machining through thermal spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
-
(2003): Wlasnosci warstw kompozytowych natryskiwanych gazowo-detonacyjnie na podloza stopów lekkich na osnowie Al i Mg, Proc. Conf. "Modern Wear and Corrosion Resistant Coatings Obtained by Thermal Spraying", Warschau, 2003, 2003.
-
(2003): Advantages of reactive spraying by simultaneous self-propagating high temperature synthesis (SHS), IWW Annual Assembly 2003.
-
(2003): Particle Image Velocimetry Thermal Spraying, SDMA/ICSF 2003 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June, S. Kapitel 7, S. 115-126. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
ISBN: 3-8330-0571-8 -
(2003): Aspekte der PVD-Beschichtung plasmanitrierter Werkzeugstähle, Tagungsband zur 5. Industriefachtagung "Oberflächen- und Werkstofftechnik" und zum 6. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und Werkstofftechnische Anwendungen Vol. 16, S. 265-270. Chemnitz: Eigenverlag, 2003.
-
(2003): State of the Art of Thermal Spraying, 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
ISBN: 3-8330-0571-8 -
(2003): Cellular Magnesium: Magnesium mit zellenförmiger Struktur, MetFoam. Cellular Metals: Manufacture, Properties, Applications. International Conference Berlin 23. - 25.06.2003. Berlin: Metall Innovation Technologie MIT, S. 255–258
-
(2003): Thermographische Analyse beim Walzen von Magnesiumblechen, 11. Magnesium Abnehmerseminar ; 26./26. September 2003 in Aalen &. 11th Magnesium Automotive and End User Seminar. Europäische Forschungsgemeinschaft Magnesiumguss. Aalen, S. 18.0-18.5
ISBN: 3-932291-36-0 -
(2003): Themenschwerpunkt "Urformen", Mikromechanische Produktionstechnik, Abschlusskolloquium zum DFG-Schwerpunktprogramm 1012, S. 115-147, 2003.
-
(2002): Internationale Schneidtechnische Tagung 2002. Wasserstrahltechnologie im 21. Jahrhundert - ein Ausblick auf Forschritt und künftige Entwicklungsfelder, Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation
-
(2002): Partikeldiagnostik mittels Particle Image Velocimetry (PIV) beim Hochgeschwindigkeitsflammspritzen, Tagungsband des GTV-Kolloquiums 2002, Luckenbach, S. 21-32, 2002.
-
(2002): Abrasive waterjet technology in aerospace and aircraft manufacturing industries. Wasserabrasivstrahltechnologie für die Luft- und Raumfahrtindustrie., Internationale Schneidtechnische Tagung 2002. Unter Mitarbeit von Ch. Biskup, F. Pude, E. Zheng, F. Chen und E. Siores. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation.
-
(2002): Two-dimensional and three-dimensional abrasive waterjet machining of aerospace composite components, 16th International Conference on Water Jetting, Aix-en-Provence, France, Oct. 2002, pp. 211-224
ISBN: 1-85598-042-8 -
(2002): Abrasive Waterjet Technology in Aerospace and Aircraft Manufacturing Industries, International Conference on Cutting Technology (ICCT), Hannover, Germany, April 2002, pp. 143-152
ISBN: 3-9806415-5-4 -
(2002): Analysis of changing material properties of low carbon steel wire St1Kp after heat treatment and bending, Sučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (5), S. 377–382
-
(2002): Hochleistungsstrahlverfahren für das Fügen von Feinblechen, Drittes Industriekolloquim SFB 362. DFG. Clausthal-Zellerfeld, 06.02.2002.
-
(2002): Hochleistungsstrahlverfahren für moderne Schweißkonstruktionen, 2. Intensivseminar Elektronenstrahltechnik. mi information center. Landsberg: verlag moderne industrie.
-
(2002): Oxide Coated Transparent Aluminum Foaming Moulds, Proceedings of Materials Week 2002. München 30.09. - 02.10.2002: Werkstoff-Informationsgesellschaft
-
(2001): Prozessdiagnose und -regelung beim Löten mittels Ultraschall, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, S. 329-334. Düsseldorf: DVS-Verlag, 2001.
-
(2001): Casting Process for Foamed Magnesium, J. Banhart, M. F. Ashby und N. A. Fleck (Hg.): Cellular Metals and Metal Foaming Technology. Bremen 18. - 20.06.2001. Bremen: Metall Innovation Technologie MIT, S. 175–180
-
(2001): Untersuchungen zum industriellen Weichlöten von Kupfer an Rotguß, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 5-10. Düsseldorf: DVS-Verlag, 2001.
-
(2001): Flußmittelfreies Löten von Aluminiumlegierungen mit Schutzgasaktivatoren, DVS (Hg.): Tagungsband zur “Löt 2001”, 6. Internationales Kolloquium, Bd. 212. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH (212), S. 375–379
-
(2001): Neue Lösungsansätze zum Löten von Aluminiumlegierungen mit artgleichen und nicht artgleichen Fügepartnern, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 231-235. Düsseldorf: DVS-Verlag, 2001.
-
(2001): Non-Vakuum-Elektronenstrahlschweißen: Ein Verfahren zum Fügen von Feinblechen, E. Lugscheider (Hg.): 9. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie 2001. VDI. Aachen: VDI-Gesellschaft Werkstofftechnik, S. 59–67
-
(2001): Non-Vakuum-Elektronenstrahlschweißen an Al- und Mg-Feinblechen, Tagungsband zur 5. Konferenz „Strahltechnik“ am 27. und 28. November 2001, S. 46–53
-
(2000): Casting Process for the Production of Foamed Magnesium Structural Parts, T. W. Clyne (Hg.): Metal matrix composites and metallic foams. Euromat 1999 European Congress on Advanced Materials and Processes, München 27. - 30.09.1999. Weinheim: Wiley-VCH (5), S. 46–50
-
(2000): Metall-Kapillardruckgießen: Ein neues Urformverfahren für die Mikromechanik, E. Lugscheider (Hg.): 7. Werkstoffwissenschaftliches Kolloquium - Innovative Werkstofftechnologie 1999, Werkstoffwissenschaftliche Schriftenreihe. Aachen: Shaker Verlag (41), S. 67–73
-
(1999): Investigations on Capillary Action Microcasting of Metals, 1st International Conference and General Meeting of the European Society for Precision Engineering and Nanotechnology, Bremen, Germany, S. 490-493, 1999.
-
(1998): Anwendungsorientierte Lotentwicklung, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 48-51, 1998.
-
(1998): Fluß-mittelfreies Löten von Leichtmetall/Stahl-Verbindungen, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 206-210, 1998.
-
(1997): Nd: YAG laser beam welding of magnesium constructions, G. W. Lorimer (Hg.): Proceedings of the Third International Magnesium Conference. 10-12 April 1996, Manchester, UK. London: Institute of Materials, S. 89–98.
Patents
-
(2021): Verfahren zum Herstellen eines gehärteten Bauteils und Werkzeugmaschine, Patentschrift, Deutsches Patent- und Markenamt, DE 10 2020 105 360 A1
-
(2019): Konstruktionsbauteil eines technischen Gegenstands sowie Verfahren zur Herstellung des Konstruktionsbauteils, Patentschrift: DE 102015106002, 06.03.2019
-
(2019): Method for manufcaturing a component containing an iron alloy material, component and iron alloy material, Patentschrift: EP 2990140B1, 02.01.2019
-
(2019): Gelenkbauteil sowie damit gebildetes künstliches Gelenk und Verfahren zu dessen Herstellung, Patentschrift: DE 102018101692B4, 01.08.2019
-
(2018): Verfahren zum Oberflächenbeschichten eines Bauteils, Patentschrift: DE 10 2016 114 450 B4, 22.03.2018
-
(2017): Verfahren zum Strangpressen, Strangpressvorrichtung sowie Strangpresswerkzeug, Patentschrift: DE102015107308, 19.10.2017
-
(2017): Verfahren zur Herstellung eines Hybridzahnrads sowie Hybridzahnrad, Patentschrift: DE102015102297, 31.08.2017
-
(2017): Verfahren zur Herstellung eines metallischen Bauteils, metallisches Bauteil und Vorrichtung zur Herstellung eines metallischen Bauteils, Patentschrift: DE 10 2014 109 764 B4, 20.07.2017
-
(2015): Wasserabrasiv-Suspensionsschneideeinrichtung, Verfahren zu dessen Steuerung und Computerprogramm, Patentschrift: DE 10 2014 100 839 B4, 30.07.2015
-
(2014): Verfahren zur Herstellung eines Ziehprofils und Zugvorrichtung zur Herstellung eines Ziehprofils mittels eines Ziehprozesses, Patentschrift, DE10 2013 104 281 B4, 25.06.2015
-
(2011): Verfahren und Vorrichtung zum thermischen Bearbeiten von Werkstoffen mit einem Elektronenstrahl und Gas , Veröffentlichungs-Nummer EP000002322309A1
-
(2011): Verfahren zur Bestimmung des Abstands zwischen einer autogenen Brennereinrichtung und einem Werkstück durch Erfassung einer Kerngrösse ohne eine eigene elektrische Energieversorgung , Veröffentlichungs-Nummer DE102010033947B4
-
(2010): Medizinische Implantate, Prothesen, Prothesenteile, medizinische Instrumente, Geräte und Hilfsmittel aus einem Halogenid-modifizierten Magnesiumwerkstoff, Veröffentlichungs-Nummer: EP000001458426B1
-
(2009): Bauteil, Verfahren zum Einbringen von Informationen in ein Bauteil und Verfahren zum Ermitteln einer Belastungshistorie eines Bauteils , Veröffentlichungs-Nummer: DE102009056584B4
-
(2006): Schaumgiessverfahren sowie eine druckdicht verschliessbare Giessform zur Herstellung von Formteilen , Veröffentlichungs-Nummer EP000001482062B1