Logo Leibniz Universität Hannover
Logo: IW
Logo Leibniz Universität Hannover
Logo: IW
  • Zielgruppen
  • Suche
 

Publikationen von Prof. Dr.-Ing. habil. Dr.-Ing. E.h. Dr. h.c. Friedrich-Wilhelm Bach †

2016

Patentschriften

Bach, F. W.; Biskup, C.; Zaremba, D. (2016): Absorber für eine in der Osteotomie verwendete Wasserstrahl-Schneideinrichtung, Patentschrift: AT 14607 U1 2016-02-15, 15.02.2016

2015

Beiträge in Büchern

Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Hassel, T.; Bach, F.-W.; Maier, H. J.; Lamon, J.; Haverich, A.; Wriggers, P. (2015): Development of Magnesium Alloy Scaffolds to Support Biological Myocardial Grafts: A Finite Element Investigation, Lenarz, T.; Wriggers, P. (Hg.): Biomedical Technology, Publishing Lecture Notes in Applied and Computational Mechanics 74, Springer International Publishing, Switzerland, S. 81-100
DOI: 10.1007/978-3-319-10981-7_6

Zeitschriften/Aufsätze

Hassel,T.; Hecht-Linowitzki, V.; Kussike, S.M.; Rehfeldt, D.; Bach, Fr.-W. (2015): Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVER, Welding and Cutting 14 (1), 2015, S. 48-53

Patentschriften

Bauer, M.; Pude, F.; Eiben, F.; Bach, Fr.-W. (2015): Wasserabrasiv-Suspensionsschneideeinrichtung, Verfahren zu dessen Steuerung und Computerprogramm, Patentschrift: DE 10 2014 100 839 B4, 30.07.2015

2014

Konferenz

Bauer, M.; Eiben, F.; Bach, Fr.-W.; Maier, H. J.; Hassel, T. (2014): New valve technology for AWSJ cutting, Proceedings of the 22nd International Conference on Water Jetting, Haarlem, Netherlands, 3-5 September 2014, pp. 99-106

Hassel, T.; Bauer, M.; Hoyer, P.; Patil, A. J.; Beniash, E.; Bach, F.-W.; Maier, H. J.  (2014): Study of magnesium fluoride and self-assembled organosilane coatings of AZ31 and MgCa0.8 alloys, 6th Symposium on Biodegradable Metals, University Politecnico di Milano, Maratea, Italien, 24.-29. August 2014

Durisin, M.; Lenarz, T.; Kanaan, N.; Bach, F.-W.; Angrisani, G. L.; Maier, H. J. (2014): Changes on a platinum electrode surface during acoustic stimulation of a cochlear implant – in vitro approach, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S. 1144–1147
DOI: 10.1515/bmt-2014-5014

Eifler, R.; Seitz, J. M.; Klose, C.; Bach, F.-W. (2014): Drawing and Stranding of Magnesium Wires for use as a Resorbable Suture Material, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.1186
DOI: 10.1515/bmt-2014-5014

Böhm, V.; Maier, H. J.; Bach, F.-W.; Reimche, W.; Behrens, B.-A.; Odening, D.  (2014): Acoustic process monitoring during transient precision forging of high strengh components, Ludger Overmeyer und Vyacheslav P. Shkodyrev (Hg.): AST - Symposium on Automated Systems and Technologies. Proceedings, Hannover, 15-16 October 2014. 1. Aufl. Garbsen: TEWISS (Berichte aus dem ITA, 2014, Bd. 4), S. 105–110

Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Hassel, T.; Bach, Fr.-W.; Maier, H. J.; Haverich, A.; Wriggers, P. (2014): Finite element simulations for development of cardiovascular implants to support biological grafts, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.984
DOI: 10.1515/bmt-2014-4422

Bauer, M.; Hassel, T.; Grünzel, O.; Hinz, C.; Schilling, T.; Kaufeld, K. T.; Bach, Fr.-W.; Maier, H. J.; Haverich, A. (2014): Characterization of native and decellularised aortic tissue by using uniaxial tensile test, 48. Jahrestagung der deutschen Gesellschaft für Biomedizinische Technik (DGBMT), Hannover, 8.-10.10.2014, Biomedical Engineering/Biomedizinische Technik 59 (S1), S.115
DOI: 10.1515/bmt-2014-4509

Westphal, R.; Zaremba, D.; Hassel, T.; Liodakis, E.; Suero, E.; Krettek, C.; Bach, F.-W.; Wahl, F. (2014): Roboterassistierte Umstellungsosteotomie mittels Wasserabrasivstahltechnik, Deutsche Gesellschaft für Computer‐ und Roboter Assistierte Chirurgie, Session XV

Kaufeld, K. T.; Schilling, T.; Hinz, C.; Brandes, G.; Cebotari, S.; Tudorache, I.; Mogaldea, A.; Bach, F.-W.; Hassel, T.; Biskup, C.; Bauer, M.; Hilfiker, A.; Haverich, A. (2014): Decellularized aortic allograft stabilized by an absorbable magnesium scaffold for substitution of the descending aorta, Thorac cardiovasc Surg (The Thoracic and Cardiovascular Surgeon)
DOI: 10.1055/s-0034-1367288

Beiträge in Büchern

Yu, Z.; Gretzki, T.; Nürnberger, F.; Kästner, M.; Haskamp, K.; Bach, F.-W.; Schaper, M.; Hassel, T. (2014): Wärmebehandlung, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 127–220

Böhm, V.; Kästner, M.; Gillhaus, Rüdiger; Haskamp, K.; Reimche, W.; Bach, F.-W.; Reithmeier, E. (2014): Mess- und Prüftechnik, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 311-430

Wolf, L.; Diekamp, M.; Gretzki, T.; Nürnberger, F.; Bach, F.-W.; Rodman, D.; Moritz, J.; Schrödter, J.; Hübner, S.; Behrens, B. -A (2014): Hot Stamping and subsequent spray cooling: A new manufacturing approach, Prof. O. N. Golovko, Plastic Deformation of Metals, 2014, Akzent PP, Dnipropetrovsk, S. 36-55

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Hübsch, C.; Maier, H. J. (2014): Microstructured thermally sprayed surfaces, B. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92

Frackowiak, W.; Bruchwald, O.; Reimche, W.; Bach, F.-W.; Maier, H. J. (2014): High Frequency Eddy-Current and Induction Thermography Inspection Techniques, In: Capova, K. (Hrsg.): Electromagnetic nondestructive evaluation (XVII), ISBN 978-1-61499-407-7, S. 226-233
DOI: 10.3233/978-1-61499-407-7-226

Verschiedenes

Westphal, R.; Zaremba, D.; Hassel, T.; Suero, E.; Nael, H.; Citak, M.; Krettek, C.; Bach, F.; Wahl; F.  (2014): Robot Guided Water Jet Cutting to Assist Osteotomies of Human Bones, Video-Proceedings - IEEE, International Conference on Robotics and Automation, Hong Kong, May/June 2014, Video

Zeitschriften/Aufsätze

Rodman, M.; Bryukhanov, A.A.; Bach, Fr.-W.; Grydin, O.; Klose, C.; Gerstein, G. (2014): Complex Investigations of the Influence of Low Cycle Sign-Variable Bending on the Mechanical Properties of Magnesium Alloy AZ31 Sheet , Plastic Deformation of Metals 1, S. 23-27

Biermann, D.; Kirschner, M.; Maier, H. J.; Bach, F.-W.; Möhwald, K.; Schaup, J. (2014): Active brazed ceramic cemented carbide compound drills for machining lamellar graphite cast iron, Prod. Eng. Res. Devel. (Production Engineering), 2014, vol. 8, 3
DOI: 10.1007/s11740-014-0547-x

Biermann, D.; Kirschner, M.; Maier, H. J.; Bach, F.-W.; Möhwald, K.; Schaup, J. (2014): Verbundbohrwerkzeug vereint Eigenschaftsvorteile der Fügepartner, Forum Schneidwerkzeug- und Schleiftechnik, Forum Schneidwerkzeug- und Schleiftechnik, 2014, 102-109

T. Hassel, V. Hecht-Linowitzki, S. M. Kussike, D. Rehfeldt, F.-W. Bach (2014): Systematische Untersuchung zum nassen Lichtbogenschweißen unter Wasser mit umhüllten Stabelektroden, Schweißen und Schneiden, 2014, vol. 66, 05, 250-256

Engelhardt, M.; Grittner, N.; Reimche, W.; Bach, Fr.-W. (2014): Non-destructive detection of weld seams in extruded aluminium profiles, In: Key Engineering Materials 585, S. 103–110.

Herbst, S.; Gerstein, G.; Nürnberger, F.; Bach, F.-W. (2014): Suitable Impact Parameters for High-Speed Joining and Influence on the Bonding Zone Microstructure, Journal of Materials Engineering and Performance 23 (3), S. 944-953
DOI: 10.1007/s11665-013-0845-z

Behrens, B.-A.; Maier, H. J.; Bach, F.-W.; Reimche, W.; Mroz, G.; Schrödter, J.; Jocker, J. (2014): A method to detect the level and direction of mechanical forces with the aid of load-induced martensitic phase transformation, Prod. Eng. Res. Devel., vol 8, 63-72

M. Bauer, T. Schilling, M. Weidling, D. Hartung, Ch. Biskup, P. Wriggers, F. Wacker, Fr. -W. Bach, A. Haverich, T. Hassel (2014): Geometric adaption of biodegradable magnesium alloy scaffolds to stabilise bio-logical myocardial grafts. Part I, Journal of Materials Science: Materials in Medicine (Springer Verlag), Volume 25, S. 909-916
DOI: 10.1007/s10856-013-5100-5

Varahram, A.; Breidenstein, B.; Hassel, T.; Bach, F. -W; Maier, H. J. (2014): New design and construction of expandable casing tubes, Forschung im Ingenieurwesen 78 (3-4), S. 145-149

Patentschriften

Eifler, R.; Seitz, J.-M.; Bach, F. W. (2014): Verfahren zur Herstellung eines Ziehprofils und Zugvorrichtung zur Herstellung eines Ziehprofils mittels eines Ziehprozesses, Patentschrift, DE10 2013 104 281, Anmeldedatum: 26.04.2013

Vortrag

Reimche, W.; Bruchwald, O.; Frackowiak, W.; Maier, H.-J.; Bach, F.-W. (2014): Hochtemperatur Bainit-Sensortechnik zur inline Charakterisierung der Werkstoffumwandlung und Einstellung der Bauteileigenschaften, AiF-Leittechnologien für Morgen EcoForge. Ressourceneffiziente Prozessketten für Hochleistungsbauteile. Hamburger NDT Tage 2014. DGZfP-Ausbildungszentrum Hamburg/Helling. Hamburg, 12.11.2014

2013

Konferenz

Dellinger, P.; Möhwald, K.; Maier, H. J.; Bach, Fr.-W. (2013): Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology, 9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013

Behrens, B.- A.; Bach, Fr.-W.; Diekamp, M.; Hübner, S.; Nürnberger, F.; Schrödter, J.; Wolf, L.; Moritz, J. (2013): Process Time Reduction of Hot Stamping by Means of Early Extraction from the Press, In: Mats Oldenburg und Kurt Steinhoff (Hg.): Proceedings / 4th International Conference Hot Sheet Metal Forming of High Performance Steel. June 9 - 12, 2013, Luleå, Sweden. Auerbach: Verl. Wiss. Scripten (CHS 2 series, 4), S. 259-266 (8).

Holländer, U.; Bach, Fr.-W.; Möhwald, K.; Kirchberg, S.; Ziegmann, G. (2013): Injection molding, characterization and application of polymer bonded nickel based braze metal preforms for high temperature brazing processes, Proceedings of 10th International Conference on Brazing, High Temperature Brazing and Diffusion Brazing, Aachen, Juni 2013, S. 11-16

Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, F.-W. (2013): Injection molding and application of ring-shaped polymer-bonded braze metal preforms, Tagungsband: Design of/with composites, Composites Week @ Leuven, Leuven (Belgien), September 2013

Zaremba, D.; Westphal, R.; Suero, E.; Krettek, C.; Wahl, F.M; Bach, Fr.-W.; Hassel, T. (2013): Robot-Assisted Displacement Osteotomy by the Abrasive Waterjet – Concept and Technical Realization, In: M. Hashish (Hg.): Proceedings of the 2013 WJTA-IMCA Conference and Expo. September 9-11, 2013, George R. Brown Convention Center, Houston, Texas. WaterJet Technology Association. Houston, USA, S. E3.

Kussike, S. M.; Hecht-Linowitzki, V.; Werner, J.; Peuker, M.; Bach, Fr.-W.; Hassel, T. (2013): Hydrophobierung von Stabelektroden zum nassen Lichtbogenhand-schweißen unter Wasser – Wo liegen die Möglichkeiten?, In: DVS-Berichte Band 296, Große Schweißtechnische Tagung, Essen, 16. bis 21. September 2013, S. 56–62
DOI: 978-3-87155-614-2

Frąckowiak, W.; Bruchwald, O.; Reimche, W.; Bach, F.-W.; Maier, H. J.  (2013): High Frequency Eddy-Current and Induction Thermography Inspection Techniques for Turbine Components, In: 18th International Workshop on Electromagnetic Non-destructive Evaluation (ENDE). Bratislava, SK, 25.-28.06.2013.

Wolf, L.; Moritz, J.; Diekamp, M.; Schrödter, J.; Nürnberger, F.; Hübner, S.; Bach, Fr.-W.; Behrens, B.- A.; Sunderkötter, C.; Marusch H.-E. (2013): Partielles Vergüten mittels verkürztem Formhärteprozess und nachgeschalteter Spraykühlung, In: M. Merklein (Hg.): 8. Erlanger Workshop Warmblechumformung. Bamberg, Germany: Meisenbach GmbH-Verlag, S. 65–84.

Hassel, T.; Hecht-Linowitzki, V.; Kussike, S. M.; Rehfeldt, D.; Bach, Fr.-W. (2013): Underwater arc wet welding and statistical analyses with the ANALYSATOR HANNOVER, In: 66th IIW Annual Assembly. Commission XII „Arc Welding Processes and Production Systems“. Unter Mitarbeit von International Institute of Welding

Petersen, M.; Jakob, H.; Köhler, A.; Bach, Fr.-W.; Hassel, T.  (2013): Hot-Wire-Plasmaschneiden: Zerlegen von komplexen Bauteilen und Verbundwerkstoffen / Hot-Wire plasma arc cutting: Cutting of complex structures and composite materials, In: Kontec Gesellschaft für technische Kommunikation (Hrsg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle. Hamburg, S. 463–486

Jakob, H.; Köhler, A.; Bach, Fr.-W.; Hassel, T.; Kremer, G.; Kinscher, J.; Tewes, R.; Dierkes, U.; Heger, K.; Held, C. (2013): Zerlegen metallischer Strukturen im kerntechnischen Umfeld durch Verwendung von Schneidladungen / Cutting of metal structures with linear cutter charges in nuclear power plants, In: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 513–545.

Jakob, H.; Petersen, M.; Köhler, A.; Bach, Fr.-W.; Hassel, T.; Brüggemann, P.; Bienia, H.; Brähler, G. (2013): Zirkoniumlegierungen universell und sicher Schneiden – ZIRKUSS Universal and safe cutting techniques for zirconium alloys - ZIRKUSS, In: Kontec Gesellschaft für technische Kommunikation mbH (Hg.): KONTEC 2013 – Tagungsband. 11. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“ einschließlich 11. Statusbericht des BMBF „Stilllegung und Rückbau kerntechnischer Anlagen“. Hamburg: Kontec Gesellschaft für technische Kommunikation mbH, S. 612–626.

Reimche, W.; Bruchwald, O.; Frackowiak, W.; Bach, F.-W.; Maier, H. J. (2013): Sensorkontrollierte Umwandlung von Hochleistungsbauteilen aus der Schmiedewärme, In: Christ, H.-J. (Hrsg.): Tagung Werkstoffprüfung – Fortschritte in der Werkstoffprüfung für Forschung und Praxis, 28.11.-29.11. 2013, Neu-Ulm, S. 271-277

Klose, C.; Demminger, C.; Zwoch, S.; Reimche, W.; Bach, Fr.-W; Maier, H. J.; Kerber, K. (2013): Measurement of static and dynamic loads utilizing sensory magnesium components, In: Euro Intelligent Materials 2013 (E. Quandt und C. Selhuber-Unkel (Hg.)), DGM, 2013, S. 57

Verschiedenes

Meschut, G.; Hahn, O.; Matzke, M.; Olfermann, T.; Reimche, W.; B., Christoph; Mroz, G.; Bach, F.-W.; Maier, H. J.; Drossel, W.-G.; Neugebauer, R.; Ahnert, M.; Broschwitz, E.; Kraus, C. (2013): Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen, Proceedings to conference 3 Fügetechnisches 2013

Zeitschriften/Aufsätze

Freytag, P.; Kerber, K.; Bach, Fr.-W. (2013): Laserbeschriftung von Hartferritmagneten zur Kennzeichnung von Druckgussteilen, In: Forschung im Ingenieurwesen 77 (1), S. 39–47. Online verfügbar unter http://link.springer.com/content/pdf/10.1007%2Fs10010-013-0161-7.pdf

Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Abo-Namous, O.; Kästner, M.; Reithmeier, E. (2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und Verschleißbeanspruchungen, In: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract

Drynda, A.; Seibt, J.; Hassel, T.; Bach, Fr.-W.; Peuster, M. (2013): Biocompatibility of fluoride-coated magnesiumcalcium alloys with optimized degradation kinetics in a subcutaneous mouse model, In: J Biomed Mater Res Part A 101A, S. 33–43

Krüger, R.; Seitz, J.-M.; Ewald, A.; Bach, Fr.-W.; Groll, J. (2013): Strong and tough magnesium wire reinforced phosphate cement composites for load-bearing bone replacement, In: Journal of the Mechanical Behavior of Biomedical Materials 20, S. 36–44.

Waizy, H.; Seitz, J.-M.; Reifenrath, J.; Weizbauer, A.; Bach, Fr.-W.; Meyer-Lindenberg, A.; Denkena, B.; Windhagen, H. (2013): Biodegradable magnesium implants for orthopedic applications, In: Journal of Materials Science 48 (1), S. 39–50. Online verfügbar unter http://www.springerlink.com/content/n33l6487g9388578/.
DOI: 10.1007/s10853-012-6572-2

Ullmann, B.; Angrisani, N.; Reifenrath, J.; Seitz, J.-M.; Bormann, D.; Bach, Fr.-W.; Meyer-Lindenberg, A. (2013): The effects of handling and storage on magnesium based implants — First results, In: Materials Science and Engineering: C 33 (5), S. 3010–3017.

Hoyer, P.; Angrisani, G. L.; Klose, C.; Bach, Fr.-W.; Hassel, T. (2013): Korrosionsverhalten binärer Magnesium-Zink-Legierungen in salzhaltigen Medien, In: Materialwissenschaft und Werkstofftechnik 44 (1), S. 84–93.

Herbst, S.; Jablonik, L.; Gerstein, G.; Nürnberger, F.; Bach, Fr.-W. (2013): Topographieoptimierende Präparation metallischer Werkstoffverbunde, In: Praktische Metallographie / Practical Metallography 50 (7), S. 491–500. Online verfügbar unter http://www.practical-metallography.com/PM110242.

Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Maier, H. J. (2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von Turbinenschaufeln, In: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.

Hassel, T.; Murray, N.; Konya, R.; Beniyash, A.; Bach, Fr.-W. (2013): Nonvacuum electron beam cutting and welding—two partnering processes for fast and highly efficient metal working, In: Welding in the World 57 (3), S. 315–322. Online verfügbar unter http://link.springer.com/article/10.1007%2Fs40194-013-0032-8.

Schilling, T.; Gudrun, B.; Tudorache, I.; Cebotari, S.; Hilfiker, A.; Meyer, T.; Biskup, C.; Bauer, M.; Waldmann, K.-H.; Bach, Fr.-W.; Haverich, A.; Hassel, T. (2013): In vivo degradation of magnesium alloy LA63 scaffolds for temporary stabilisation of biological myocardial grafts in a swine model, In: Biomedical Engineering/Biomedizinische Technik 58 (5), S. 407–416.

Wulf, E.; Alphai, L.; Westphal, D.; Seitz, J.-M.; Schaper, M.; Becker, J.; Feldhoff, A.; Bach, Fr.-W. (2013): Grain refining of aluminium alloys and silicon by means of boron-nitride particles, International Journal of Material Research (IJMR), S. 266-274
DOI: 10.3139/146.110866

Reimche, W.; Bruchwald, O.; Frackowiak, W.; Bach, Fr.-W.; Maier, H. J. (2013): Non-destructive determination of local damage and material condition in high-performance components, HTM (HTM Journal of Heat Treatment and Materials), S. 59-67
DOI: 10.3139/105.110176

Hassel, T.; Konya, R.; Collmann, P.; Schaumann, P.; Priebe, S.; Deißer, T. A.; Beniyash, A.; Murray, N.; Bach, Fr.-W. (2013): Economical joining of tubular steel towers for wind turbines employing non-vacuum electron beam welding for high-strength steels in comarsion with sub-merged arc welding, In: Welding in the World. Online verfügbar unter http://www.springerlink.com/openurl.asp?genre=article&id=doi:10.1007/s40194-013-0050-6.

Klose, C.; Demminger, C.; Mroz, G.; Reimche, W.; Bach, Fr.-W.; Maier, H. J.; Kerber K.  (2013): Influence of Cobalt on the Properties of Load-Sensitive Magnesium Alloys, In: Sensors 13, S. 106–118. Online verfügbar unter http://www.mdpi.com/1424-8220/13/1/106/.

Seitz, J.-M.; Eifler, R.; Bach, Fr.-W.; Maier H. J. (2013): Magnesium Degradation Products: Effects on Tissue and Human Metabolism, In: Journal of Biomedical Materials Research Part A. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/jbm.a.35023/full.

Seitz, J.-M.; Fau, D. R.; Eifler, R.; Kietzmann, M.; Weber, C.; Durisin, M.; Bach, Fr.-W.;  (2013): MgNd2 : A Future Resorbable Magnesium-Based Implant Material?, In: Emerging Materials Research 2 (5), S. 239–247. Online verfügbar unter http://www.icevirtuallibrary.com/content/article/10.1680/emr.13.00034.

Durisin, M.; Weber, C.; Seitz, J.-M.; Bach, Fr.-W.; Kietzmann, M.; Schumacher, S.; Lenarz, Th. (2013): The Biodegradable Magnesium Stent as an Alternative Treatment in Cases of chronic Ventilation Disorders of the Paranasal Sinuses, In: BioMedical Engineering OnLine 58. Online verfügbar unter http://www.degruyter.com/view/j/bmte.2013.58.issue-s1-C/bmt-2013-4049/bmt-2013-4049.xml.

Patentschriften

Hassel, T.; Varahram, A.; Benedict, D.; Lehr, J.; Bach, Fr.-W. (2013): Enhanced Magnetically Impelled Arc Butt Welding (MIAB) Technology, Angemeldet durch Baker Hughes Incorporated am 14.10.2011. Veröffentlichungsnr: US20130092670 A1.

Hassel, T.; Varahram, A.; Bär, F.; Mitulla, S.; Lehr, J.; Overmeyer, L.; Wohlgemuth, L.; Bach, Fr.-W. (2013): ARC GUIDING AND SEALING DEVICE FOR A MAGNETICALLY IMPELLED BUTT WELDING RIG, Angemeldet durch Baker Hughes Incorporated am 14.10.2011. Veröffentlichungsnr: US 2013/0092665 A1

Hassel, T.; Varahram, A.; Benedict, D.; Lehr, J.; Bach, Fr.-W. (2013): ENHANCED MAGNETICALLY ARC BUTT WELDING (MIAB) TECHNOLOGY, Angemeldet durch Baker Hughes Incorporated am 05.10.2011. Veröffentlichungsnr: WO 2013/055598 A1.

Hassel, T.; Varahram, A.; Bär, F.; Mitulla, S.; Lehr, J.; Overmeyer, L.; Wohlgemuth, L.; Bach, Fr.-W.; Brouwer, D. (2013): ARC GUIDING AND SEALING DEVICE FOR A MAGNETICALLY IMPELLED BUTT WELDING RIG, Angemeldet durch Baker Hughes Incorporated am 05.10.2011. Veröffentlichungsnr: WO 2013/055600 A1.

Vortrag

Bauer, M.; Biskup, C.; Schilling, T.; Haverich, A.; Bach, Fr.-W.; Maier, H. J.; Hassel, T.  (2013): Influence of shot peening on surface roughness and in-vitro load cycles of magnesium alloys, BMT Kongress 2013. VDE MedTech. Deutsche Gesellschaft für Biomedizinische Technik (DGBMT). Graz, 19.09.2013.

Bauer, M.; Angrisani, G. L.; Schilling, T.; Kaufeld, T.; Hinz, C.; Haverich, A.; Bach, Fr.-W.; Maier, H. J.; Hassel, T. (2013): Evaluation of different Mg alloys for the in-vitro and in-vivo degradation testing of stabilizing tubular aortic scaffolds, Jahrestagung der Deutschen Gesellschaft für Biomaterialien 2013. Deutsche Gesellschaft für Biomaterialien e. V. Deutsche Gesellschaft für Biomaterialien e. V., Erlangen-Nürnberg, 26.09.2013.

Weidling, M.; Besdo, S.; Schilling, T.; Bauer, M.; Bach, Fr.-W.; Maier, H. J.; Haverich, A.; Wriggers, P.; Hassel, T. (2013): Development of magnesium alloy scaffolds to support biological myocardial grafts - A finite element investigation, International Conference on Biomedical Technology. European Community on Computational Methods in Applied Sciences (ECCOMAS). DFG SFB599. Hannover, 20.11.2013.

Reimche, Wilfried; Bruchwald, Oliver; Zwoch, Stefan; Bach, Friedrich-Wilhelm; Kolbusch, Rudolf (2013): Wirbelstrombasierte Unterwasser-Rissprüfung hochbeanspruchter Sohlverankerungslaschen in Wehranlagen, 4. Tagung Unterwassertechnik 2013

Meschut, G.; Hahn, O.; Matzke, M.; Olfermann, T.; Reimche, W.; Birr, C.; Mroz, G.; Bach, F.-W.; Maier, H. J.; Drossel, W.-G.; Neugebauer, R.; Ahnert, M.; Broschwitz, E.; Kraus, C. (2013): Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen, 3. Fügetechnisches Gemeinschaftskolloquium

Klose, C.; Demminger, C.; Zwoch, S.; Reimche, W.; Bach, F.-W; Maier, H. J. (2013): Magnesium race car components with load-sensitive properties, Euro LightMAT 2013. Magnesium, Aluminium, Titanium - Science and Technology. DGM. Bremen, 03.09.2013.

2012

Konferenz

Klose, C.; Mroz, G.; Kerber, K.; Reimche, W.; Bach, Fr.-W.  (2012): Production and Comparison of Adapted Load-sensitive Magnesium Alloys, In: B. Denkena, J. Gausemeier und B. Scholz-Reiter (Hg.): SysInt - 1st Joint International Symposium on System-integrated Intelligence. New Challenges for Production Engineering 27.-29.06.2012. CIRP The International Academy for Production Engineering. Garbsen: PZH Verlag, S. 56–58.

Petersen, M.; Jakob, H.; Bach, Fr.-W.; Hassel, T.  (2012): Grundlagenuntersuchungen und Emissionsmessungen beim Hot-Wire-Plasmaschneiden, In: Deutscher Verband für Schweißen und Verwandte Verfahren (DVS) (Hg.): DVS-Berichte Band 286. Tagungsband des DVS-Congress 2012. Düsseldorf: DVS Media, S. 137–142.

Holländer, U.; Möhwald, K.; Bach, Fr.-W. (2012): Physikalisch-chemische Betrachtungen zur Oxidschichtauflösung beim Hartlöten von Stählen mit Cu- und AgCu-Loten, In: Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Unter Mitarbeit von B. Wielage. Chemnitz: Eigenverlag, S. 465–472.

Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.  (2012): A New Hybrid Process for Repair Brazing and Coating of Turbine Blades, In: R.S Lima, A. Agarwal, M.M Hyland, Y.-C Lau, C. Li, A. McDonald und F.-L Toma (Hg.): International Thermal Spray Conference and Exposition (ITSC 2012). Conference Proceedings, 20.05. – 24.05.2012, Houston, TX, USA. ASM International. Novelty, OH, USA: ASM International, S. 110–113.

Reimche, W.; Frackowiak, W.; Bruchwald, O.; Böhm, V.; Bach, Fr.-W. (2012): Nachweis von lokalen Schädigungen an Hochleistungsbauteilen mit Hochfrequenz Wirbelstromtechniken und Induktions-Thermografie, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.

Reimche, W.; Bruchwald, O.; Zwoch, S.; Bach, Fr.-W. (2012): Prüfung hochbeanspruchter Sohlverankerungslaschen in Wehranlagen auf Rissanzeigen unter Wasser, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.

Reimche, W.; Böhm, V.; Bach, Fr.-W.; Odening, D.; Behrens, B.- A. (2012): Zeitbereichsanalyse transienten Umformverhaltens zur Qualitätsbewertung beim Präzisionsschmieden von Hochleistungsbauteilen, In: DGZfP e.V. (Hg.): Berichtsband-CD zur DACH-Jahrestagung 2012.

Varahram, A.; Lehr, J.; Swider, M. A.; Hassel, T.; Bach, Fr.-W. (2012): Casing connection method with improved Strength and Reliability for Monobore Wellbore Constructions, In: GeoEnergy Celle e.V Celle Drilling (Hg.): Celle Drilling 2012. International Conference for Advanced Drilling Technology

Murray, N.; Konya, R.; Beniyash, A.; Hassel, T.; Bach, Fr.-W.  (2012): New advances in non-vacuum electron beam cutting, In: Wilfried Behr (Hg.): International Electron Beam Welding Conference. Lectures of the 2nd IEBW Conference taking place in Aachen on March 26 - 30, 2012. Düsseldorf: DVS Media (DVS-Berichte, 285).

Bach, Fr.-W.; Möhwald, K.; Kerber, K.; Erne, M.; Knödler, P.; Otten, M.  (2012): Herstellung von nachbearbeitungsarmen Innenbeschichtungen auf Druckgussteilen durch Transplantation thermischer Spritzschichten, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 129–139.

Engelhardt, M.; Haverkamp, H.; Klose, C.; Bach, Fr.-W. (2012): Development of a Pneumatic High-Speed Nakajima Testing Device, In: A. E. Tekkaya, G. Daehn und M. Kleiner (Hg.): High Speed Forming 2012. Proceedings of the 5th International Conference. Organizing committee of the 5th International Conference on High Speed Forming, April 24 – 26 2012, Technische Universität Dortmund, Faculty of Mechanical Engi-neering, Institute of Forming Technology and Lightweight Construction and De-partment of Materials Science and Engineering of the Ohio State University. Dortmund, S. 155–164.

Engelhardt, M.; Grittner, N.; Klose, C.; Bach, Fr.-W. (2012): Influence of Process Fluctuations on Weld Seam Properties in Aluminum Alloy Extrusion, In: H. Weiland, A. D. Rollet und W. A. Cassada (Hg.): ICAA13: 13th International Conference 2012. Hoboken, NJ, USA: John Wiley & Sons, Inc., S. 1843–1850.

Seitz, J.-M.; Eifler, R.; Bach, Fr.-W.  (2012): Magnesium Wire Materials, In: J. Grigoleit (Hg.): Wrought Magnesium Alloys - Resource-efficient Production and Applications. Proceedings: 63rd Freiberg Research Forum for Mining and Metallurgy. Freiberg: Eigenverlag, S. 28–31.

Birr, C.; Reimche, W.; Maier, H.J; Bach, Fr.-W.; Olfermann, T.; Matzke, M.; Meschut, G.; Hahn, O.; Ahnert, M.; Broschwitz, E.; Kraus, C.; Neugebauer, R. (2012): Lokale Konditionierung von presshartem Vergütungsstahl für das Hybridfügen von Mischbaustrukturen, In: FOSTA-EFB-DVS (Hg.): Gemeinsame Forschung in der Mechanischen Fügetechnik. 2. Fügetechnisches Gemeinschaftskolloquium 2012, S. 59–71.

Bücher

Lau, K.; Konya, R.; Hassel, T.; Bach, Fr.-W. (2012): Forschung für die Praxis P 714. Qualifizierung des Nonvakuum-Elektronenstrahlschweißens zum Fügen höherfester Stahlfeinbleche im Automobilbau, Düsseldorf: Verlag und Vertriebsgesellschaft mbH

Zeitschriften/Aufsätze

Seitz, J.-M., Bormann, U., Collier, K., Wulf, E., Eifler, R. and Bach, Fr.-W. (2012): Application of a Bioactive Coating on Resorbable, Neodymium Containing Magnesium Alloys, and Analyses of their Effects on the In Vitro Degradation Behavior in a Simulated Body Fluid, Advanced Engineering Materials; DOI: 10.1002/adem.201180078; http://onlinelibrary.wiley.com/doi/10.1002/adem.201180078/full

Behrens, S.; Hassel, T.; Bach, F.-W.; Steinwarz, W.; Dyllong, N.; Tragsdorf, I. M. (2012): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK. Ein Überblick zum Abschluss des Projektes, Atw. Internationale Zeitschrift für Kernenergie 57, 2012 (4), 250-254

Hinrichs, B.; Reimche, W.; Bruchwald, O.; Frackowiak, W.; Fritsching, U.; Bach, Fr.-W. (2012): Sensorkontrolliertes Bainitisieren im Spraydüsenfeld, GWI Gaswärme International, 3, pp. 77-85

Gershteyn, G.; Shevchenko, N.; Diekamp, M.; Brosius, A.; Schaper, M.; Bach, Fr.-W. (2012): Features of austenitic steels’ microstructure following plastic deformation, Materialwissenschaft und Werkstofftechnik, 43, (2012), No. 3

Gerstein, G.; Nowak, M.; Bierbaum, M.; Zhuravina, T.; Schaper, M.; Bach, Fr.-W. (2012): Increase the deformability of NiCo single crystals using of electrical pulse-like currents, Key Engineering Materials, 504-506, 143
DOI: 10.4028/www.scientific.net/KEM.504-506.143

Engelhardt, M.; Grittner, N.; von Senden genannt Haverkamp, H.; Reimche, W.; Bormann, D.; Bach, Fr.-W.  (2012): Extrusion of hybrid sheet metals, Journal of Materials Processing Tech. 212 (2012), pp. 1030-1038 (Final version published online 18. Feb 2012)
DOI: 10.1016/j.jmatprotec.2011.12.013

Schaup, J.; Holländer, U.; Roxlau, C.; Langohr, A.; Möhwald, K.; Bach, Fr.-W.  (2012): Neue Nickelhartlote für den Schutzgasdurchlaufofen, Schweissen und Schneiden 6 (64), S. 326–330

Hoyer, P.; Angrisani, G. -L; Klose, C.; Bach, Fr.-W.; Hassel, T.  (2012): Influence of Aluminium on the Corrosion Behaviour of Binary Magnesium-Aluminium Alloys in Saline Solutions, Materials and Corrosion, DOI: 10.1002/maco.201206531

Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, Fr.-W. (2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing Processes, In: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.

Wulf, E.; Alphai, L.; Wetsphal, D.; Seitz, J.-M.; Schaper, M.; Becker, J.; Feldhoff, A.; Bach, Fr.-W. (2012): Grain refining of aluminium alloys and silicon by means of boron nitride particles, In: International Journal of Material Research (IJMR). Online verfügbar unter http://www.ijmr.de/web/o_archiv.asp?ps=MK110866&task=03&o_id=25112811648-50.

Bach, Fr.-W.; Dellinger, P.; Holländer, U.; Möhwald, K.; Prehm, J. (2012): Oberflächenveredelung durch Metall-Kapillardruckgießen, In: Mikroproduktion 2012/03, S. 62–67

Rodman, D.; Krause. C.; Nürnberger, F.; Bach, Fr.-W.; Gerdes, L.; Breidenstein, B. (2012): Investigation of the surface residual stresses in spray cooled induction hardened gearwheels, International Journal of Materials Research, Vol. 103, Nr. 1, pp. 73-79
DOI: 10.3139/146.110622

Swider, M. A.; Langohr, A.; Möller, F.; Möhwald, K.; Bach, Fr-W; Hassel, T. (2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von Aluminiumlegierungen, In: Schweißen und Schneiden 64 (8), S. 490–496.

Seitz, J.-M.; Eifler, R.; Stahl, J.; Kietzmann, M.; Bach, Fr.-W. (2012): Characterization of MgNd2 alloy for potential applications in bioresorbable implantable devices, In: Acta Biomaterialia 8 (10), S. 3852–3864. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706112002371

Lehmann, E.; Schmaltz, S.; Germain, S.; Faßmann, D.; Weber, C.; Löhnert, S.; Schaper, M.; Bach, Fr.-W.; Steinamm, P.; Willner, K.; Wriggers, P. (2012): Material Model Identification for DC04 Based on the Numerical Modelling of the Polycrystalline Microstructure and Experimental Data, Key Engineering Materials 504-506 pp.993–998

Klöpfer, E.; Bach, Fr.-W.; Evertz, T.; Otto, M.; Redenius, A.  (2012): Ressourceneffizienz bei der Herstellung von dichtereduzierten Stählen mit dem Bandgießverfahren, In: Chemie Ingenieur Technik 84 (10), S. 1740–1748. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/cite.201200061/abstract.

Klose, C., Mroz, G., Rodman, M., Kujat, B., Bormann, D., Reimche, W., Bach, Fr.-W. (2012): Magnetic Magnesium Alloys Based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 14, 1-2 S. 28-34

Klose, C.; Kerber, K.; Otten, M.; Mroz, G.; Reimche, W.; Bach, Fr.-W. (2012): Mit magnetischen Legierungen werden ganze Bauteile zu Sensoren, In: Maschinenmarkt (39), S. 62–65. Online verfügbar unter http://www.maschinenmarkt.vogel.de/themenkanaele/konstruktion/werkstoffe/articles/379106/.

Faßmann, D.; Gerstein, G.; Gerstein, D.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W.  (2012): Preparation Routine for In Situ Strain Analysis of deep drawing Steel DC04 by Means of Transmission Electron Microscopy, In: Praktische Metallographie 2012 (9), S. 577–587

Faßmann, D.; Gerstein, G.; Schaper, M.; Bach, Fr.-W. (2012): Investigation of ductile damage development in ferritic steel subject to uniaxial deformation, In: Fatigue & Fracture of Engineering Materials & Structures 35 (10), S. 936–942. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1111/j.1460-2695.2012.01679.x/full.

Klose, C.; Mroz, G.; Angrisani, G. L.; Kerber, K.; Reimche, W.; Bach, Fr.-W. (2012): Casting Process and Comparison of the Properties of Adapted Load-Sensitive Magnesium Alloys, In: Production Engineering Research & Development. Online verfügbar unter http://link.springer.com/article/10.1007/s11740-012-0413-7.

Kohorst, P.; Borchers, L.; Strempel, J.; Stiesch, M.; Hassel, Th.; Bach, Fr.-W.; Hübsch, C.  (2012): Low-temperature degradation of different zirconia ceramics for dental applications , In: Acta Biomaterialia 8 (3), S. 1213–1220. Online verfügbar unter http://www.sciencedirect.com/science/article/pii/S1742706111005034.

Usov, V.V; Bryukhanov, P.A; Rodman, M.; Shkatulyak, N.M; Shaper, M.; Klose, C.; Bach, Fr.-W. (2012): Influence of reversed bending on texture, strcture and mechanical properties of α-titanium sheets, In: Deformation and Fracture of Materials (Deformatsiya I Razrushenie materialov) (9), S. 32–37.

Erne, M.; Kolar, D.; Hübsch, C.; Möhwald, K.; Bach, Fr.-W.: (2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma Spraying, Journal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/

Behrens, B. - A.; Bach, Fr.-W.; Bouguecha, A.; Nürnberger, F.; Schaper, M.; Yu, Z.; Klassen, A. (2012): Numerische Berechnung einer integrierten Wärmebehandlung für präzisionsge-schmiedete Bauteile, In: Journal of Heat Treatment and Materials 67, S. 337–343. Online verfügbar unter http://www.htm-journal.de/HT110156.

Zaremba, D.; Biskup, C.; Heber, T.; Weckend, N.; Hufenbach, W.; Adam, F.; Bach, Fr.-W.; Hassel, T. (2012): Repair Preparation of Fiber-Reinforced Plastics by the Machining of a Stepped Peripheral Zone, In: Journal of Mechanical Engineering 58 (10), S. 571–577.

Kiliclar, Yalin; Engelhardt, Markus; Vladimirov, Ivaylo N.; Pietryga, Michael P.; von Senden genannt Haverkamp, Hermann; Reese, Stefanie; Bach, Friedrich Wilhelm (2012): On the Improvement of Formability and the Prediction of Forming Limit Diagrams at Fracture by Means of Constitutive Modelling, KEM (Key Engineering Materials), S. 29-34
DOI: 10.4028/www.scientific.net/KEM.504-506.29

Hoyer, P.; Hassel, T.; Bach, Fr.-W. (2012): Einfluss der Oberflächenbehandlung auf das Korrosionsverhalten von Magnesiumlegierungen, In: Materialwissenschaft und Werkstofftechnik 43 (12), S. 1067–1073

Patentschriften

Seitz, J.-M.; Eifler, R.; Bach, Fr.-W. (2012): Magnesiumlegierung und deren Herstellungsverfahren, Angemeldet durch Gottfried Wilhelm Leibniz Universität Hannover. Veröffentlichungsnr: DE102012108089.5.

Bach, Fr.-W.; Bautsch, T.; Guenther, A.; Olfe, J.; Tai Phan-Tan; Wilk, P. (2012): Process for Electrochemical Stripping of Components , Veröffentlichungs-Nummer US020080283416A1

Vortrag

Hinz, C.; Schilling, T.; Kaufeld, T.; Meyer, A.; Mogaldea, A.; Tudorache, I.; Cebotari, S.; Bach, Fr.-W.; Biskup, C.; Hassel, T.; Bauer, M.; Waldmann, K.-H.; Hilfiker, A.; Haverich, A. (2012): Degradable magnesium clips for the temporarily stabilization of biological decellularized aortic allografts, 78. Jahrestagung der Deutschen Gesellschaft für Kardiologie – Herz- und Kreislaufforschung e.V.; 11.-14.4.2012; Mannheim

Brandes, G.; Hinz, C.; Schilling, T.; Kaufeld, T.; Mogaldea, A.; Tudorache, I.; Cebotari, S.; Biskup, C.; Hassel, T.; Bauer, M.; Hilfiger, A.; Bach, Fr.-W.; Haverich, A.  (2012): Histological analysis of decellularized aortic allografts stabilized by a surrounding magnesium clips following long-term implantation in sheep, Jahrestagung der Deutschen Gesellschaft für Biomaterialien (DGBMT) 2012. Deutsche Gesellschaft für Biomaterialien e. V., 01.11.2012.

Möller, F.; Swider, M. A.; Langohr, A.; Hassel, T.; Möhwald, K.; Bach, Fr.-W.; Vollertsen, F. (2012): Developments of brazing solder and processes for flux less joining of aluminum, 65th Annual Assembly Commission XVII of the International Institute of Welding. International Institute Of Welding (IIW). IIW. Denver, Colorado, USA, 09.07.2012.

Bauer, M.; Hassel, T.; Biskup, Ch.; Hartung, D.; Schilling, T.; Weidling, M.; Wriggers, P.; Bach, Fr.-W.; Haverich, A. (2012): Geometric adaption of resorbable myocardial stabilizing structures based on the magnesium alloys LA63 and ZEK100 for the support of myocardial grafts on the left ventricle, 46. DGBMT Jahrestagung, BMT 2012. VDE MedTech. Jena, 17.09.2012.

2011

Hinte, N.; Biskup, C.; Hassel, T.; Schilling, T.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2011): Stabilizing structures for the aorta replacement - Static and dynamic testing, BMT 2011, Freiburg, 27.-30. September 2011

Konferenz

Plorin, T.; Bormann, D.; Haverkamp, H.; Klose, C.; Bach, Fr.-W. (2011): Herstellung ultraleichter Magnesium-Verbundprofile, Heinz Palkowski (Hg.): Abschlusskolloquium des Sonderforschungsbereichs 675: Erzeugung hochfester metallischer Strukturen und Verbindungen durch gezieltes Einstellen lokaler Eigenschaften. TU Clausthal, Institut für Metallurgie. Clausthal-Zellerfeld. S. 129 - 134.

Kremer, G.; Runge, J.; Tewes, R.; Dierkes, U.; Hassel, T.; Jakob, H.; Bach, Fr.-W.; Heger, K.; Praxl, H. (2011): Schneidladung als Zerlegeverfahren beim Rückbau von kerntechnischen Anlagen und Qualifizierung im kerntechnischen Umfeld, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 22-42

Besdo, S.; Biskup, C.; Klodmann, J.; Schmolke, S.; Andreae, A.; Waldmann, K.-H.; Bach, Fr.-W. (2011): Design of Interference Screws for the Cruiciate Ligament Reconstuction: A Finite Element Study, 4th International Conference on the Mechanics of Biomaterials and Tissues (ICOMBT)

Schmolke, S.; Andreae, A.; Biskup, C. (2011): Vergleichende Überprüfung des Einwachsverhaltens von biologischen Implantaten aus boviner Knochenkompakta und Polylalktidschrauben für die orthopädische Chirugie, Deutscher Kongress für die Orthopädie und Unfallchirugie, Berlin, 25.-28. Oktober

Brandes, G.; Schilling, T.; Meyer, T.; Cebotari, S.; Tudorache, I.; Hinte, N.; Biskup, C.; Hassel, T.; Bach, Fr.-W.; Haverich, A. (2011): Tissue Engineering of magnesium stabilized, vascularized, autologus gastric tissue for cardiac muscle replacement, ESAO-Kongress Oktober 2011

Hassel, T.; Wolyniec, A.; Kussike, S.M.; Bierbaum, M.; Rehfeldt, D.; Bach, Fr.-W. (2011): Systematische Untersuchung von Lichtbogenschweißprozessen unter Wasser, Deutscher Verband für Schweißen und verwandte Verfahren e.V., Unterwassertechnik 2011, S. 16-20

Hassel, T.; Kussike, S.M.; Wolyniec, A.; Bierbaum, M.; Bach, Fr.-W. (2011): Entwicklung von Stabelektroden für das nasse Lichtbogenschweißverfahren unter Wasser mittels Simulation von Tauchtiefen durch unbemannte Druckkammersysteme, Deutscher Verband für Schweißen und verwandte Verfahren e.V, Unterwassertechnik 2011, S. 21-27

Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Tribological behaviour of suspension plasma sprayed coatings for hot extrusion tools, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).

Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Three anodes compared to three cathodes: Evaluation of gun concepts for high performance plasma spraying operation, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).

Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Achieving new thermal spray coatings by usage of multielectrode plasma guns, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 353–360.

Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Suspension Plasma Spraying of oxide ceramic coatings on massive forming tools, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 337–346.

Schaper, M.; Gershteyn, G.; Clausmeyer, T.; Shevchenko, N.; Bargmann, M.; Bach, Fr.-W. (2011): Correlation between morphology of dislocation structures and macroscopic loadings, Proc. ICTP 2011, 2011

Gershteyn, G.; Nürnberger, F.; Cianciosi, F.; Shevchenko, N.; Schaper, M.; Bach, Fr.-W. (2011): A Study of Structure Evolution in Pearlitic Steel Wire at Increasing Plastic Deformation, Steel research int. 82 (2011) No. 12, p.p. 1368-1374

Behrens, S.; Hassel, T.; Bach, Fr.-W.; Steinwarz, W.; Dyllong, N.; Tragsdorf, I. M. (2011): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End- und Zwischenlagerbauteilen zur Reduktion von Reparaturen, Korrosion und Kosten - SHARK - Ein Überblick zum Abschluss des Projektes, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 608-621

Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011): Repair Brazing of Turbine Blades using Thermal Spraying, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 347–352.

Behrens, B.-A.; Yilkiran, T.; Bach, Fr.-W.; Puchert, A. (2011): Erhöhung des verschleißwiderstandes von Werkzeugen der Warmmassivumformung durch Ausnutzung der zyklischen Randschichthärtung, 20. Umformtechnisches Kolloquium Hannover. Hannover, 23.02.2011.

Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011): Reparaturlöten von Turbinenschaufeln mittels Thermischen Spritzens, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen, Bd. 43, pp. 231–236, Chemnitz, Eigenverlag, ISBN 978-3-00-035117-8

Bach, Fr.-W., Möhwald, K., Zhang, Yi, Freytag, P.; Erne, M.; Kerber, K.; Biermann, D.; Zabel, A., Peuker, A. (2011): Herstellung von Druckgussteilen mit mikrostrukturierten Funktionsschichten, durch die Transplantation von thermischen Spritzschichten, In: Tagungsband zum Werkstofftechnischen Kolloquium (14. Werkstofftechnisches Kolloquium), S. 24–33

Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2011): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Wielage (Hg.) 2010 – Tagungsband 13. Werkstofftechnisches Kolloquium Chemnitz

Bär, F.; Varahram, A.; Hassel, Th.; Overmeyer, L.; Bach, Fr.-W.  (2011): Cost-efficient Monobore Well Construction for Geothermal Energy, Proceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE

Brosius, A.; Soyarslan, C.; Stiemer, M.; Isik, K.; Faßmann, D.; Sieczkarek, P. et al.  (2011): Numerische und metallurgische Analyse der Werkstoffschädigung in der Blechmassivumformung, M. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 33–50.

Hassel, T.; Petersen, M.; Jakob, H.; Bach, Fr.-W. (2011): Hot-Wire-Plasmaschneiden mit exotherm abreagierendem Zusatzwerkstoff zur Erhöhung der Schneidleistung, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011

Hassel, Th.; Petersen, M.; Beniyash, A.; Bach, Fr.-W. (2011): Thermal treatment of contaminated concrete surfaces as a decommissioning method for Nuclear Power Plant Buildings, Proceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011, S. 129–135.

Hoyer, P.; Hassel, Th.; Bach, Fr.-W. (2011): Korrosions- und Verschleißschutz von Magnesiumbauteiloberflächen mittels PPA von Titanschichten, DVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275), S. 280–283.

Hoyer, P.; Hassel, Th.; Birr, C.; Jendras, M.; Bach, Fr.-W.; Grunau, H.  (2011): Korrosionsschutzgerechte Konstruktion und Handhabung langzeitstabiler Behälter für die Lagerung schwach- und mittelradioaktiver Abfälle, In: KTG Kerntechnische Gesellschaft e.V. (Hrsg.): KONTEC 2011, 10. Internationales Symposium "Konditionierung radioaktiver Betriebs- und Stilllegungsabfälle". Dresden. 06.-08.04.2011, S. 622–628

Jakob, H.; Hassel, Th.; Köhler, A.; Bach, Fr.-W.  (2011): MMC based materials as an alternative cutting material for cutting densely filled and heavily reinforced concrete structures, Proceedings of 1st International Conference on Stone and Concrete Machining. 1st International Conference on Stone and Concrete Machining. Hannover, 23.11.2011.

Lehmann, E.; Schmaltz, S.; Faßmann, D.; Germain, S.; Weber, C.; Löhnert, S. et al.  (2011): Identifikation eines Materialmodells für den DC04 basierend auf dernumerischen Modellierung der c und experimentellen Daten, M. Merklein, Fr.-W. Bach und A. E. Tekkaya (Hg.): Tagungsband 1. Workshop Blechmassivumformung. Erlangen, 13.10.2011. DFG Sonderforschungsbereich TR 73. Bamberg: Meisenbach GmbH-Verlag, S. 13–32.

Milenin, A.; Kustra, P.; Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.  (2011): Development and Validation of a Mathematical Model of Warm Drawing Process of Magnesium Alloys in Heated Dies, 2011 Conference proceedings of the Wire Association International Inc. InterWire2011. Atlanta, Georgia, USA.

Swider, M. A.; Varahram, A.; Hassel, Th.; Bach, Fr.-W.  (2011): Schweißfalttechnik, Untersuchungen und Prozessentwicklung zur Herstellung faltbarer Tragstrukturen, DVS Congress 2011. Große Schweißtechnische Tagung 2011, Studentenkongress 2011 ; Abschlusskolloquium Lichtbogenschweißen 2011 ; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Hamburg vom 27. bis 29. September 2011. Düsseldorf: DVS Media (DVS-Berichte, 275).

Varahram, A.; Bär, F.; Hassel, Th.; Overmeyer, L.; Bach, Fr.-W.  (2011): Design of Folded Tubulars for Expandable Casing Applications, Proceedings of the 16th Annual International Conference on Industrial Engineering Theory, Applications and Practice. Stuttgart. Unter Mitarbeit von IJIE

Reimche, W.; Zwoch, S.; Bruchwald, O.; Bach, Fr-W (2011): Hochtemperatur-Prüftechnik ermöglicht Einblick in die Werkstoffumwandlung und Phasenausbildung bei Hochleistungsbauteilen, In: DGZfP-Jahrestagung 2011 Zerstörungsfreie Materialprüfung. 30. Mai - 1. Juni 2011, Bremen ; Berichtsband. Berlin: DGZfP (Berichtsband / Deutsche Gesellschaft für Zerstörungsfreie Prüfung e.V, 127), S. Di3C2.

Kiliclar, Y.; Engelhardt, M.; von Senden genannt Haverkamp, H.; Schwarze, M.; Vladimirov, I.; Bormann, D.; Reese, S.; Bach, Fr.-W. (2011): Combined Quasi-Static-Dynamic Forming Processes - Material Modelling, Experimental Validation and Finite Element Technology, In: G. Hirt (Hg.): Special edition: 10th International Conference on Technology of Plasticity, ICTP 2011. [held in Aachen, Germany on September 25th - 30th, 2011]. Düsseldorf: Verl. Stahleisen GmbH (Steel research international Special edition), S. 865–870.

Jakob, H.; Petersen, M.; Hassel, Th.; Bach, Fr.-W. (2011): Entwicklung eines LSI-Brenners: Wiederentdeckung des Lichtbogen-Sauerstoff-Impuls-Schneidens, DVS-Berichte Band 275; Vorträge der Veranstaltungen im Rahmen von DVS Congress und DVS Expo in Ham-burg vom 27. bis 29. September 2011, S. 122-129

Stiesch, M.; Abraham, W.-R; Hauser, H.; Müller, P. P.; Borchers, L.; Kohorst, P.; Heuer, W.; Winkel, A.; Bach, Fr.-W.; Hübsch, C.; Pfaffenroth, C.; Dempwolf, W.; Menzel, H. (2011): Materialoptimierung und Funktionalisierung dentaler Implantat-Abutments, In: Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK) (Hg.): Spitzenforschung in der Zahnheilkunde. Innovationen und Auszeichnungen 2011. Deutsche Gesellschaft für Zahn-, Mund- und Kieferheilkunde (DGZMK). Lampertheim: ALPHA Informations-GmbH, S. 158–165.

Grittner, N.; Haverkamp, H.; Stelling, O.; Striewe, B.; Bormann, D.; Schimanski, K.; Nikolaus, M.; von Hehl, A.; Bach, Fr.-W.; Wielage, B. (Hrsg.) (2011): Verbundstrangpressen von Titan-Aluminium Verbindungen, Tagungsband zum 18. Symposium Verbundwerkstoffe und Werkstoffverbunde Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 41. Chemnitz: Eigenverl., 2011.

Diebel, M.; Hauer, J.; Reimche, W.; Bach, Fr.-W.  (2011): Quality Control of High Tension 3D-NVEB-Weld Joints, Proceedings of the International Symposion on Digital Industrial Radiology and Computed Tomography

Zaremba, D.; Biskup, C.; Heber, T.; Weckend, N.; Hufenbach, W.; Adam, F.; Bach, Fr.-W.; Hassel, T. (2011): Experimental evaluation of jetting methods for the surface preparation of fiber-reinforced plastics, 11th International Conference on Management of Innovative Technologies and 2nd International Conference on Sustainable Life in Manufacturing, Fiesa, Slovenia, 25–27 September 2011.

Beiträge in Büchern

Hübsch, C.; Hassel, Th.; Bach, Fr.-W.; Borchers, L.; Kohorst, P.; Stiesch, M.  (2011): ZrO2-Keramiken mit oberflächennahen Diffusionsschichten zur Anwendung in der dentalen Prothetik, E. Steinhauser und H.-F. Zeilhofer (Hg.): Biomaterialien (1-4, 12), S. 132.

Zeitschriften/Aufsätze

Faßmann, D.; Gershteyn, G.; Schaper, M.; Bach, Fr.-W. (2011): Präparations- und Analysestrategie zur Untersuchung verformungsinduzierter Poren in kaltverfomtem Stahl, Praktische Metallographie Vol. 48, Nr. 5, S. 232-238, 2011.

Hepke, M.; Rodman, M.; von Senden genannt Haverkamp, H.; Zilberg, J. V.; Briukhanov, A. A.; Bormann, D.; Schaper, M.; Bach, Fr.-W. (2011): Investigation of the influence of low cycle bending on the properties of thin sheets, International Aluminium Journal Vol. 87, Nr. 7-8, S. 60-62, 2011.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C.; Langohr, A. (2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnaces, International Journal of Materials Research 2011/08, pp. 964-971
DOI: 10.3139/146.110549

Schaup, J.; Möhwald, K.; Bach, Fr.-W.; Deißer, T.A.  (2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und Schneidwerkzeugen, Info-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12

Seitz, J.-M., Utermöhlen, D., Wulf, E., Klose, C.; Bach, Fr.-W. (2011): Front Cover Advanced Materials 12/2011, Advanced Engineering Materials; Vol. 13; Iss. 12; http://onlinelibrary.wiley.com/doi/10.1002/adem.201190032/abstract; doi: 10.1002/adem.201190032

Engelhardt, M.; Grittner, N.; Bormann, D.; Bach, Fr.-W. (2011): Mikrostrukturelle Pressschweißnahtcharakterisierung im strangpressten Zustand für Al-Mg-Si-Legierungen: Microstructural weld seam characterisation in the as extruded condition for Al-Mg-Si-alloys, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 531-541, 2011.

Rodman, D.; Kerber, K.; Yu, Z.; Mozgova, I.; Nürnberger, F.; Bach, Fr.-W. (2011): Orts- und temperaturabhängige Wärmeübergangskoeffizienten bei der Sprühkühlung von AlSi10Mg-Gussplatten, Forschung im Ingenieurwesen Vol. 75, Nr. 1, S. 25-34, 2011.
DOI: 10.1007/s10010-011-0131x

Rodman, D.; Krause, C.; Nürnberger, F.; Bach, Fr.-W.; Haskamp, K.; Kästner, M.; Reithmeier, E. (2011): Induction hardening of spur gearwheels made from 42CrMo4 hardening and tempering steel by employing spray cooling, Steel Research International Vol. 82, Nr. 4, S. 329-336, 2011.
DOI: 10.1002/srin.201000218

Schumacher, S.; Stahl, J.; Bäumer, W.; Seitz, J.-M.; Bach, Fr.-W.; Petersen, L. J.; Kietzmann, M. (2011): Ex vivo examination of the biocompatibility of biodegradable magnesium via microdialysis in the isolated perfused bovine udder model, Int. J. Artif. Organs Vol. 34, Nr. 1, S. 34-43, 2011.

Waltz, F.; Swider, M. A.; Hoyer, P.; Hassel, T.; Erne, M.; Möhwald, K.; Adlung, M.; Feldhoff, A.; Wickleder, C.; Bach, Fr.-W. (2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloy, Journal of Materials Science, Doi: 10.1007/s10853-011-5785-0

Seitz, J.-M.; Utermöhlen, D.; Wulf, E.; Klose, C.; Bach, Fr.-W. (2011): The manufacture of resorbable suture material from magnesium - drawning and stranding of thin wires, Advanced Engineering Materials 13, 2011, S. 1087-1095
DOI: 10.1002/adem.201100152

Belski, A.; Gastan, E.; Vahed, N.; Klose, C.; Rodman, M.; Lange, F.; Wurz, M.-C.; Bormann, D.; Rissing, L.; Behrens, B.-A.; Bach, Fr.-W. (2011): Process Principle for the Production of Sintered Dynamic Component-inherent Data Storage, Production Engineering Vol. 5, Nr. 3, S. 233-240, 2011.
DOI: 10.1007/s11740-010-0290-x

Lie, L.; Langohr, A.; Erne, M.; Möhwald, K.; Bach, Fr.-W. (2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die Druckindustrie, In: Thermal Spray Bulletin 4 (2), S. 114–120.

Tiemann, S.; Lie, L.; Holländer, U.; Möhwald, K.; Bach, Fr.-W.  (2011): Influence of reactive process gases on zinc solders on aluminium and steel, Welding and Cutting 10 (5), S. 314–317

Psyk, V.; Gershteyn, G.; Barlage, B.; Weddeling, C.; Albuja, B.; Brosius, A.; Tekkaya, A. E.; Bach, Fr.-W. (2011): Process Design for the Manufacturing of Magnetic Pulse Welded Joints, Key Engineering Materials Vol. 473, S. 243-250, 2011.
DOI: 10.4028/www.scientific.net/KEM.473.243

Diekamp, M.; Hübner, S.; Nürnberger, F.; Schaper, M.; Behrens, B.- A.; Bach, Fr.-W. (2011): Prozessoptimiertes Presshärten mittels Sprühkühlung – prozessintegrierte Wärme-behandlung von Blechen des Werkstoffes 22MnB5, In: HTM - Journal of Heat Treatment and Materials 2011 (6), S. 316–322. Online verfügbar unter http://www.htm-journal.de/HT110118

Böhm, V.; Bruchwald, O.; Reimche, W.; Bach, Fr.-W.; Odening, D.; Behrens, B.-A.  (2011): Acoustic Process Monitoring during Transient Precision Forging of High Strength Components., Metallurgical and mining industry 3 (7), S. 91–97.

Gretzki, T.; Rodman, D.; Wolf, L.; Dalinger, A.; Krause, C.; Hassel, Th.; Bach, Fr.-W.  (2011): Economic surface hardening by spray cooling, HTM - Journal of Heat Treatment and Materials 66 (5), S. 290–296.

Hassel, Th.; Lizunkova, Y.; Bach, Fr.-W.; Bataev, A.; Nikulina, A.; Teplich, A.  (2011): Structure and properties of beaded welds created under water by power wire, Obrabotka Metallov 50 (1), S. 31–37

Hepke, M.; Rodman, M.; Zilberg, J. V.; Briukhanov, A. A.; Bormann, D.; Schaper, M.; Bach, Fr.-W.  (2011): Investigation of the influence of low cycle alternating bending loads on the properties of thin sheets possessing different crystal lattice structures, Metallurgical and mining industry 3 (7), S. 69–73

Hoyer, P.; Hassel, Th.; Hübsch, C.; Birr, C.; Jendras, M.; Bach, Fr.-W.  (2011): Einsatz innovativer Fügetechnologien und korrosionsschutzgerechter Designs an 200-l-Gebinden zur sicheren Lagerung schwach- und mittelradioaktiver Abfälle, atw-International Journal for Nuclear Power 56 (10), S. 553–558

Murray, N.; Konya, R.; Beniyash, A.; Bach, Fr.-W.; Hassel, Th.  (2011): Schneiden und Schweißen von Kupfer mit dem Elektronenstrahl, Metall - Internationalle Fachzeitschrift für Metallurgie 65 (11), S. 507–511

Seitz, J.-M.; Collier, K.; Wulf, E.; Bormann, D.; Angrisani, N.; Meyer-Lindenberg, A.; Bach, Fr.-W.  (2011): The Effect of Different Sterilization Methods on the Mechanical Strength of Magnesium Based Implant Materials, Advanced Engineering Materials.
DOI: 10.1002/adem.201100074

Seitz, J.-M.; Collier, K.; Wulf, E.; Bormann, D.; Bach, Fr.-W. (2011): Comparison of the Corrosion Behavior of Coated and Uncoated Magnesium Alloys in an In Vitro Corrosion Environment, Advanced Engineering Materials
DOI: 10.1002/adem.201080144

Seitz, J.-M.; Eifler, R.; Bach, Fr.-W.  (2011): Designentwicklung für einen resorbierbaren Magnesiumstent für die Nasennebenhöhlen, Biomaterialien 12 (1-4), S. 183

Waltz, F.; Swider, M. A.; Hassel, Th.; Behrens, P.; Bach, Fr.-W.  (2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, Uni Magazin (01|02 2011), S. 48–51

Waltz, F.; Swider, M. A.; Hassel, Th.; Behrens, P.; Bach, Fr.-W.  (2011): Nanokristallines Magnesiumfluorid - Ein Hightech-Korrosionsschutz für Magnesium, AlumniCampus (6), S. 32–35

Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Bretschneider, M.; Kästner, M.; Reithmeier, E. (2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structures, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.

Grittner, N.; Engelhardt, M.; Hepke, M.; Bormann, D.; Behrens, B.-A.; Bach, Fr.-W. (2011): Modification of the mechanical anisotropy in extrudet AZ31 sheets, Key Engineering Materials Vol. 473, S. 490-497, 2011.

Hufenbach, W.; Adam, F.; Heber, T.; Weckend, N.; Bach, Fr.-W.; Hassel, T.; Zaremba, D. (2011): Novel Repair Concept for Composite Materials by Repetitive Geometrical Interlock Elements, Materials 2011, 4; pp. 2219-2230.

Klose, Ch.; Mroz, G.; Rodman, M.; Kujat, B.; Bormann, D.; Reimche, W.; Bach, Fr.-W. (2011): Magnetic Magnesium Alloys based on MgZn and SmCo with Sensory Properties, Advanced Engineering Materials, 13, S. 1-7
DOI: 10.1002/adem.201100197

Patentschriften

Reimche, W.; Mroz, G.; Bach, Fr.-W. (2011): Bauteil-Verfahren zum Einbringen von Informationen in ein Bauteil und Verfahren zum Ermitteln einer Belastungshistorie eines Bauteils, Veröff.-Nr.: WO/2011/066816; Internationale Veröffentlichungsnummer: PCT/DE2010/001336

Bach, Fr.-W; Haverich, A.; Cebotari, S.; Biskup, C.; Schuster, B. (2011): Supporting element for tissue implants, Patentanmeldung WO 2011/101142 A1, Gottfried Wilhelm Leibniz Universität Hannover, Medizinische Hochschule Hannover

Bach, Fr.-W.; Hassel, T.; Pletsch, N.;Nietzold, A.; Kühne, U. (2011): Verfahren zur Reparatur einer Glocke, Veröffentlichungs-Nummer: DE102010019120A1

Bach, Fr.-W.; Haverich, A.; Cebotari, S.; Biskup, C.; Schuster, B. (2011): Stützelement für Gewebeimplantate, Veröffentlichungs-Nummer: DE102010008357A1

Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.; Lenarz, T.; Schwab, B.; Kramer, S.; Kietzmann, M (2011): Stent and Method for Production Thereof, Angemeldet durch Wilhelm Leibniz Universität Hannover, Medizinische Hochschule Hannover, Stiftung Tierärztliche Hochschule Hannover. Veröffentlichungsnr: PCT/EP2011/004472.

Bach, Fr.-W.; Beniyash, A.; Hassel, T.; Konya, R.; Murray, N.; Ruchay, W. (2011): Verfahren und Vorrichtung zum thermischen Bearbeiten von Werkstoffen mit einem Elektronenstrahl und Gas , Veröffentlichungs-Nummer EP000002322309A1

Bach, Fr.-W.; Hassel, T.; Bierbaum, M.; Krink, V. (2011): Verfahren zur Bestimmung des Abstands zwischen einer autogenen Brennereinrichtung und einem Werkstück durch Erfassung einer Kerngrösse ohne eine eigene elektrische Energieversorgung

Menneking, C.; Bormann, D.; Behrens, P.; Bach, Fr.-W. (2011): Bioresorbierbares Material, Veröffentlichungs-Nummer EP000002268325A2

Menneking, C.; Bormann, D.Behrens, P.; Bach, Fr.-W. (2011): Bioresorbable Material, Veröffentlichungs-Nummer US020110034926A1

Bach, Fr.-W.; Haverich, A.; Cebotari, S.; Biskup, C.; Schuster, B. (2011): Stützelemente für Gewebeimplantate, Veröffentlichungs-Nummer WO002011101142A1

Vortrag

Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011): Schichttransplantation - Prozessintegrierte Beschichtung von Druckgussteilen, Werkstoff Forum - Intelligenter Leichtbau. Hannover Messe 2011

Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011): Transplantierte Funktionsschichten auf Druckgussteilen, Materials Café,. Hannover Messe 2011

Klöpfer, E.; Springub, B.; Masimov, M.; Gershteyn, G.; Nürnberger, F.; Bach, Fr.-W. (2011): Investigation of the HSD®-Steel with a modified concentration of the aluminum content, Euromat 2011. Montpellier, Frankreich, 12.-15. September. Online verfügbar unter http://euromat2011.fems.eu/wp-content/uploads/2011/09/2011-09-05_program_complete_4days.pdf.

Varahram, A.; Srisupattarawanit, T.; Breidenstein, B.; Hassel, Th.; Schiefer, F.; Denkena, B.; Ostermeyer, G.-P.; Bach, Fr.-W. (2011): Design of Folded Tubulars for Expandable Casing Applications, Celle Drilling 2011, 13.09.2011, Celle

2010

Konferenz

Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2010): Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen, GfKorr-Tagung. Dresden, 28.04.2010.

Bach, Fr.-W.; Schaper, M.; Yu, Z.; Nürnberger, F.; Gretzki, T.; Rodman, D.; Springer, R. (2010): Computation of the Isothermal Transformation Diagrams of 42CrMo4 Steel from Dilatometer Measurements with Continuous Cooling, {Conf. Proc.}. Shanghai, China, 31.03.-02.06. 2010.

Reimche, W.; Klümper-Westkamp, H.; Vetterlein, J.; Zwoch, S.; Bach, Fr.-W. (2010): Sensorkontrolliertes Bainitisieren zur Prozesssteuerung und Qualitätssicherung in der Wärmebehandlung , 83. Tagung des Wissenschaftlichen Rates der AiF. Berlin-Adlershof, 09.11.2010.

Hinte, N.; Biskup, C.; Hassel, T.; Schilling, T.; Meyer, T.; Cebotari, S.; Tudorache, I.; Haverich, A.; Bach, Fr.-W. (2010): In-vitro Testung von Stützstrukturen zur Stabilisation von xenogenen Aortenprothesen im kardiovaskulären Hochdruckberech, Jahrestagung der deutschen Gesellschaft für Biomaterialien (DGBM), Heilbad Heiligenstadt, November 2010

Schilling, T.; Brandes, G.; Cebotari, S.; Tudorache, I.; Hilfiker, A.; Meyer, T.; Biskup, C.; Hinte, N.; Hassel, T.; Bach, Fr.-W.; Haverich, A. (2010): Biokompabilität von Magnesiumgittern zur Unterstützung von regenerativen Therapien in der kardiovaskulären Chirugie, 44. Jahrestag der DGBMT, BMT 2010, Rostock Supplement zur Biomedizinische Technik / Biomedical Engineering, De Gruyter Verlag ISSN 0939-4990

Bach, Fr.-W.; Hassel, T.; Biskup, C.; Hinte, N.; Schenk, A. (2010): In-process generation of water ice particles for cutting and cleaning purposes, 20th International Conference on Water Jetting, Graz, Austria, 20.-22. Oktober 2010, S. 275-283

Schilling, T.; Cebotari, S.; Tudorache, I.; Hilfiker, A.; Meyer, T.; Biskup, C.; Bormann, D.; Bach, Fr.-W.; Haverich, A. (2010): Stabilizing autologus intestine vascularized cardiac patch material by magnesium alloys, 39th Annual Meeting German Society for Thoracic and Cardiovascular Surgey 2010, 14.-17. February 2010

Varahram, A.; Srisupattarawanit, T.; Hassel, T.; Schiefer, F.; Bach, Fr.-W.; Ostermeyer, G.-P. (2010): Konstruktion gefaltete und aufweitbare Rohre zur Bohrlochauskleidung, 3. Nano und Material Symposium Niedersachsen. gebo Forschungsverbund Geothermie und Hochleistungsbohrtechnik. Celle, 07.10.2010.

Mozgova, I.; Brückner, H.-P.; Bach, Fr.-W; Blume, H.; Hassel, T.; Kussike, S.-M.; Bierbaum, M.; Büggenam, P.; Piszczek, M. (2010): Development of a Therapeutic Device Supporting Real-Time Dynamic Verical Force Unload, 55. IWK - Internationales Wissenschaftliches Kolloquium, 2010, S. 468-479

Bormann, D.; Haverkamp, H.; Engelhardt, M.; Mroz, G.; Reimche, W.; Plorin, T.; Grittner, N.; Bach, Fr.-W.; {et al.} (2010): Arbeiten des Institutes für Werkstoffkunde auf dem Gebiet der MMCD., Sitzung des DGM-Fachausschusses "Metallische Verbundwerkstoffe". Karlsruhe, 10.11.2010.

Bach, Fr.-W.; Möhwald, K.; Zhang, I.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2010): Prozesskettenverkürzte Fertigung von Leichtmetall-Druckgussverbundbauteilen durch Transplantation thermisch gespritzter Schichten, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 110-120. Chemnitz: Eigenverl., 2010.

Kerber, K.; Bach, Fr.-W. (2010): Eigenschaften der Werkstoffverbunde durch Druckguss hergestellter Verbundgussteile aus Aluminium und Magnesium, In: Tagungsband zum Symposium Verbundwerkstoffe und Werkstoffverbunde (18. Symposium Verbundwerkstoffe und Werkstoffverbunde), S. 422–432

Reimche, W.; Bach, Fr.-W. (2010): Zerstörungsfreie Charakterisierung von Schicht- und Bauteilzuständen , 4. Internes Repair Kolloquium. München, 28.-29.01.2010.

Biskup, C.; Hassel, T.; Klose, C.; Bach, Fr.-W. (2010): AWIJ Cutting of cortical bone screws, 20th International Conference on Water Jetting. Graz, Austria 20th – 22nd October 2010, S. 201-212

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2010): Hartlöten von Edelstahl im Schutzgasdurchlaufofen mit modifizierten Ni-Hartloten, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 266-271. Düsseldorf: DVS Media, 2010.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2010): Fügen von Aluminium-Stahl-Hybridwerkstoffen mit zinkhaltigen Loten unter Einsatz reaktiver Gaszusätze im Schutzgasofen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 318-324. Chemnitz: Eigenverl., 2010.

Milenin, A.; Piotr, K.; Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.; The Wire Association International, I. (Hrsg.) (2010): Production of thin wires of magnesium alloys for surgical applications, 2010 Conference Proceedings of The Wire Association, Inc, S. 61-70, 2010.

Bach, Fr.-W.; Möhwald, K.; Nicolaus, M. (2010): Neue Lösungswege für das Reparaturlöten und -beschichten von Turbinenschaufeln: Machining Innovations Conference Tagungsband 23. und 24. November 2010 Hannover, Neue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 435-447. Garbsen: PZH Produktionstechn. Zentrum, 2010.

Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C. (2010): Entwicklung einer Fertigungstechnik für Metall-Kapillardruckgießprozesse, Maschinen-, Werkzeug- und Prozessentwicklung für neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, S. 3-8. Erlangen-Tennenlohe: Lehrstuhl für Kunststofftechnik Univ. Erlangen-Nürnberg, 2010.

Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Xin, L.; Schein, J.; Forster, G.; Hartz-Behrend, K.; Zimmermann, S.; Marques, J.-L.; Kirner, S.; Bobzin, K.; Bagcivan, N.; Petkovic, I. (2010): Homogenization of Coating Properties in Atmospheric Plasma Spraying - Current Results of a DFG (German Research Foundation)-Funded Research Group, Thermal spray: global solutions for future application DVS-Berichte Vol. 264. Düsseldorf: DVS Media, 2010.

Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C.; Wielage, B. (Hrsg.) (2010): Metall-Kapillardruckgießen - Gießen im Mikrometermaßstab, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 307-312. Chemnitz: Eigenverl., 2010.

Bach, Fr.-W.; Möhwald, K.; Hartz-Behrend, K.; Prehm, J.  (2010): Qualitative Vorausberechnungen der Benetzungsvorgänge beim Löten mittels Methoden der klassischen Molekulardynamik (MD), Hart- und Hochtemperaturlöten und Diffusionsschweißen. LÖT 2010 ; Vorträge und Posterbeiträge des 9. internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2010 & Brazing, high temperature brazing and diffusion bonding. Löt; Deutscher Verband für Schweißen und Verwandte Verfahren. Düsseldorf: DVS Media (DVS-Berichte, 263), S. 248–254.

Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Neumann, M. (2010): Beitrag zum Auftraglöten und -schweißen von Panzerungen mit hoher Verschleißreserve, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 55-63. Düsseldorf: DVS Media, 2010.

Bach, Fr.-W.; Bormann, D.; Meyer-Lindenberg, A.; Wriggers, P.; Seitz, J.-M.; Biermann, D. (Hrsg.) ; Tekkaya, A. E. (Hrsg.) ; Tillmann, W. (Hrsg.) (2010): Production of Magnesium Implants with Adapted Properties, Product Property Prediction, S. 93-99. Dortmund, 2010.

Reimche, W.; Bach, Fr.-W.; Denkena, B. (Hrsg.) (2010): Gentelligente Bauteilidentifikation und Integritätsbewertung, Genetik und Intelligenz, S. 11. Garbsen: PZH Produktionstechn. Zentrum, 2010.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010): Niedrig schmelzende Aluminiumhartlote aus dem System AlSiZn, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 117-121. Düsseldorf: DVS Media, 2010.

Yu, Z.; Nürnberger, F.; Gretzki, T.; Schaper, M.; Bach, Fr.-W.; CADFEM (Hrsg.) (2010): Simulation der Eigenspannungsentwicklung beim Abschrecken von Ritzelwellen aus 42CrMo4 mittels Spraykühlung, ANSYS Conference & 28th CADFEM Users' Meeting 2010, 2010.

Engelhardt, M.; Haverkamp, H.; Kiliclar, Y.; Schwarze, M.; Vladimirov, I.; Bormann, D.; Bach, Fr.-W.; Reese, S.; Daehn, G. (Hrsg.) ; Zhang, Y. (Hrsg.) ; Babusci, K. (Hrsg.) ; Weddeling, C. (Hrsg.) ; Marre, M. (Hrsg.) ; Tekkaya, A. E. (Hrsg.) (2010): Characterization and Simulation of High-Speed-Deformation-Processes, ICHSF 2010, S. 229-238. Columbus, Ohio, USA, März 2010.

Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Wielage, B.; Wielage, B. (Hrsg.) (2010): Berührungslose Geometrieprüfung endbearbeiteter Bauteile mit optisch nicht kooperativen Oberflächen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 313-317. Chemnitz: Eigenverl., 2010.

Turichin, G.; Valdaytseva, E.; Bach, Fr.-W.; Beniyash, A.; Korablev, V. V. (Hrsg.) (2010): Dynamic processes at high speed laser and electron beam treatment of materials, Results of joint research activity of scientists from Saint-Petersburg State Polytechnical University and Leibniz University of Hannover., S. 91-101. Saint-Petersburg: Polytechn. Univ. Publ. House, 2010.

Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Gu, Z.-H. (Hrsg.) (2010): Mechanical Surface Treatment to Obtain Optically Cooperative Surfaces vis-à-vis Fringe Projection, Reflection, scattering, and diffraction from surfaces II Proceedings of SPIE Vol. 7792, S. 77920V-77920V-9. Bellingham, Wash.: SPIE, 2010.

Dellinger, P.; Bach, Fr.-W.; Möhwald, K.; Wielage, B. (Hrsg.) (2010): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 86-91. Chemnitz: Eigenverl., 2010.

Schnick, M.; Füssel, U.; Hertel, M.; Schuster; Krink, V.; Petersen, M.; Hassel, T.; Bach, Fr.-W.; Ko{o}cak, M. (Hrsg.) (2010): Plasma keyhole welding of mild steel plates for ship yard productions, Istanbul IIW 2010, S. 479-483. Istanbul: GEV, 2010.

Bormann, D.; Bach, Fr.-W.; Klose, C.; Rodman, M.; Reimche, W.; Mroz, G.; Behrens, B.-A.; Weilandt, K.; Jocker, J. (2010): Werkstoffe mit sensorischen Eigenschaften für optimierte Wartungsintervalle, Neue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 478-486. Garbsen: PZH Produktionstechn. Zentrum, 2010.

Hassel, T.; Petersen, M.; Bach, Fr.-W. (2010): Sonderlösungen zum thermischen Trennen im Bereich des Rückbaus kerntechnischer Anlagen, 4. Symposium "Stilllegung und Rückbau kerntechnischer Anlagen". Hannover, 02.11.2010.

Bücher

Bach, Fr.-W. (Hg.)  (2010): "Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme". Vortragsband zum Kolloquium des Graduiertenkolleg 1378/1., LWT, TU Dortmund. Unter Mitarbeit von W. Tillmann, T. Plorin und B. Rüther. Garbsen: PZH Produktionstechnisches Zentrum. Online verfügbar unter http://www.gbv.de/dms/tib-ub-hannover/626868181.pdf.

Beiträge in Büchern

Haverich, A.; Bach, Fr.-W.; Hassel, T.; Schilling, T.; Cebotari, S.; Tudorache, I.; Hinte, N.; Biskup, C.; Hilfiker, A. (2010): Stabilisierende Magnesiumstrukturen zur Unterstützung von kardiovaskulärem Gewebeersatz im Hochdrucksystem, Zukunftsfähige bioresorbierbare und permanente Implantate aus metallischen und keramischen Werkstoffen, Sonderforschungsbereich SFB 599, Druckerei der Medizinischen Hochschule Hannover, November 2010

Hassel, Th.; Lizunkova, Y.; Wolyniec, A.; Bach, Fr.-W.  (2010): Entwicklung und Herstellung von selbstschützenden Doppelmantel-Fülldrahtelektroden zum kontinuierlichen Unterwasserschweißen, DVS (Hg.): DVS - Jahrbuch Schweißtechnik 2011: DVS-Verl., Verl. für Schweißen und Verwandte Verfahren, S. 183–191.

Verschiedenes

Kramer, S.; Götz, F.; Seitz, J.-M.; Bach, Fr.-W.; Lenarz, T.; Schwab, B.; Deutsche Gesellschaft für Hals-Nasen-Ohren-Heilkunde, K.-u. H.-C. e. V. (Hrsg.) (2010): Tribrid-Stenting - eine neue operative Methode zur Erweiterung und Offenhaltung der Nasennebenhöhlen, Hg. v. Kopf-und Hals-Chirurgie e. V. Deutsche Gesellschaft für Hals-Nasen-Ohren-Heilkunde. Wiesbaden, zuletzt aktualisiert am 22.04.2010.

Badar, M.; Rittershaus, D.; Seitz, J.-M.; Bormann, D.; Bach, Fr.-W.; Hauser, H.; Meyer-Lindenberg, A.; Müller, P. P. (2010): In vitro und in vivo Modelle zur molekularen Evaluierung der zellulären Reaktionen auf Magnesium, Biomedizinische Technik / Biomedical Engineering 55, S. 19-21. Berlin: Walter de Gruyter, 2010.

Seitz, J.-M.; Freytag, P.; Bach, Fr.-W. (2010): Strangpress-Matrize und Verfahren zum Strangpressen von Magnesiumwerkstoffen, , 29.01.2010.

Seitz, J.-M.; Bach, Fr.-W.; Bormann, D.; Lenarz, T.; Schwab, B.; Kramer, S.; Kietzmann, M. (2010): Herstellungsverfahren für einen Mukosastent, , 06.05.2010.

Berichte

Behrens, B.-A.; Pielka, T.; Bach, Fr.-W.; Schaup, J. (2010): Erhöhung der Verschleißfestigkeit von Schneidstempeln durch partielle Integration von Hartmetall- und Keramiksegmenten mittels stoffschlüssigem Fügen: Ergebnisse eines Vorhabens der industriellen Gemeinschaftsforschung (IGF), EFB-Forschungsbericht, Nr. 308. Hannover: EFB, 2010.

Zeitschriften/Aufsätze

Klümper-Westkamp, H.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2010): Kontrolliertes Bainitisieren trumpft in puncto Wirtschaftlichkeit auf, Maschinenmarkt, Nr. 24, S. 58-61, 2010.

Gershteyn, G.; Nowak, M.; Schaper, M.; Bach, Fr.-W. (2010): Untersuchung der mikrostrukturellen Werkstoffcharakteristik des Stahls DC06 bei der plastischen Umformung: Analysis on the micro structural material characteristic of the DC06 steel by the plastic deformation, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 10, S. 844-852, 2010.

Gershteyn, G.; Golosova, T.; Schaper, M.; Gerstein, D.; Lychagin, D.; Bach, Fr.-W. (2010): The Possible Mechanism of Slip Band Formation, Sistemnye Technologii Vol. 70, Nr. 5, S. 162-166, 2010.

Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying process, Materialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.

Erne, M.; Kolar, D.; Bach, Fr.-W.; Möhwald, K. (2010): Suspension Plasma Spraying of triboactive coatings for high temperature applications, Key Engineering Materials, Nr. 438, S. 139-146, 2010.

Hepke, M.; Rodman, M.; Bormann, D.; Bach, Fr.-W.; Zilberg, J. (2010): Einfluss einer alternierenden Biegebeanspruchung auf die mechanischen Eigenschaften der Magnesiumlegierung AZ31, Aluminium, Nr. 5, S. 55-58, 2010.

Klümper-Westkamp, H.; Zoch, H.-W.; Reimche, W.; Zwoch, S.; Bach, Fr.-W. (2010): Wirtschaftlich Bainitisieren mit neuem Wirbelstrom-Messsystem, Gaswärme International Vol. 59, Nr. 6, S. 472, 2010.

Grittner, N.; Bormann, D.; Springer, R.; Reimche, W.; Bach, Fr.-W. (2010): Zerstörungsfreie Messmethoden zur Bestimmung des Warmauslagerungszustandes von Aluminiumlegierungen am Beispiel der Legierung EN AW-6082, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 8, S. 646-651, 2010.

Seitz, J.-M.; Wulf, E.; Freytag, P.; Bormann, D.; Bach, Fr.-W. (2010): The Manufacture of Resorbable Suture Material from Magnesium, Advanced Engineering Materials Vol. 12, Nr. 11, S. 1099-1105, 2010.

Diebel, M.; Mroz, G.; Frackowiak, W.; Hauer, J.; Reimche, W.; Bach, Fr.-W. (2010): Setting of Gradient Material Properties and Quality Control of High Tension 3D NVEB-Weld Joints, Advanced Materials Research, Nr. 137, S. 375-411, 2010.

Seitz, J.-M.; Bach, Fr.-W. (2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, AlumniCampus, Nr. 4, S. 44-46, 2010.

Seitz, J.-M.; Bach, Fr.-W. (2010): Schwer auf Draht : Selbstauflösende Magnesiumdrähte in der Biomedizintechnik, Unimagazin, Nr. 1, S. 48-50, 2010.

Bach, Fr.-W.; Schaper, M.; Yu, Z.; Nürnberger, F.; Gretzki, T.; Rodman, D.; Springer, R. (2010): Computation of isothermal transformation diagrams of 42CrMo4 steel from dilatometer measurements with continuous cooling., International Heat Treatment and Surface Engineering Vol. 4, Nr. 4, S. 171-175, 2010.

Rosen, S.; Varahram, A.; Möhring, H. C.; Hassel, T.; Denkena, B.; Bach, Fr.-W. (2010): Der Forschungsverbund "Geothermie und Hochleistungsbohrtechnik", Geothermische Energie - Mitteilungsblatt des GtV-Bundesverbandes Geothermie e.V. Vol. 19, Nr. 68, S. 21-23, 2010.

Wulf, E.; Seitz, J.-M.; Bormann, D.; Becker, J.-A.; Feldhoff, A.; Möhwald, K.; Bach, Fr.-W. (2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen Diamanten, Schweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.

Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Reithmeier, E.; Kästner, M.; Abo-Namous, O. (2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfaces, Key Engineering Materials, Nr. 438, S. 123-129, 2010.

Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus Leichtmetalllegierungen, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.

Wu, K. H.; Gastan, E.; Rodman, M.; Behrens, B.-A.; Bach, Fr.-W.; Gatzen, H.-H. (2010): Development and application of magnetic magnesium for data storage in gentelligent products, Journal of Magnetism and Magnetic Materials Vol. 322, Nr. 9-12, S. 1134-1136, 2010.

Borchers, L.; Stiesch, M.; Bach, Fr.-W.; Buhl, J.-C.; Hübsch, C.; Jendras, M.; Keller, T.; Kohorst, P. (2010): Influence of hydrothermal and mechanical conditions on the strength of zirconia, Acta Biomaterialia Vol. 2010, Nr. 6, S. 4547-4552, 2010.

Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010): Keramikinlays für Schneidstempel, Bleche Rohre Profile, Nr. 10, S. 16-17, 2010.

Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-Schneidstempelinlays, UTF science, Nr. III, S. 1-12, 2010.

Plorin, T.; Bormann, D.; Heidenblut, T.; Bach, Fr.-W. (2010): Investigations into manufacturing composite profiles having local magnesium-foam reinforcements, Advanced Materials Research, Nr. 137, S. 129-160, 2010.

Nürnberger, F.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; Koszurkiewicz, B.; Milenin, A. (2010): Microstructure transformations in tempering steels during continuous cooling from hot forging temperatures, Steel Research Vol. 81, Nr. 3, S. 224-233, 2010.

Drynda, A.; Hassel, Th.; Hoehn, R.; Perz, A.; Bach, Fr.-W.; Peuster, M.  (2010): Development and biocompatibility of a novel corrodible fluoride-coated magnesium-calcium alloy with improved degradation kinetics and adequate mechanical properties for cardiovascular applications., Journal of Biomedical Materials Research Part A 93A (2), S. 763–775.

Krause, A.; v. d. Höh, N.; Bormann, D.; Krause, C.; Bach, Fr.-W.; Windhagen, H.; Meyer-Lindenberg, A.  (2010): Degradation behaviour and mechanical properties of magnesium implants in rabbit tibiae., Journal of Materials Science (45), S. 624–632.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn, Schweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnaces, Key Engineering Materials, Nr. 438, S. 73-80, 2010.

Krause, C.; Springer, R.; Biasutti, F.; Gershteyn, G.; Bach, Fr.-W. (2010): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach einer induktiven Hochgeschwindigkeitsaustenitisierung mit anschließendem Abschrecken, Journal of Heat Treatment and Materials Vol. 65, Nr. 2, S. 96-101, 2010.

Hassel, T.; Birr, C.; Bach, Fr.-W. (2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, Key Engineering Materials Vol. 2010, Nr. 438, S. 147-154, 2010.

Bach, Fr.-W.; Bormann, D.; Rodman, M.; Haverkamp, H. (2010): Friction and Temperature Development in the Hot Roll Cladding Process, Steel Research International Vol. 81, Nr. 1, S. 48-54, 2010.

Hassel, T.; Birr, C.; Bach, Fr.-W. (2010): Surface zone modification by atmospheric plasma-nitriding (APN) with the aid of the transmitted plasma-arc, In: Key Engineering Materials 438, S. 147–154.

Grydin, O.; Ogins'kyy, Y.; Danchenko, O.; Bach, Fr.-W. (2010): Experimental twin-roll casting equipment for production of thin strips, Metallurgical and Mining Industry. Vol. 2, Nr. 5, S. 348-354, 2010.

Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Galvanotechnik, Nr. 11, S. 2646-2650, 2010.

Demling., A.; Elter, C.; Heidenblut, T.; Bach, Fr.-W.; Hahn, A.; Schwestka-Polly, R.; Stiesch, M.; Heuer, W. (2010): Reduction of biofilm on orthodontic brackets by use of a polytetrafluorethylene (PTFE) coating, European Journal of Orthodontics, Nr. 32, S. 414-418, 2010.

Kirner, S.; Hartz-Behrend, K.; Forster, G.; Marques, J.-L.; Schein, J.; Erne, M.; Prehm, J.; Möhwald, K.; Bach, Fr.-W. (2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels Tomographie, Thermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.

Patentschriften

Bach, Fr.-W.; Haverich, A.; Cebotari, S.; Biskup, C.; Schuster, B. (2010): Stützelement für Gewebeimplantate, Patentanmeldung DE 10 2010 008 357.7-45, Gottfried Wilhelm Leibniz Universität Hannover, Medizinische Hochschule Hannover

Seitz, J.-M.; Freytag, P.; Bach, Fr.-W. (2010): Strangpress-Matrize und Verfahren zum Strangpressen von Magnesiumwerkstoffen, Angemeldet durch Gottfried Wilhelm Leibniz Universität Hannover am 29.01.2010. Anmeldenr: DE102010006387.8

Bach, Fr.-W.; Bierbaum, M.; Hassel, T. (2010): Betätigungseinrichtung zur mehrachsigen räumlichen Positionierung eines Hilfsmittels und Verfahren zur Steuerung einer Betätigungseinrichtung, Veröffentlichungs-Nummer: DE102010006617A1

Kerber, K.; Bach, Fr.-W.; Schaper, M. (2010): Verfahren zur Herstellung eines Gussteils , Veröffentlichungs-Nummer DE102007062436B4

Bach, Fr.-W.; Bierbaum, M.; Krause, C. (2010): Verfahren und Vorrichtung zum Stimulieren von Zellen, Veröffentlichungs-Nummer: WO002010063265A2

Klotz J.; Bach Fr.-W.  (2010): Ein Bohrverfahren, eine für chirugische Zwecke bestimmte Bohrmaschine mit einem Aufsatz sowie ein Aufsatz für eine für chirugische Zwecke bestimmte Bohrmaschine, Veröffentlichungs-Nummer: WO002010066221A1

Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2010): Verfahren zur Herstellung eines Elements aus einem Magnesiumwerkstoff und so hergestelltes Element, Veröffentlichungs-Nummer EP000002225054A1

Wirth, C.-J.; Windhagen, H.; Witte, F.; Bach, Fr.-W. ; Kaese, V. (2010): Medizinische Implantate, Prothesen, Prothesenteile, medizinische Instrumente, Geräte und Hilfsmittel aus einem Halogenid-modifizierten Magnesiumwerkstoff, Veröffentlichungs-Nummer EP000001458426B1

Vortrag

Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2010): Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen, Workshop Korrosion und Korrosionsschutz von Magnesium. Lauenburg, 13.10.2010.

Hassel, T.; Petersen, M.; Jakob, H.; Bach, Fr.-W. (2010): "INNO-CUT" - Innovative Lichtbogenverfahren für die Stilllegung und den Rückbau kerntechnischer Anlagen Hot-Wire-Plasmaschneiden und Lichtbogen-Sauerstoff-Impulsschneiden, Stilllegungstechniken. BMBF. Greifswald, 01.06.2010.

Freytag, P.; Kerber, K.; Otten, M.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010): Funktionsintegrierte Druckgussteile durch Verbundguss, Clausthaler Metallurgie-Kolloquium, 2010.

Reimche, W.; Bach, Fr.-W. (2010): Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren, . Dortmund, 11.11.2010.

Hassel, T.; Jakob, H.; Bach, Fr.-W. (2010): Trockeneisstrahlverfahren - Möglichkeiten der Leistungssteigerung und Strahlprozessüberwachung, "Stilllegungstechniken". KTG-AG. Würgassen, 16.11.2010.

2009

Menneking C.; Bormann D.; Behrens P.; Bach Fr.-W. (2009): Bioresorbierbares Material, Veröffentlichungs-Nummer: WO002009127423A2

Konferenz

Plorin, T.; Bormann, D.; Bach, Fr.-W. (2009): Manufacture and characterization of magnesium foams for ultra-lightweight applications, Proceedings Materials Science and Technology (MS&T), S. 2366-2374. Red Hook, NY: Curran, Oktober 2009.

Bach, Fr.-W.; Petersen, M.; Zwoch, S.; Reimche, W.; Hassel, T. (2009): Hochleistungsplasmaschweißen im Schiffbau: 10. Fachtagung "Schweißen im Schiffbau und Ingenieurbau", Schweißen im Schiffbau und Ingenierbau. 10. Sondertagung 22. und 23. April 2009 in Hamburg, S. 105–113

Hoyer, P.; Bach, Fr.-W.; Denkena, B.; Biermann, D. (2009): Form-, Oberflächen- und Randzoneneinfluss auf das Korrosionsverhalten und die mechanischen Eigenschaften von Magnesiumlegierungen, GfKorr-Tagung. Ottobrunn, 22.04.2009.

Bormann, D.; Rodman, M.; Klose, C.; Kerber, K.; Reimche, W.; Wurz, M. C.; Bach, Fr.-W. (2009): Soft and Hardmagnetic Magnesium Materials as Components of Structural Elements, Kainer, K. U. (Hrsg.): Magnesium; 8th International Conference on Magnesium Alloys and their Applications, S. 27-32. Weinheim: Wiley-VCH, 2009.

Klose, C.; Angrisani, G. L.; Bormann, D.; Bach, Fr.-W. (2009): Vibration Treatment for Microstructural Grain Refinement of Magnesium Alloys using the Low Pressure Die Casting Process, 8th International Conference on Magnesium Alloys and their Applications, S. 275-281. Weinheim: Wiley-VCH, 2009.

Jendras, M.; Bach, Fr.-W.; Springer, R.; Gershteyn, G.; Hübsch, C.; Bührig-Polaczek, A. (Hrsg.) (2009): Beobachtung der hydrothermalen Alterung von ZrO2 Keramiken mittels mikroskopischer und röntgenographischer Verfahren, Fortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 219-225. Frankfurt: Werkstoff-Informationsges., 2009.

Bach, Fr.-W.; Rodman, M.; Hepke, M.; Bormann, D.; Kainer, K. U. (Hrsg.) (2009): Investigation of the Mechanical Properties of Magnesium Alloy AZ31 Sheets due to a Straightening Process, 8th International Conference on Magnesium Alloys and their Applications, S. 830-835. Weinheim: Wiley-VCH, 2009.

Biskup, C.; Hepke, M.; Grittner, N.; Plorin, T.; Hassel, T.; Bormann, D.; Schilling, T.; Hilfiker, A.; Cebotari, S.; Tudorache, I.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2009): AWIJ of cutting structures made of magnesium alloys for the cardiovascular surgey, American WJTA Conference and Expo 2009, Houston, USA, 18.-20. August 2009, paper 1A

Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Hartz, K.; Schein, J.; Forster, G.; Zimmermann, S.; Marques, J.-L.; Bobzin, K.; Bagcivan, N.; Parkot, D.; Petkovic, I.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009): Homogenization of Coating Properties in Atmospheric Plasma Spraying - New Results of a DFG (German Research Foundation)-Funded Research Group, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 762-767, 2009.

Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Wielage, B. (Hrsg.) (2009): Löten von hochlegierten Stählen, Nickel- und Titanlegierungen unter Ausbildung stängelkristallitverstärkter Lötnähte, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 403-409. Chemnitz: Eigenverlag, 2009.

Reimche, W.; Zwoch, S.; Diebel, M.; Bach, Fr.-W. (2009): Entwicklung einer Wirbelstromtechnik zur Nullspaltfindung und Prozessführung von Hochleistungs-Strahl-Schweißverfahren, DGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 881-891. Münster, 2009.

Besdo, S.; Biskup, C.; Klodmann, J.; Jacob, H. G.; Glasmacher, B.; Bach, Fr.-W. (2009): Simulation of the fixation of a cruciate ligament reconstruction with interference srews, Proceedings of the XXXVI European Society for Artificial Organs (ESAO) Congress, 2.-5. September 2009, Compiègne, France

Reimche, W.; Zwoch, S.; Klotz, J.; Bach, Fr.-W. (2009): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, DGZfP-Jahrestagung 2009 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung", S. 984-995. Münster, 2009.

Reimche, W.; Diebel, M.; Mroz, G.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2009): Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen, 7. Industriekolloquium "Potenziale metallischer Werkstoffe lokal nutzen", S. 93-107. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2009.

Kujat, B.; Bormann, D.; Günther; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): Grain Refinement of AZ91 with Hexagonal Boron Nitride, 8th International Conference on Magnesium Alloys and their Applications, S. 302-307. Weinheim: Wiley-VCH, 2009.

Behrens, B.-A.; Bach, Fr.-W.; Puchert, A.; Pfahl, A.; Rudskoj, A. I. (Hrsg.) (2009): Increasing the Wear Resistance of Hot Working Tool Steel by Lowering the Eutectoid Temperature, Sovremennye metalliceskie materialy i technologii, S. 46-56. Sankt-Peterburg: Izdat. Politechn. Univ., 2009.

Kerber, K.; Bormann, D.; Möhwald, K.; Holländer, U.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): Compound Casting of Aluminium and Magnesium-Alloy by High Pressure Die Casting, 8th International Conference on Magnesium Alloys and their Applications, S. 390-397. Weinheim: Wiley-VCH, 2009.

Biskup, C.; Hepke, M.; Grittner, N.; Hassel, T.; Bormann, D.; Hoyer, P.; Schilling, T.; Hilfiker, A.; Cebotari, S.; Tudorache, I.; Meyer, T.; Haverich, A.; Bach, Fr.-W. (2009): Testing of Stabilizing Structures Made of Magensium Alloys for the Cardiovascular Surgery, 8th International Conference on Magnesium Alloys and their Applications, S. 1149-1155., Weimar, Germany, 26.-29. October 2009

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D.; Uhlenwinkel, V. (Hrsg.) (2009): Achieving Thin Functional Coatings by Mixing of Nanosized Feedstock Powders in the Suspension Plasma Spraying Process, Proceedings of the 4´th International conference on Spray Deposit in and Melt Atomization, 2009.

Krause, C.; Springer, R.; Biasutti, F.; Gershteyn, G.; Bach, Fr.-W.; {Arbeitsgemeinschaft Wärmebeh(Hrsg.) ;lung und Werkstofftechnik e.V.} (Hrsg.) (2009): Mikrostrukturelle Untersuchungen an randschichhärtbarem Stahl Cf53 nach SDPR - Hochhochgeschwindigkeits-Austenitisieren mit anschließendem Abschrecken, Werkstofftechnik, Fertigungs- und Verfahrenstechnik. 65. Kolloquium für Wärmebehandlung. Rhein-Main-Hallen Wiesbaden, 2009.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D. (2009): Suspensionsplasmaspritzen thermisch aktivierbarer triboaktiver Schichtverbunde, Tagungsband zum 17. Symposium Verbundwerkstoffe und Werkstoffverbunde, 01.-03.04.2009, Bayreuth, S. 627-634. Bayreuth, 2009.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009): Basic Principles to Obtain Oxide Ceramic Coating Systems with Reduced Sliding Wear by Suspension Plasma Spraying, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 200-206, 2009.

Bach, Fr.-W.; Behrens, B.-A.; Gretzki, T.; Hassel, T.; Odening, D.; Neugebauer, R. (Hrsg.) (2009): Integrierte Wärmebehandlung komplexer Präzisionsschmiedebauteile mittels einer prozess- und geometrieangepassten Zwei-Phasen-Spraykühlung, Proceedings Berichte aus dem IWU Vol. 52, S. 283-301. Auerbach: Verl. Wiss. Scripten, 2009.

Engelhardt, M.; Broer, C.; Bosse, M.; Heidenblut, T.; Bormann, D.; Bach, Fr.-W.  (2009): Investigations on Extruded Seams in Magnesium Alloy Hollow Sections, K. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 608–614.

Bach, Fr.-W.; Möhwald, K.; Bause, T.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2009): Herstellung von beschichteten Druckgussbauteilen durch prozessintegrierte Applikation thermisch gespritzter Schichten in Gussformen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 36, S. 79-86. Chemnitz: Eigenverlag, 2009.

Hepke, M.; Bormann, D.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): Upward Direct Chill Casting of Magnesium Alloys, 8th International Conference on Magnesium Alloys and their Applications, S. 424-430. Weinheim: Wiley-VCH, 2009.

Hassel, Th.; Swider, M. A.; Waltz, F.; Möhwald, K.; Bach, Fr.-W.; Behrens, P.  (2009): Protection of Magnesium Welds by the Combination of TIG Welding with a Simultaneous Suspension Plasma Spraying Process for the Application of Nanoscaled Magnesium Fluoride Layers to Prevent Corrosion, K. U. Kainer (Hg.): 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH.

Murray, N.; Beniyash, A.; Konya, R.; Bach, Fr.-W.; Hassel, Th.  (2009): EBWC-006 Non Vacuum EB Cutting, AWS - American Welding Society (Hg.): 2009 CD IEBW Proceedings.

Hassel, T.; Wolyniec, A.; Kussike, S. M.; Bach, Fr.-W. (2009): Entwicklung von Stabelektroden für das nasse Unterwasserschweißen - Untersuchung über den Einfluss der Umhüllung, DVS-Deutscher Verband f. Schweißen u. verwandte Verfahren e. V, D. V.S. (Hg.) (2009): Unterwassertechnik. Tagung in Hamburg 03.-04.03.2010: DVS Media.

Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009): PVD-Schichtabformung im µm-Bereich, Tagungsband des zweiten Workshops für Optische Technologien, 17.11.2008, S. 167-169. Garbsen: Verlag PZH Produktionstechnisches Zentrum GmbH, 2009.

Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 397-402. Chemnitz: Eigenverlag, 2009.

Springer, R.; Gershteyn, G.; Hoffmann, S.; Bach, Fr.-W.; Bleck, W.; Bührig-Polaczek, A. (Hrsg.) (2009): Untersuchung des Deformationsreliefs an Oberflächen metallischer Werkstoffe mittels konfokaler Mikroskopie zur Beschreibung des Fließverhaltens, Fortschritte in der Metallographie: [Vortragstexte der 43. Metallographie-Tagung, 16. - 18. September 2009 in Aachen] Sonderbände der praktischen Metallographie Vol. 41, S. 145-149. Frankfurt: Werkstoff-Informationsges., 2009.

Reimche, W.; Mroz, G.; Bruchwald, O.; Bach, Fr.-W.;  (2009): Bauteilinhärente Belastungssensoren und Informationsspeicherung in der Randzone, In: Michael Borsutzki (Hg.): Fortschritte der Kennwertermittlung für Forschung und Praxis. Bad Neuenahr. Tagung Werkstoffprüfung. Düsseldorf: Stahleisen, S. 383–390.

Bach, Fr.-W.; Plorin, T.; Tillmann, W. (Hg.)  (2009): Herstellung, Bearbeitung und Qualifizierung hybrider Werkstoffsysteme., Kolloquium Graduiertenkolleg 1378/1. Leibniz Universität Hannover; Technische Universität Dortmund; PZH Produktionstechnisches Zentrum. Garbsen: PZH Produktionstechnisches Zentrum GmbH; PZH Produktionstechn. Zentrum.

Bach, Fr.-W.; Möhwald, K.; Hoyer, P.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T. (2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsverfahren, Beiträge zum Abschlusskolloquium des SPP 1138, Bonn 11.-12.02.2009, S. 79-95. Bremen: BIAS Verlag, 2009.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2009): Schutzgasofenlöten von Aluminium und Stahl in reaktiven Prozessgasen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 418-423. Chemnitz: Eigenverlag, 2009.

Danilovich, D.; Luzhkova, A.; Ordanyan, S.; Jendras, M.; Bach, Fr.-W.; Hübsch, C.  (2009): Joint synthesis of components in the system TiC-TiB2, In: Deutsche Gesellschaft für Kristallographie (Hg.): 17. Jahrestagung der Deutschen Gesellschaft für Kristallographie. München: Oldenbourg Verlag, S. 116–117

Borchers, L.; Kellner, T.; Hübsch, C.; Jendras, M.; Bach, Fr.-W.; Kohorst, P.; Stiesch, M.  (2009): Strength of zirconia after mechanical, thermal, and hydrothermal loading, In: International Association for Dental Research (Hg.): 87th General Session of the International Association for Dental Research and Ex-hibition. International Association for Dental Research. Alexandria, VA, USA: International Association for Dental Research, S. 532.

Grydin, O.; Batyrshina, E.; Bach, Fr.-W.; CADFEM (Hrsg.) (2009): Mathematische Modellierung des Gießens von dünnen Blechen nach dem Zwei-Rollen-Verfahren, ANSYS Conference & 27th CADFEM Users' Meeting, 2009.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2009): Werkstoffkundliche und Prozesstechnische Aspekte zum Hartlöten im Schutzgasdurchlaufofen, Tagungsband des 4. Aachener Oberflächenkolloquium Schriftenreihe Oberflächentechnik, S. 29-44. Aachen: Shakerverlag, 2009.

Grittner, N.; Hepke, M.; Plorin, T.; Biskup, C.; Bosse M.; Bormann, D.; Breidenstein, B.; Behrens, B.-A.; Bach, Fr.-W. (2009): Extrusion of Split Strips for Roll Forming, 8th International Conference on Magnesium Alloys and their Applications, S. 503-508. Weimar, Germany 26.-29. October

Yu, Z.; Nürnberger, F.; Gretzki, T.; Schaper, M.; Bach, Fr.-W. (2009): Simulation of microstructure and residual stress development in cylinders of AISI 4140 during quenching by spray cooling and following tempering, Materials Science & Technology Conference and Exhibition 2009 Vol. 4, S. 2422-2433. Red Hook, NY: Curran, 2009.

Reimche, W.; Diebel, M.; Mroz, G.; Frackowiak, W.; Bach, Fr.-W.; Borsutzki, M. (Hrsg.) (2009): Einstellung beanspruchungsgerechter Werkstoffeigenschaften durch Verfestigung und strukturierte Wärmebehandlung, Fortschritte der Kennwertermittlung für Forschung und Praxis, S. 391-398. Düsseldorf: Stahleisen, 2009.

Plorin, T.; Bormann, D.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2009): Ausgeschäumte Profile: Magnesiumschäume für den Einsatz in Verbundprofilen, Potenziale metallischer Werkstoffe lokal nutzen, S. 153-159. Clausthal Zellerfeld: Oberharzer Druckerei Fischer & Thielbar GmbH, 2009.

Grydin, O.; Schaper, M.; Bach, Fr.-W.; Howard, S. M. (Hrsg.) (2009): Analysis of microstructure evolution during cold deformation of air-hardening steel LH800, EPD congress 2009, S. 91-98. Warrendale, Pa.: TMS, 2009.

Angrisani, G. L.; Klose, C.; Bormann, D.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): Influence of Alloy Composition and Heat Treatment on Damping Characteristics of Magnesium Alloys, 8th International Conference on Magnesium Alloys and their Applications. Deutsche Gesellschaft für Materialkunde; International Conference on Magnesium Alloys and Their Applications. Weinheim: Wiley-VCH, S. 270–281

Hoyer, P.; Bormann, D.; Bosse, M.; Bach, Fr.-W.; Jendras, M.; Denkena, B.; Lucas, A.; Biermann, D.; Pantke, K.; Kainer, K. U. (Hrsg.) (2009): Influence of form, surface and subsurface areas on the corrosion behaviour and the mechanical properties of magnesium alloys, 8th International Conference on Magnesium Alloys and their Applications, S. 1288-1294. Weinheim: Wiley-VCH, 2009.

Bach, Fr.-W.; Hassel, T.; Schenk A.; Biskup, C. (2009): Materialbearbeitung mit Hochdruckwasserstrahlen - Anwendungsgebiete und Entwicklungstrends, Vortragsband zum Fachkolloquium „Innovative Technologien für die Bearbeitung metallischer und nichtmetallischer Werkstoffe“. Technische Universität Dresden, Dresden, 25. September 2009.

Seitz, J.-M.; Bormann, D.; Stahl, J.; Schumacher, S.; Kietzmann, M.; Kramer, S.; Schwab, B.; Lenarz, T.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): The Potential for Magnesium Alloys Containing ~Neodymium in Medical Engineering, 8th International Conference on Magnesium Alloys and their Applications, S. 1189-1194. Weinheim: Wiley-VCH, 2009.

Hoyer, P.; Möhwald, K.; Bach, Fr.-W.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T.; Vollertsen, F. (Hrsg.) (2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsprozessen, S. 79-95, 2009.

Bach, Fr.-W.; Beniyash, A.; Konya, R.; Szelagowski, A.; Hassel, T. (2009): Non-vacuum electron beam diagnostics, 9-th International Conference on Electron Beam Technologies, 1-4 June, Varna, Bulgaria; ISSN 0861-4717, S.52-58, Band 44, 5-6/2009

Reimche, W.; Zwoch, S.; Bach, Fr.-W.; Klümper-Westkamp, H.; Zoch, H.-W.; Borsutzki, M. (Hrsg.) (2009): Sensortechnik zur diskreten Erfassung von Umwandlungsvorgängen beim Bainitisieren, Fortschritte der Kennwertermittlung für Forschung und Praxis, S. 299-308. Düsseldorf: Stahleisen, 2009.

Bach, Fr.-W.; Beniyash, A.; Konya, R.; Szelagowski, A.; Hassel, T. (2009): Non-vaccum electron beam diagnostics, Proceedings of 9th International Conference on Electron Beam Technologies, 1-4 June 2009, Varna, Bulgaria, p.52-58, ISSN 0861-4717

Hübsch, C.; Buhl, J.-C.; Bach, Fr.-W.; Jendras, M. (2009): Quantiative X-ray analysis of hydrothermal induced phase transformation of ZrO2 ceramics, 17. Jahrestagung der Deutschen Gesellschaft für Kristallographie,, Hannover. Deutsche Gesellschaft für Kristallographie. Hannover, 09.03.2009.

Hübsch, C.; Bach, Fr.-W.; Jendras, M.; Borchers, L.; Stiesch, S. (2009): Observation of hydrothermal induced phase transformation of ZrO2 ceramics for dental applications, 11th International and Interdisciplinary Symposium Biomaterials and Biomechanics, 05-07.März 2009, Essen, S. 127-128

Zeitschriften/Aufsätze

Frolov, I.; Gretzki, T.; Yu, Z.; Nürnberger, F.; Hassel, T.; Bach, Fr.-W. (2009): Surface Hardening Spline Geometries of Heat-Treatable Steel Cf53 using Water-Air Spray Cooling, Materials Working by Pressure - Collection of science papers Vol. 20, Nr. 1, S. 270-275, 2009.

Gretzki, T.; Krause, C.; Frolov, I.; Hassel, T.; Nicolaus, M.; Bach, Fr.-W.; Kästner, M.; Abo-Namous, O.; Reithmeier, E. (2009): Manufacturing Surface Hardened Components of 42CrMo4 by Water-Air Spray Cooling, Steel Research International Vol. 80, Nr. 12, S. 906-915, 2009.

Shevchenko, N. V.; Gershteyn, G.; Schaper, M.; Bach, Fr.-W. (2009): Structure investigation of austenitic steel after cold rolling deformation, Sucasni problemy metalurhii Vol. 12, S. 107-113, 2009.

Teplyakova, L.; Gershteyn, G.; Popova, E.; Kozlov, L.; Ignatenko, R.; Springer, R.; Schaper, M.; Bach, Fr.-W. (2009): Scale-dependent hierarchy of structural elements in the microstructure of thermomechanical treated ferritic steels with residual austenite, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 9, S. 704-712, 2009.

Stahlhut, C.; von der Haar, C.; Kallage, P.; Herzog, D.; Haferkamp, H.; Bach, Fr.-W.; Reimche, W.; Zwoch, S. (2009): Wirbelstromtechnik - ein neues Verfahren zur Detektion von Nullspaltfugen bei Laserstrahlschweißen, Schweissen und Schneiden Vol. 61, Nr. 9, S. 520-527, 2009.

Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C. (2009): Gießformen mit Kapillareffekt, Gießerei-Erfahrungsaustausch, Nr. 3, S. 22-23. Düsseldorf: Gießerei-Verlag GmbH, 2009.

Schumacher, S.; Stahl, J.; Niedorf, F.; Bäumer, W.; Krause, C.; Bach, Fr.-W.; Seitz, J.-M.; Kietzmann, M. (2009): In-Vitro Biocompatibility Testing of Degradable Magnesium-Based Alloys on Murine Fibroblasts L929, Naunyn-Schmiedeberg's Archives of Pharmacology Vol. 379, Nr. Suppl.1, S. 70, 2009.

Schumacher, S.; Stahl, J.; Niedorf, F.; Bäumer, W.; Bach, Fr.-W.; Seitz, J.-M.; Petersen, L. J.; Kietzmann, M. (2009): In Vitro Testing of Biodegradable Implants, Journal of Veterinary Pharmacology and Therapeutics Vol. 32, Nr. s1, S. 264-265, 2009.

Wulf, E.; Krause, C.; Bormann, D.; Schaper, M.; Becker, J.-A.; Woenckhaus, V.; Bach, Fr.-W. (2009): Thermographic analysis of AlSi12 during crystallization as a function of cooling rate, International Journal of Materials Research Vol. 100, Nr. 1, S. 97-103, 2009.

Zilberg, J.; Bach, Fr.-W.; Bormann, D.; Rodman, M.; Schaper, M.; Hepke, M. (2009): Effect of alternating bending on the structure and properties of strips from AZ31 magnesium alloy, Metallovendenie Vol. 646, Nr. 4, S. 20-25, 2009.

Bach, Fr.-W.; Möhwald, K.; Schaup, J.; Holländer, U.; Wolter, K.-J.; Herzog, T.; Wohlrabe, H.; Wielage, B.; Lampke, T.; Weber-Nestler, D.; Bobzin, K.; Schlegel, A. (2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle, Schweißen und Schneiden, Nr. 7, S. 358-368, 2009.

Bernard, M.; Scheer, C.; Böhm, V.; Reimche, W.; Bach, Fr.-W. (2009): New Developments in Non-destructive Testing for Quality Assurance in Component Manufacturing, Steel research int Vol. 80, Nr. 12, S. 916-928, 2009.

Bause, T.; Bach, Fr.-W.; Möhwald, K.; Erne, M. (2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und Korrosionsschutz, Thermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.

Behrens, B.-A.; Bach, Fr.-W.; Denkena, B.; Möhwald, K.; Deißer, T. A.; Kramer, N.; Bistron, M. (2009): Manufacturing of Reinforced High Precision Forging Dies, Steel Research International, Nr. 12, S. 878-886, 2009.

Reimche, W.; Bach, Fr.-W.; Zwoch, S.; Stahlhut, C.; von der Haar, C.; Kallage, P.; Herzog, D.; Haferkamp, H. (2009): Eddy current technology - a new procedure for the detection of zero-gap grooves during laser welding, Welding and Cutting Vol. 8, Nr. 6, S. 359-364, 2009.

Nürnberger, F.; Grydin, O.; Yu, Z.; Schaper, M.; Bach, Fr.-W. (2009): Simulation of Integrated Heat-treatment of Precision Forged Components, Steel Research International Vol. 80, Nr. 12, S. 899-905, 2009.

Nürnberger, F.; Schaper, M.; Bach, Fr.-W.; Mozgova, I.; Kuznetsov, K.; Halikova, A.; Perederieva, O. (2009): Prediction of continuous cooling diagrams for the precision forged tempering steel 50CrMo4 by means of artificial neural networks, Advances in Materials Science and Engineering, 2009.

Nürnberger, F.; Rodman, D.; Grydin, O.; Diekamp, M.; Mozgova, I.; Bach, Fr.-W. (2009): Spray cooling of aluminium chassis frames, Sucasni problemy metalurhii Vol. 12, S. 92-99, 2009.

Nürnberger, F.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; Evertz, T.; Kluge, U. (2009): Isothermal Microstructural Transformations of the Heat-treatable Steel 42CrMo4 during Heat-treatment following Hot-forming, Steel Research International Vol. 80, Nr. 12, S. 892-898, 2009.

Pfahl, A.; Puchert, A.; Behrens, B.-A.; Bach, Fr.-W. (2009): Legierungsentwicklung zur Verschleißreduzierung von Schmiedegesenken -Einfluss von Mangan auf die Absenkung der Ac1b-Temperatur, HTM - Journal of Heat Treatment and Materials Vol. 64, Nr. 5, S. 291-296, 2009.

Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C.  (2009): Gießformen mit Kapillareffekt., Gießerei-Erfahrungsaustausch (3), S. 22–23.

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im Schutzgasofen, INFO-SERVICE, Nr. 20, S. 6-11, 2009.

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im Schutzgasdurchlaufofen, INFO-SERVICE, Nr. 20, S. 16-19, 2009.

Bach, Fr.-W.; Prehm, J.; Hartz-Behrend, K.; Roxlau, C.  (2009): Gießformen mit Kapillareffekt, Gießerei-Erfahrungsaustausch (3), S. 22–23

Alphei, L.; Braun, A.; Becker, V.; Feldhoff, A.; Becker, J.-A.; Wulf, E.; Krause, C.; Bach, Fr.-W. (2009): Crystallization of supercooled silicon droplets initiated through small silicon nitride particles, Journal of Crystal Growth Vol. 311, Nr. 5, S. 1250-1255, 2009.

Krause, C.; Springer, R.; Gershteyn, G.; Dudzinski, W.; Bach, Fr.-W. (2009): In-situ high temperature microstructural analysis during tempering of 42CrMo4 using transmission electron microscopy, International Journal of Materials Research Vol. 2009, Nr. 7, S. 991-1000, 2009.

Hübner, S.; Palkowski, H.; Behrens, B.-A.; Bach, Fr.-W.; Wesling, V.; Esderts, A.; Rudolph, K.-M.; Voges-Schwieger, K.; Weilandt, K.; Mielke, J.; Knigge, J.; Hagen, T.; Asadi, M.; Sokolova, O.; Wiche, H.; Medhurst, T.; Diebel, M. (2009): Im Fertigungsprozess lassen sich Bauteile spezifisch optimieren, Maschinenmarkt Vol. 44, S. 26-29, 2009.

Grittner, N.; Haverkamp, H.; Stelling, O.; Bormann, D.; Schimanski, K.; Nikolaus, M.; Hehl, A. v.; Bach, Fr.-W.; Zoch, H.-W. (2009): Verbundstrangpressen von Titan-Aluminium-Verbindungen, Materialwissenschaft und Werkstofftechnik Vol. 40, Nr. 12, S. 901-906, 2009.

Bach, Fr.-W.; Beniyash, A.; Lau, K.; Konya, R. (2009): Nonvacuum electron beam welding of structural steels, The Paton Welding Journal, Vol. 2009, Nr. 5, pages 22-26.

Bach, Fr.-W.; Brukhanov, A. A.; Zilberg, J.; Wolshok, N. W.; Rodman, M.; Hepke, M. (2009): Entfestigung von Blechen aus der Mg-Legierung AZ31 beim alternierenden Biegen, Deformation & Fracture of Materials, Nr. 5, 2009.

Demling, A.; Heuer, W.; Elter, C.; Heidenblut, T.; Bach, Fr.-W.; Schwestka-Polly, R.; Stiesch-Scholz, M. (2009): Analysis of supra- and subgingival long-term biofilm formation on orthodontic bands, European Journal of Orthodontics, Nr. 31, S. 202-206, 2009.

Patentschriften

Reimche, W.; Bach, Fr.-W.; Mroz, G. (2009): Bauteil, Verfahren zum Einbringen von Informationen in ein Bauteil und Verfahren zum Ermitteln einer Belastungshistorie eines Bauteils , Veröffentlichungs-Nummer DE102009056584A1

Bach, Fr.-W.; Beniyash, A.; Hassel, T.; Konya, R.; Murray, N.; Ruchay, W. (2009): Verfahren und Vorrichtung zum thermischen Bearbeiten von Werkstoffen , Veröffentlichungs-Nummer: DE102009052807A1

Bach, Fr.-W.; Hassel, T.; Bierbaum, M. (2009): Verfahren und Vorrichtung mit einer autogenen Brennereinrichtung , Veröffentlichungs-Nummer: DE102009033556A1

Bach, Fr.-W.; Kucharski R.; Bormann, D.  (2009): Verfahren zur Herstellung eines Elementes aus einem Magnesiumwerkstoff und so herstellbares Element, Veröffentlichungs-Nummer: WO002009083250A1

Menneking, C.; Bormann, D.; Behrens, P. ; Bach, Fr.-W. (2009): Bioresorbierbares Material , Veröffentlichungs-Nummer DE102008019748A1

Bach, Fr.-W.; Schaper, M.; Hassel, T.; Bosse, M. (2009): Ferro- oder ferrimagnetische Magnesiumlegierung, deren Herstellung und Verwendungen , Veröffentlichungs-Nummer DE102008008812A1

Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2009): Verfahren zur Herstellung eines Elements aus einem Magnesiumwerkstoff und so herstellbares Element , Veröffentlichungs-Nummer DE102007063317A1

Vortrag

Engelhardt, M.; Bormann, D.; Haverkamp, H.; Plorin, T.; Klose, C.; Gershteyn, G.; Bach, Fr.-W. (2009): Werkstoffkundliche Analyse der Prozesskombination konventioneller und dynamischer Umformverfahren, Workshop Impulsumformung, S. 1-19. Dortmund, 12.03.2009.

Reimche, W.; Bernard, M.; Scheer, C.; Böhm, V.; Bombosch, S.; Bach, Fr.-W. (2009): Frühzeitige zerstörungsfreie Erkennung und Klassifizierung von Getriebeschäden: DGZfP Arbeitskreis ZWICKAU-CHEMNITZ, Westsächsische Hochschule Zwickau (FH) Technikum II, 27. Januar 2009, DGZfP Arbeitskreis ZWICKAU-CHEMNITZ, Westsächsische Hochschule Zwickau (FH) Technikum II, 27. Januar 2009.

Behrens, S.; Jendras, M.; Bach, F.-W. (2009): Corrosion behaviour of magnesium and its alloys examined by means of ICP-OES, DGM Tagung „Magnesium Alloys and their Applications“, Weimar, 26.-29.10.2009

Mroz, G.; Reimche, W.; Bach, Fr.-W. (2009): Gentelligente Bauteilidentifikation und Integritätsbewertung, 9. Luft- und Raumfahrtseminar, 24. und 25. Nov. 2009

Reimche, W.; Bach, Fr.-W. (2009): Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren, 10.-12.11.2009.

Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2009): Verschleißschutzoberflächen für Präzisions-Umformwerkzeuge, Oberflächentag (Hannover-Messe)

Bach, Fr.-W.; Bormann, D.; Kerber, K. (2009): Mg-Verbundguss für intelligente Bauteile, Messe Euromold 2009. DGM Forum Werkstoffe. DEMAT GmbH. Frankfurt, 03.12.2009.

2008

Konferenz

Klose, C.; Angrisani, G. L.; Wienecke, S.; Männer, J.; Yelbuz, T. M.; Bormann, D.; Bach, Fr.-W. (2008): 3D-Darstellung des embryonalen Herzen mittels Mikro-Computer-Tomographie (Mikro-CT): Erste Ergebnisse einer Machbarkeitsstudie, Jochen Weil (Hg.): 40. Jahrestagung der Deutschen Gesellschaft für Pädiatrische Kardiologie, 01.09.2008. Clinical Research in Cardialogy. Sonderdruck. Steinkopff (97), S. 674.

Kohorst, P.; Tegtmeyer, S.; Biskup, C.; Bach, Fr.-W.; Stiesch-Scholz, M. (2008): Einfluss des Abrasivmediums bei der Dentinbearbeitung mittels Wasserabrasivstrahlverfahren, Jahrestagung der Deutschen Gesellschaft für Zahn-, Mund- und Kieferheilkunde, Poster3, Stuttgart, Oktober 2008.

Bach, Fr.-W.; Schaper, M.; Grydin, O.; Tekkaya, A. E.; Brosius, A.; Cwiekala, T.; Svendsen, B.; Barthel, C. (2008): Efficient modeling and calculation of sheet metal forming using steel LH800, Steel Research int., Special Edition to 12th International Conference "Metal Forming" Vol. 2008, S. 99-105, 2008.

Reimche, W.; Bernard, M.; Bombosch, S.; Scheer, C.; Böhm, V.; Bach, Fr.-W. (2008): Entwicklung und Qualifizierung von Prüftechniken zur Prozessüberwachung und Qualitäts-sicherung in der Fertigung, 9. DELTA TEST Fachtagung 2008, 12.-14. November 2008

Bach, Fr.-W.; Schenk, A.; Rümenapp, T.; Brüggemann, P. (2008): Rückbau kerntechnischer Anlagen, Tagungsband des 6. Steinkolloquiums des Instituts für Fertigungstechnik und Werkzeugmaschinen. Hannover

Biskup, C.; Schenk, A.; Bach, Fr.-W.  (2008): Cutting perfomance comparison of the AWIJ technique with intake of abrasive/air-mixture or supsension as well as the AWSJ, 19th International Conference on Water Jetting, Nottingham, UK, 15.-17. Oktober 2008, S. 155-168

Risch, D.; Gershteyn, G.; Dudzinski, W.; Beerwald, C.; Brosius, A.; Schaper, M.; Tekkaya, A. E.; Bach, Fr.-W.; Kleiner, M. (Hrsg.) (2008): Design and Analysis of a Deep Drawing and Inprocess Electromagnetic Sheet Metal Forming Process, Proceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 201–212

Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2008): Verfahrenskombinationen und Hybride aus thermischem Beschichten und Fügen, 3. Aachener Oberflächentechnik-Kolloquium 12.12.2008, S. 31-50. Aachen: Shaker Verlag, 2008.

Lau, K.; Konya, R.; Bach, Fr.-W. (2008): Untersuchungen der Eignung des Elektronenstrahlschweißens an Atmosphäre zur Verarbeitung von höherfesten, verzinkten Karosseriebaustählen, Die Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl.

Bach, Fr.-W.; Schaper, M.; Bormann, D.; Reimche, W.; Mroz, G.; Rodman, M. (2008): Investigation of magnetic magnesium alloys, 4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.

Böhm, V.; Scheer, C.; Reimche, W.; Bach, Fr.-W. (2008): Klassifizierung von Getriebeschäden mit Schwingungsanalyse und Wirbelstromtechnik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.

Nürnberger, F.; Yu, Z.; Wilkening, L.; Grydin, O.; Schaper, M.; Bach, Fr.-W.; CADFEM (Hrsg.) (2008): Simulation der Eigenspannungsentwicklung beim Abschrecken von Zylindern aus 42CrMo4 mittels Spraykühlung, ANSYS Conference & 26th CADFEM Users' Meeting, 2008.

Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2008): Oberflächenbehandlungen von Polymeren und Werkzeugen zur Polymerbearbeitung, Fahlbusch, Pfalz (Hg.) 2008 – Tagungsband Hannoversches Zentrum für Optische Technologien; Workshop Optische Technologien

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T.; Scheer, C. (2008): Characterisation of thermally sprayed near net shape oxide ceramic and cermet coatings by acoustic emission analysis, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.

Bernard, M.; Bombosch, S.; Reimche, W.; Bach, Fr.-W. (2008): Nachweis von Härterissen im Verzahnungsbereich von Zahnrädern mit Thermographie und Wirbelstromtechnik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.

Mroz, G.; Reimche, W.; Bach, Fr.-W. (2008): Acquisition of Discrete Component and Loading Information in the Component's Edge Re-gion Using Innovative Sensor Technology, 4th I*PROMS 2008 Virtual International Conference on Innovative Production Machines and Systems, 2008.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Wielage, B. (Hrsg.) (2008): Optimierung von Eisenbasisfülldrähten für das Lichtbogenspritzen mittels statistischer Methoden, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 73-79. Chemnitz: Eigenverlag, 2008.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008): Development of near net shape coatings for wear and corrosion protection, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.

Psyk, V.; Gershteyn, G.; Demir, O. K.; Brosius, A.; Tekkaya, A. E.; Schaper, M.; Bach, Fr.-W.; Kleiner, M. (Hrsg.) (2008): Process Analysis and Physical Simulation of Electromagnetic Joining of Thin-walled Parts, Proceedings of the 3rd International Conference on High Speed Forming. March 11 - 12, 2008, Dortmund, Germany. Unter Mitarbeit von M. Kleiner und A. E. Tekkaya. Proceedings of 3rd International Conference on High Speed Forming; Institut für Umformtechnik und Leichtbau. Dortmund: IUL, S. 181–190

Tekkaya, A.E; Brosius, A.; Cwiekala, T.; Bach, Fr.-W.; Grydin, O.; Schaper, M.; Svendsen, B.; Barthel, C. (2008): Zeiteffiziente Prozesskettenmodellierung und -berechnung in der Blechumfor-mung und -verarbeitung, In: MEFORM 2008. Simulation von Umformprozessen. Institut für Metallformung, TU Bergakademie Freiberg. Freiberg, Deutschland: ACATRAIN e.V., S. 262–274.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C.; Wielage, B. (Hrsg.) (2008): Neue Entwicklungen beim Hartlöten im Schutzgasdurchlaufofen, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 209-214. Chemnitz: Eigenverlag, 2008.

Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Bobzin, K.; Bagcivan, N.; Petkovic, I.; Schein, J.; Forster, G.; Zimmermann, S. (2008): Homogenization of coating properties in Atmospheric Plasma Spraying - technical objectives and first results of a DFG funded research group, Proc. International Thermal Spray Conference, June 2-4, 2008, Maastricht, The Netherlands, 2008.

Bach, Fr.-W.; Bormann, D.; Walden, L.; Kleiner, M. (Hrsg.) (2008): Influence of Forming Rate on the Microstructure and Properties of Materials subjected to Electromagnetic Forming: A Synopsis, ICHSF 2008, S. 55-64. Dortmund: Technische Universität Dortmund, 2008.

Bach, Fr.-W.; Erne, M.; Möhwald, K.; Wielage, B. (Hrsg.) (2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaf-ten von thermisch gespritzten Schichten, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 66-72. Chemnitz: Eigenverlag, 2008. Online verfügbar unter http://www.worldcat.org/oclc/318648539

Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.

Bach, Fr.-W.; Drößler, B.; Möhwald, K. (2008): Thermally sprayed coatings with stochastic microstructures for thermomechanically high stressed surfaces, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.

Scheer, C.; Reimche, W.; Bach, Fr.-W. (2008): Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavlet-Transformation., DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.

Reimche, W.; Zwoch, S.; Böhm, V.; Bach, Fr.-W.; Vetterlein, J.; Klümper-Westkamp, H.; Zoch, H.-W. (2008): Entwicklung einer prozessfähigen Prüftechnik zum sensorkontrollierten Bainitisieren in der Wärmebehandlung, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.

Hassel, T.; Linzunkova, Y.; Wolyniec, A.; Bach, Fr.-W. (2008): Herstellung und Entwicklung von selbstschützenden Doppelmantelfülldrahtelektroden zum kontinuierlen Unterwasserschweißen, Die Verbindungsspezialisten. Große Schweißtechnische Tagung ; BMBF-Forschungsförderung "Fügen im Produktlebenszyklus" ; Studentenkongress ; Vorträge und Posterbeiträge der Veranstaltung in Dresden vom 17. bis 19. September 2008 = DVS - Deutscher Verband für Schweißen und verwandte Verfahren. Als Ms. gedr. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren DVS-Verl., S. 83–88

Bosse, M.; Hoyer, P.; Bach, Fr.-W.; Bormann, D. (2008): Influence of cutting and non-cutting processes on the corrosion behavior and the mechanical properties of magnesium alloys, Supplemental proceedings, TMS 2008 137th annual meeting & exhibition. : [held March 9 - 13, in New Orleans, Louisiana, USA]. Warrendale, Pa.: TMS, S. 383–388

Klümper-Westkamp, H.; Vetterlein, J.; Lütjens, J.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2008): Bainite sensor - A new tool for process and quality control of the bainite transformation, Proc. European Conf. on Heat Treatment 2008, Innovation in Heat Treatment for Industrial Competetiveness (ECHT 2008), 07.-09.05.2008, Verona, Italien, Associazione Italiana di Metallurgia/AIM (Hrsg.), 2008, auf CD-ROM. – ISBN 88-85298-64-8

Bormann, D.; Menneking, C.; Behrens, P.; Bach, Fr.-W. (2008): Bioresorbierbares Material, , 18.04.2008.

Zeitschriften/Aufsätze

Krause, C.; Bormann, D.; Bach, Fr.-W.; {et al.} (2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Spraykühlung, HMT - Journal of Heat Treatment and Materials - Zeitschrift für Werkstoffe, Wärmebehandlung, Fertigung Vol. 63, Nr. 1, S. 22-26, 2008.

Krause, C.; Bach, Fr.-W.; Bormann, D.; Zeddies, M.; Krause, A.; Meyer-Lindenberg, A.; Windhagen, H. (2008): Resorbierbare Marknägel auf Magnesiumbasis, Schweizer Maschinenmarkt, Nr. 1/2, S. 94-99, 2008.

Elter, C.; Heuer, W.; Demling, A.; Hannig, M.; Heidenblut, T.; Bach, Fr.-W.; Stiesch-Scholz, M. (2008): Supra- and subgingival biofilm formation on implant abutments with different surface characteristics, International Journal of Oral & Maxillofacial Implants Vol. 23, Nr. 2, S. 327-334, 2008.

Reimche, W.; Bernard, M.; Bombosch, S.; Scheer, C.; Bach, Fr.-W. (2008): Nachweis von Anrissen in der Randzone von Hochleistungsbauteilen mit Wirbelstromtechnik und induktiv angeregter Thermographie, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 5, S. 284-297, 2008.

Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, Schweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.

Zwoch, S.; Reimche, W.; Klotz, J.; Bach, Fr.-W. (2008): Entwicklung einer Ultraschallprüftechnik zur Qualitätsbewertung von Bolzenschweißverbindungen, Schweissen und Schneiden Vol. 60, Nr. 4, S. 205-210, 2008.

Behrens, B.-A.; Bach, Fr.-W.; Reimche, W.; Gastan, E.; Lange, F.; Mroz, G. (2008): Verfahren zur Einbringung und Wiedergabe von Daten in Sinterbauteilen, Metall - Internationalle Fachzeitschrift für Metallurgie Vol. 62, Nr. 5, S. 298-301, 2008.

Reimche, W.; Bach, Fr.-W.; Mroz, G.; Duhm, R.; Bernard, M.; Diebel, M. (2008): High Strength 3D Non-Vacuum Electron Beam Weld Joints - Setting of Gradient Material Properties and Testing of Weld Quality, Steel research int Vol. 79, Nr. 3, 2008.

Plorin, T.; Bormann, D.; Bach, Fr.-W. (2008): The Manufacture and Characterisation of Reinforced Magnesium Foams, Steel Research International Vol. 79, Nr. 3, S. 185-190, 2008.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Tillmann, W.; Vogli, E.; Nebel, J. (2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal spraying, Thermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.

Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.

Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.

Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Schweißen und Schneiden, Nr. 4, S. 192-199, 2008.

Bach, Fr.-W.; Möhwald, K.; Bause, T.; Erne, M. (2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten Pulvern, Schweißen und Schneiden, Nr. 11, S. 625-631, 2008.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S. (2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von Aluminiumwerkstoffen, Materialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.

Peuster, M.; Beerbaum, P.; Bach, Fr.-W.  (2008): Are resorbable implants about to become a reality? , Cardiology in the Young (16), S. 107–116.

Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Schweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.

Krause, C.; Hassel, T.; Frolov, I.; Gretzki, T.; Kästner, M.; Seewig, J.; Bormann, D.; Bach, Fr.-W. (2008): Randschichtvergüten von Zahnwellen mittels Wasser-Luft-Sprühkühlung., HTM, Härterei-Technische Mitteilungen Vol. 63, Nr. 1, S. 22-26, 2008.

Krause, C.; Wulf, F.; Nürnberger, F.; Bach, Fr.-W. (2008): Wärmeübergangs- und Tropfencharakteristik für eine Spraykühlung im Temperaturbereich von 900 °C bis 100 °C, Forschung im Ingenieurwesen Vol. 72, Nr. 3, S. 163-173, 2008.

Kucharski, R.; Bormann, D.; Bach, Fr.-W.; Jendras, M.; Hauser, M.; Müller, P. P.; Reifenrath, J.; Meyer-Lindenberg, A. (2008): Herstellung von offenporigen Magnesium-Keramik-Implantaten, Biomaterialien Vol. 9, Nr. 3/4, S. 110, 2008.

Bach, Fr.-W.; Bormann, D.; Rodman, M.; Haverkamp, H. (2008): Hybrides Walzen am Beispiel von Titan-Aluminium-Verbunden, Materialwissenschaft und Werkstofftechnik Vol. 39, Nr. 9, S. 588-593, 2008.

Bach, Fr.-W.; Bormann, D.; Haverkamp, H. (2008): Walzplattierte Leichtmetallverbunde, Werkstoffe in der Fertigung, Nr. 4, S. 33-35, 2008.

Cwiekala, T.; Brosius, A.; Tekkaya, A. E.; Grydin, O.; Schaper, M.; Bach, Fr.-W. (2008): Efficient Modelling and Simulation of Process Chains in Sheet Metal Forming and Processing, Steel Research International Vol. 79, Nr. 10, S. 731-737, 2008.

Heuer, W.; Elter, C.; Demling, A.; Suerbaum, S.; Heidenblut, T.; Bach, Fr.-W.; Hannig, M.; Stiesch-Scholz, M. (2008): Analyse der initialen Biofilmbildung auf oberflächenmodifizierten Healing-Abutments, Deutsche Zahnärztliche Zeitschrift Vol. 63, Nr. 9, S. 632-638, 2008.

Klümper-Westkamp, H.; Vetterlein, J.; Lütjens, J.; Zoch, H.-W.; Reimche, W.; Bach, Fr.-W. (2008): Bainite Sensor - A new tool for process and quality control of the bainite transformation, HTM - Journal of Heat Treatment and Materials Vol. 63, Nr. 3, S. 174-180, 2008.

Patentschriften

Bach, Fr.-W.; Denkena, B. (2008): Vorrichtung zur spanenden Bearbeitung eines Werkstücks, Veröffentlichungs-Nummer: WO002008055489A2

Krettek C.; Huefner T.; Goesling T.; Bach, Fr.-W.; Klotz J.  (2008): Bohrmaschine für chirugische Zwecke, Veröffentlichungs-Nummer: WO002008071176A1

Klotz, J.; Bach, Fr.-W. (2008): Ein chirurgisches Bohrverfahren, eine für chirurgische Zwecke bestimmte Bohrmaschine mit einem Aufsatz sowie ein Aufsatz für eine für chirurgische Zwecke bestimmte Bohrmaschine , Veröffentlichungs-Nummer DE102008061249A1

Bach, Fr.-W.; Bierbaum, M.; Krause, C. (2008): Verfahren und Vorrichtung zum Stimulieren von Zellen , Veröffentlichungs-Nummer DE102008059731A1

Bach, Fr.-W.; Denkena, B. (2008): Vorrichtung zur spanenden Bearbeitung eines Werkstücks , Veröffentlichungs-Nummer DE102006053330A1

2007

Konferenz

Reimche, W.; Bernard, M.; Zwoch, S.; Bach, Fr.-W. (2007): Anwendung von Simulationsverfahren zur Entwicklung von zerstörungsfreien Prüftechniken im Rahmen der Qualitätsprüfung von Schweißverbindungen, 1. Fachtagung „Prüfen in der Schweißtechnik“. 30. und 31. Januar 2007, Halle (Saale). Gesellschaft für Schweißtechnik International mbH, Schweißtechnische Lehr- und Versuchsanstalt Halle GmbH. Halle (Saale), S. 4–15

Reimche, W.; Scheer, C.; Bach, Fr.-W. (2007): Frühzeitige Schadenserkennung an rotierenden Bauteilen mittels Schallemissionsanalyse und einer Wirbelstromtechnik unter Anwendung der Wavelet-Transformation, Schwingungsüberwachung und Diagnose von Maschinen VDI-Berichte Vol. 1982, CD-ROM, S. 39-55. Düsseldorf: VDI-Verl., 2007.

Dyllong, N.; Steinwarz, W.; Wienert, R.; Kramm, K.-H.; Bach, F.-W.; Hassel, T.; Behrens, S. (2007): Schutz durch Hochgeschwindigkeitsflammspritzschichten auf dickwandigen End-und Zwischenlagerbauteilen zur Reduktion von Reparaturen, In: Kontec Gesellschaft für technische Kommunikation mbH (Hrsg.): KONTEC 2007 – Tagungsband. 8. Internationales Symposium „Konditionierung radioaktiver Betriebs- und Stillle-gungsabfälle“. Dresden, 21.-23.03.2007, S.534- 539

Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007): Early fault detection at gear units by acoustic emission and wavelet analysis, 5th International Conference on Acoustic Emission, Lake Tahoe, Nevada, USA, October 29 to November 2, 2007

Bach, Fr.-W.; Biskup, C.; Kremer, G.; Kirsch, L.; Schmolke, S. (2007): Investigation of the Abrasive Water Injection Jet Drilling Process in Cortical Bone, Proceedings of the 2007 American WJTA Conference and Expo, Aug 2007, Houston, USA, paper 1-D

Bach, Fr.-W.; Reimche, W.; Duhm, R.; Mroz, G.; Denkena, B. (Hrsg.) (2007): Gentelligente Bauteilidentifikation und Integritätsbewertung, Gentelligente Bauteile im Lebenszyklus, S. 31-38. Garbsen: PZH Produktionstechnisches Zentrum, 2007.

Michaeli, W.; Kamps, T.; Bach, Fr.-W.; Hartz, K.; Schmachtenberg, E.; Vetter, K.; Schmiederer, D.; Lurz, A.; Piotter, V.; Prokop, J. (2007): Neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, MikroSystemTechnik Kongress 2007 Proceedings, 15. - 17. Oktober 2007 in Dresden, S. 635-638. Berlin und Offenbach: VDE Verlag GmbH, 2007.

Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007): Frühzeitige Schadenserkennung und -ortung an Getrieben mittels Schallemissionsanalyse und Wavelet-Transformation, 16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.

Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Bistron, M. (2007): Use of a TiBN multilayer coating for wear reduction, Proceedings of 9th International Conference on Numerical Methods in Industrial Forming Processes - numiform'07, S. 1047-1052. Porto, Portugal, 2007.

Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Küper, A.; Deißer, T. A.; Bistron, M. (2007): Reduction of Wear by a TiBN Multilayer Coating, 31st Int. Cocoa Beach Conference ICACC Jan. 2007 // Proceedings of the 31st International Conference on Advanced Ceramics and Composites, January 21-26, 2007, Daytona Beach, Florida, USA. Westerville, Ohio: American Ceramic Soc

Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007): Schallemissions- und Waveletanalysen zur frühzeitigen Schadenserkennung an hochbelas-teten rotierenden Bauteilen, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.

Bach, Fr.-W.; Schaper, M.; Rodman, M.; Nowak, M.; Kainer, K. U. (Hrsg.) (2007): Magnesium with Magnetic Properties for Sensory Use, Kainer, K.U. ; DGM, Oberursel: Magnesium. Proceedings of the 7th International Conference on Magnesium Alloys and their Applications 2006 : 06-09. November 2006, Dresden, pp. 992-996. Weinheim: Wiley-VCH, 2007.

Scheer, C.; Reimche, W.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007): Frühzeitige Erfassung und Klassifizierung der Schadensentwicklung in hochbeanspruchten rotierenden Bauteilen mittels Schallemissions- und Wavelet-Analysen, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.

Bach, Fr.-W.; Schaper, M.; Nowak, M.; Rodman, M.; Denkena, B. (Hrsg.) (2007): Magnetische Magnesiumlegierungen. Entwicklung von Magnesiumlegierungen mit magnetischen Ausscheidungen., Gentelligente Bauteile im Lebenszyklus, S. 7-12. Garbsen: PZH Produktionstechnisches Zentrum, 2007.

Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2007): Thermally Sprayed Coatings with Stochastic Microstructure for Improved Lubricant Retention, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 317-322, 2007.

Mroz, G.; Reimche, W.; Diebel, M.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007): Erfassung diskreter Bauteil- und Belastungsinformationen in der Bauteilrandzone mit inno-vativer Sensortechnik, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.

Bernard, M.; Reimche, W.; Bach, Fr.-W.; Pohl, M. (Hrsg.) (2007): Prozessfähige Randhärte- und Einhärtungstiefenbestimmung an dick- und dünnwandigen Bauteilen, Konstruktion, Qualitätssicherung und Schadensanalyse. Düsseldorf: Verl. Stahleisen, 2007.

Bernard, M.; Reimche, W.; Bach, Fr.-W. (2007): Zerstörungsfreie Bestimmung der Randzoneneigenschaften hoch beanspruchter Maschinenbauteile, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth

Scheer, C.; Brüggemann, P.; Reimche, W.; Bach, Fr.-W. (2007): Beurteilung des Entschichtungszustands beim Trockeneisstrahlen mittels Analyse und Or-tung von Schallemissionssignalen, 16. Kolloquium Schallemission Statusberichte zur Entwicklung und Anwendung der Schallemissionsanalyse. Puchberg, 2007.

Reimche, W.; Bernard, M.; Bach, Fr.-W.; Kronemeijer, D. A.; Kücheknecht, B.; Pohl, M. (Hrsg.) (2007): Qualifizierung zerstörungsfreier Prüftechniken zur wiederkehrenden Prüfung austenitischer Rohre hinsichtlich chloridinduzierter Lochkorrosion, M. Pohl (Hg.): Konstruktion, Qualitätssicherung und Schadensanalyse. [Tagung "Werkstoffprüfung 2007", 29. und 30. November 2007 in Neu-Ulm]. Deutsche Gesellschaft für Materialkunde; Deutscher Verband für Materialforschung und -prüfung; Stahl-Institut VDEh. Düsseldorf: Verl. Stahleisen

Bach, Fr.-W.; Möhwald, K.; Erne, M. (2007): Diamantimprägnieren durch Thermisches Spritzen als Verfahren zur Schleifwerkzeugbeschichtung, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 286-291. Chemnitz: Eigenverlag, 2007.

Scheer, C.; Reimche, W.; Bach, Fr.-W. (2007): Schwingungsdiagnostische Beurteilung des Lauf- und Verschleißverhaltens von präzisionsgeschmiedeten und konventionellen Zahnrädern im Vergleich, Schwingungsüberwachung und Diagnose von Maschinen. VDI-Schwingungstagung 2007 ; Tagung Würzburg, 27. und 28. Februar 2007. Schwingungstagung; Gesellschaft Entwicklung, Konstruktion, Vertrieb. Düsseldorf: VDI-Verl. (VDI-Berichte, 1982, CD-ROM), S. 185–204

Bach, Fr.-W.; Möhwald, K.; Bause, T.; Wielage, B. (Hrsg.) (2007): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 125-129. Chemnitz: Eigenverlag, 2007.

Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.-A.; Kamps, T.; Bistron, M. (2007): Keramik-Metall-Verbundwerkzeuge für die Metallbearbeitung, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 52-58. Düsseldorf: DVS-Verlag, 2007.

Bach, F.; Denkena, B.; Bouzakis, K.; Geiger, M. (Hrsg.) (2007): Proceedings of the 6th International Conference THE Coatings 2007, Hannover, 25.-26. Oktober 2007. Garbsen: PZH Produktiontechnisches Zentrum GmbH

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -Drähte und -Folien, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 393-397. Düsseldorf: DVS-Verlag, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Entwicklung eines neuen Produktionsverfahrens für die Fertigung komplexer Metallverbunde- Gas/Solid-TLP-Bonding, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 231-236. Chemnitz: Eigenverlag, 2007.

Reimche, W.; Mroz, G.; Diebel, M.; Bach, Fr.-W.; Palkowski, H. (Hrsg.) (2007): Einstellung gradierter Werkstoffeigenschaften und Qualitätssicherung hochfester 3D-NVEB-Schweißverbindungen, 6. Industriekolloquium "Hochfeste Strukturen", S. 89-98. Clausthal-Zellerfeld: Techn. Univ. Inst. für Metallurgie SFB 675, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2007): SCIB - Self-Cleaning Inert-Gas Brazing? Ein neues Verfahren zum flussmittelfreien Hartlöten korrosionsbeständiger Konstruktionswerkstoffe, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 235-241. Düsseldorf: DVS-Verlag, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J. (2007): Elektrochemische Messmethoden zur Online-Bestimmung des Kupfergehaltes in bleifreien Sn-Basis-Lotbädern, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 261-267. Chemnitz: Eigenverlag, 2007.

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Krause, C.; Höh, N. v. d.; Meyer-Lindenberg, A. (2007): Absorbable Hybrid Implants, 1st Symposium on Intelligent Implants. Biometrology, Telemetry, Manufacturing. Garbsen, 9. - 10.Mai 2007. Produktionstechnisches Zentrum Hannover; Medizinische Hochschule Hannover. Hannover

Grydin, O.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W. (2007): Mathematical model for simulation of steel behavior during integrated heat treatment on the base of software ANSYS, Computational Mechanics & Enhancement and Promotion of Computational Methods in Engineering and Science. Kyoto, Japan, 3.-6.12.2007.

Bach, Fr.-W.; Möhwald, K.; Hartz, K. (2007): Metall-Kapillardruckgießen und Dampfphasen-Schmelzinfiltration: Zwei innovative Verfahren für das Herstellen metallischer Mikrobauteile, Thomas Gessner (Hg.): Proceedings / Mikrosystemtechnik-Kongress 2007. 15. - 17. Oktober 2007 in Dresden ; gemeinsame Veranstaltung von: Bundesministerium für Bildung und Forschung (BMBF), VDE Verband der Elektrotechnik Elektronik Informationstechnik. Berlin, Offenbach: VDE-Verl, S. 123–126

Mroz, G.; Diebel, M.; Reimche, W.; Bach, Fr.-W. (2007): Entwicklung von Sensortechnik zur Erfassung diskreter Bauteil und Belastungsinformationen in der Bauteilrandzone, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Hartz, K.; Nicolaus, M. (2007): Gas/Solid-TLP-Bonding Ein neues Verfahren zum Herstellen und Fügen von Miniatur- und Mikrobauteilen, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 319-324. Düsseldorf: DVS-Verlag, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2007): Flammlöten von Aluminiumschmiedeteilen, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 202-212. Chemnitz: Eigenverlag, 2007.

Reimche, W.; Duhm, R.; Bernard, M.; Bach, Fr.-W.; Kronemeijer, D. A.; Kücheknecht, B. (2007): Zerstörungsfreie Fehlerprüfung und Fehlertiefenbestimmung chlorinduzierter Lochkorrosion in austenitischen Rohren, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". 14.-16. Mai 2007, Fürth. DGZfP. Fürth

Bach, Fr.-W.; Behrens, B.-A.; Möhwald, K.; Bistron, M.; Deißer, T. A. (2007): Wear reducing measures on forging dies by application of technical surfaces, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 23-32, 2007.

Reimche, W.; Zwoch, S.; Bernard, M.; Bach, Fr.-W. (2007): Entwicklung und Qualifizierung einer Fernfeld-Wirbelstromtechnik zur Fehlerprüfung von Schweißnähten und dickwandigen Bauteilen, DGZfP-Jahrestagung 2007 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". Fürth, 2007.

Bach, Fr.-W.; Bormann, D.; Plorin, T.; Palkowski, H. (Hrsg.) (2007): Lokal ausgeschäumte, profilgewalzte, geschlossene Profile, Hochfeste Strukturen, S. 35-42. Clausthal Zellerfeld: Technische Universität Clausthal, 2007.

Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2007): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen? Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Vortragsband zu 7. Int. Konf. Strahltechnik 17.-19.4.2007 in Halle (Saale). SLV Halle, GSI: DVS, 2007.

Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Holländer, U. (2007): Hot Cracks in Pulsed Laser Beam Welds of Cr-Ni-alloyed Steels ? Detection methods and Prevention by using Predeposited Plasma Spray Layers, Proc. of the Third International Conference on Laser Technologies in Welding and Materials Processing, Katsiveli (Crimea, UA), 29 May - 2 June, 2007, 2007.

Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Drößler, B. (2007): Untersuchungen zur Spritzwerkstoffeinbringung beim Dreikathoden-Plasmaspritzprozess, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 136-142. Chemnitz: Eigenverlag, 2007.

Denkena, B.; Kramer, N.; Behrens, B.-A.; Bistron, M.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A. (2007): Manufacturing of ceramic reinforced high precision forging dies, Proceedings of 4th International Conference and Exhibition on Design and Production of Machines and Dies/Molds, Cesme, Turkey, June 21-23, 2007, 2007.

Zeitschriften/Aufsätze

Kleiner, M.; Hermes, M.; Weber, M.; Olivier, H.; Gershteyn, G.; Bach, Fr.-W.; Brosius, A. (2007): Tube expansion by gas detonation, Prod. Eng. Res. Devel. Vol. 2007, Nr. 1, S. 9-17, 2007.

Braun, M.; Krause, C.; Bormann, D.; Stahl, J.; Schwab, B.; Kietzmann, M.; Bach, Fr.-W.; Lenarz, T.; {et al.} (2007): Untersuchungen zur Biokompatibilität von Magnesiumlegierungen als degradable Implantatwerkstoffe, Biomaterialien Vol. 8, Nr. 3, S. 183, 2007.

Bach, Fr.-W.; Möhwald, K.; Roxlau, C.; Hartz, K. (2007): Gießen im Mikromaßstab, Schweizer Maschinenmarkt, Nr. 24, S. 119-121, 2007.

Michaeli, W.; Kamps, T.; Schmachtenberg, E.; Lurz, A.; Vetter, K.; Schmiederer, D.; Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Piotter, V.; Prokop, J. (2007): Mit neuen Prozessketten zu wirtschaftlicher Mikrofertigung, Mikroproduktion, Nr. 4, S. 18-22, 2007.

Bernard, M.; Reimche, W.; Bach, Fr.-W. (2007): Zerstörungsfreie Bestimmung von Härtekennwerten zur Qualitätssicherung von Hochleis-tungsbauteilen in der Fertigung, HTM - Journal of Heat Treatment and Materials Vol. 62, Nr. 6, S. 265-273, 2007.

Biskup, C.; Bach, Fr.-W.; Bormann, D.; Kremer, G. (2007): Wasserabrasivstrahlen als medizinisches Werkzeug, Schweizer Maschinenmarkt, Ausgabe 14/15, 108. Jahrgang, Juli 2007, S. 62-63

Menneking, C.; Isemann, M.; Wissmann, G.; Klose, C.; Bormann, D.; Bach, Fr.-W.; Behrens, P. (2007): Neue poröse Chitosan-Kompositmaterialien, Biomaterialien Vol. 8, Nr. 3, S. 249.

Reimche, W.; Bach, Fr.-W.; Mroz, G.; Duhm, R. (2007): Setting of gradient material properties and quality control of high tension 3D-weld joints, Advanced Materials Research Vol. 22, S. 113-125, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M.; Deißer, T. A. (2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal Composites, The Welding Journal, Nr. 86, S. 373-378, 2007.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit Kupfer, Materialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.

Bach, Fr.-W.; Milenin, A.; Kucharski, R.; Bormann, D.; Kustra, P. (2007): The FEM simulation of a magnesium alloy wire drawing for chirurgical applications, Hutnik - Polish Journal of Metallurgy Vol. 74, Nr. 1-2, S. 8-11, 2007.

Heidenblut, T.; Möhwald, K.;Deißer, T. A.; Bistron, M.;Behrens, B.-A.;Bach, Fr.-W. (2007): Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron Microscope, Microscopy and Microanalysis, S. 104-105, 2007.

Bach, Fr.-W.; Holländer, U.; Möhwald, K.; Nicolaus, M. (2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folien, Schweißen und Schneiden, Nr. 2, S. 78-83, 2007.

Bach, Fr.-W.; Kremer, G.; Rümenapp, T.; Peter, D.; Brüggemann, P. (2007): Schneid- und Dekontiminationstechnologien für den kostengünstigen Rückbau kerntechnischer Anlagen, awt Vol. 52, Nr. 4, S. 256-262, 2007.

Kucharski, R.; Bach, Fr.-W.; Balzewicz, S.; Chlopek, J.; Bormann, D. (2007): Application of Ti-6Al-4V for Tissue Engineering, Engineering of Biomaterials, Nr. 69-72, S. 18-22, 2007.

Bach, Fr.-W.; Bormann, D.; Plorin, T. (2007): Developments for the Production of Locel Foamed Hollow Sections, Advanced Engineering Materials, Nr. 22, S. 37-47, 2007.

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Meyer-Lindenberg, A. (2007): Magnesium sponges as a bioabsorbable Material: Attributes and Challenges, Zeitschrift für Metallkunde: International Journal of Materials Research Vol. 98, Nr. 7, S. 609-612, 2007.

Heuer, W.; Elter, C.; Demling, A.; Neumann, A.; Suerbaum, S.; Hannig, M.; Heidenblut, T.; Bach, Fr.-W.; Stiesch-Stolz, M. (2007): Analysis of early biofilm formation on oral implants in man, Journal of Oral Rehabilitation Vol. 34, Nr. 5, S. 377-382, 2007.

Vortrag

Reimche, W.; Bach, Fr.-W. (2007): Zerstörungsfreie Prüfung und Bewertung von Beschichtungen: DGM Fortbildungsseminar: Moderne Beschichtungsverfahren, Dortmund, Dortmund, 13.-15. Nov. 2007.

Bach, Fr.-W.; Kremer, G. (2007): Trenntechnologie - eine wissenschaftliche und wirtschaftliche Herausforderung, 85 Jahre Kjellberg Finsterwalde - Pionier des Plasmaschneidens seit 1959. Finsterwalde, 20.09.2007.

2006

Konferenz

Bach, Fr.-W.; Schenk, A. (2006): Abrasive Water jet Cutting: Technology and Applications, International Conference on Cutting Technologies 2006, Hannover (D), 10th and 11th October 2006

Bach, Fr.-W.; Biskup, C.; Kremer, G.; Schenk, A.; Kirsch, L.; Schmolke, S. (2006): Temperature measurement during abrasive waer jet cutting of cortical bone blocs measured by thermocouples, 18th International Conference on Water Jetting, Danzig, Polen, September 2006, S. 203-212

Bach, Fr.-W.; Biskup, C.; Kremer, G.; Schenk, A.; Kirsch, L.; Schmolke, S. (2006): Möglichkeiten und Grenzen der Wasserstrahltechnik zur Bearbeitung von spongiösem Hartgewebe, Jahrestag der Schweizerischen, Deutschen und Österreichischen Gesellschaft für Biomedizinische Technik, Zürich, Schweiz, September 2006, S. 70

Bach, Fr.-W.; Schenk, A.; Kremer, G.; Biskup, C.; Meier, O.; Fargas, M.; Bunte, J.; Jäscke, P. (2006): Increase of erosive potential of water jets by laser pulsing, 18th International Conference on Water Jetting, Danzig, Polen, 13.-15. September 2006, S. 357-366

Jäschke, P.; Meier, O.; Fargas, M.; Bach, Fr.-W.; Schenk, A.; Biskup, C. (2006): Abtragen mit lasergepulsten Wasserstrahlen, Internationale Schneidtechnische Tagung 2006, Hannover, Deutschland, Oktober 2006, S.70-75

Krause, C.; Bormann, D.; Hassel, T.; Bach, Fr.-W.; Windhagen, H.; Krause, A.; Hackenbroich, C.; Meyer-Lindenberg, A.; Pekguleryuz, M. O. (Hrsg.) (2006): Mechanical Properties of Degradable Magnesium Implants in Dependance of the Implantation Duration, International Symposium on Magnesium Technology in the Global Age, S. 329-343. Montreal, Quebec, Canada: CIM, 2006.

Bach, Fr.-W.; Möhwald, K.; Engl, L.; Duda, T. (2006): Roughness Enhancement of HVOF Sprayed MCrAlY Bond Coatings for Adhesion Improvement of Ceramic Top Layers, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.

Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Duda, T.; Engl, L. (2006): Untersuchungen zum Hochgeschwindigkeitsflammspritzen von MCrAlY-Schichtsystemen mit angepasster Oberflächenrauheit, Tagungsband zum 3. GTV Kolloquium "Thermisches Spritzen", 09.06.2006, Luckenbach, 2006, S. 24-32, 2006.

Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Kolar, D. (2006): Thermal Spray Joining - Soldering and Filling of Aluminum Substrates under Atmospheric Conditions by a Combined Thermal Spray / Fusing Technique, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.

Hassel, Th.; Bach, Fr.-W.; Golovko, A.; Krause, C. (2006): Investigation of the mechanical properties and the corrosion behaviour of low alloyed magnesium–calcium alloys for use as absorbable biomaterial in the implant technique, Magnesium Technology in the global age. 45th Annual Conference of Metallurgists of CIM. Montreal, S. 359–370

Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.- A.; Bistron, M.  (2006): Maßnahmen zur Erhöhung der Verschleißresistenz von Gesenkmatrizen zum Präzisionsschmieden von Zahnrädern, Bernhard Wielage (Hg.): Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 // Verbundwerkstoffe und Werkstoffverbunde. Tagungsband zum 9. Werkstofftechnischen Kolloquium in Chemnitz, 7. bis 8. September 2006, Bd. 24. Chemnitz: TU, Lehrstuhl für Verbundstoffe, S. 505–511

Bach, Fr.-W. (Hg.)  (2006): CAMC und CAMG als Schneidtechnik für den Rückbau kerntechnischer Anlagen, Internationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und G. Kremer. KONTEC Gesellschaft für technische Kommunikation.

Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.  (2006): Ceramic-Metal Composites in Forging Applications in, Proceedings of the 3rd International Soldering and Brazing Conference IBSC2006, S. 73-78. Materials Park, OH 44073-0002: ASM International, 2006.

Bach, Fr.-W.; Versemann, R. (Hg.)  (2006): Plasma-Autogen-Pulver-Schneiden - Ein experimentelles Verfahren, International Conference on Cutting Technologies 2006. Unter Mitarbeit von Fr.-W. Bach, Th. Rümenapp und Thomas [Dipl -Ing ]. Joszko. Leibzig Universität Hannover, Institut für Werkstoffkunde; RWE Power AG.

Bach, Fr.-W.; Versemann, R. (Hg.)  (2006): Qualifizierung der Wasserabrasivinjektorstrahlverfahren für den Rückbau kerntechnischer Anlagen, Internationale Schneidtechnische Tagung 2006. Unter Mitarbeit von Fr.-W. Bach und D. Peter. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover; RWE Power AG.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2006): Modellierung der Stängelkristallitbildung beim Hartlöten am Beispiel des Werkstoffsystems Fe-C-Cu, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 400-406. Chemnitz: Eigenverlag, 2006.

Kucharski, R.; Cholewa-Kowalska, K.; Chlopek, J.; Bach, Fr.-W.; Bormann, D. (2006): Resorbable Composite Based on Magnesium and Bioglass for Treating the Osseous Tissue, Biomaterials in Regenerative Medicine. Proceedings of the International Conference. Wien, 22. - 25.10.2006. Polish Academy of Sciences; Scientific Centre in Vienna. Wien, S. 109–112

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2006): Niedrig schmelzende Glaslote auf Phosphatbasis zum Fügen von Aluminium-Keramik-Verbunden, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 430-435. Chemnitz: Eigenverlag, 2006.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2006): Heating behaviour of differently tempered forged aluminium alloy components in a flame brazing process, Tagungsband zum "4. International Congress Aluminium Brazing, 16t - 18th May 2006". Düsseldorf: Aluminium-Verlag, 2006.

Bormann, D.; Bach, Fr.-W.; Krause, C.; Plorin, T.; Krause, A.; Hackenbroich, C.; Höh, N. v. d.; Meyer-Lindenberg, A. (2006): Strukturanalyse von orthopädischen und kardivaskulären Implantaten mittels Micro-Computertomographie, Aktuelle Implantatentwicklung - Funktionalisierung von Materialien, S. 12-13: DECHEMA, Februar 2006.

Zeitschriften/Aufsätze

Chlopek, J.; Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2006): New resorbable metal and polymer implants for bone surgery, Materialy i Technologie, Nr. 4, S. 57-62, 2006.

Krause, C.; Gretzki, T.; Nürnberger, F.; Schaper, M.; Bach, Fr.-W. (2006): Messung der Spraycharakteristik zur Bestimmung des Wärmeübergangskoeffizienten bei der Spraykühlung, Forschung im Ingenieurwesen, Springer Verlag Vol. 70, Nr. 4, S. 237-242, 2006.

Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Krause, C.; Grydin, O. (2006): Bestimmung der Streckgrenze und der Hall-Petch-Konstanten des Vergütungsstahles 42CrMo4 unterschiedlichen Gefügezustandes mittels Eindruckprüfungen, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 8, S. 668-673, 2006.

Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Krause, C.; Broer, O. (2006): Simulation des Abschreckhärtens mittels Spraykühlung~- Wärmeübergang, Gefüge und Härte, HTM Vol. 61, Nr. 3, S. 142-147, 2006.

Witte, F.; Reifenrath, J.; Müller, P. P.; Crostack, H.-A.; Nellsen, J.; Bach, Fr.-W.; Bormann, D.; Rudert, M. (2006): Cartilage repair on magnesium implants as scaffolds used as subchondral bone replacement, Materialwissenschaft und Werkstofftechnik Vol. 37, Nr. 6, S. 504-508, 2006.

Biskup, C.; Krömer, S.; Höver, M.; Versemann, R.; Bach, Fr.-W.; Kirsch, L.; Andreae, A.; Pude, F.; Schmolke, S. (2006): Heat Generation During Abrasive Water-Jet Osteotomies Measured by Thermocouples, Journal of Mechanical Engineering, Vol. 52, No. 7-8, July/Aug.2006, S. 451-457

Bach, Fr.-W.; Möhwald, K.; Engl, L.; Drößler, B.; Hartz, K. (2006): Particle Image Velocimetry in Thermal Spraying, Advanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2006): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, Schweißen und Schneiden, Nr. 2, S. 84-90, 2006.

Bach, Fr.-W.; Kucharski, R.; Bormann, D. (2006): Magnesium Compound Structures for the Treatment of Bone Defects, Engineering of Biomaterials, Nr. 56-57, S. 58-61, 2006.

Bach, Fr.-W.; Kucharski, R.; Bormann, D.; Besdo, D.; Besdo, S.; Hackenbroich, C.; Thorey, F.; Meyer-Lindenberg, A. (2006): Design and Resorption Properties of the Metal bone Implants: Application in-vivo, Engineering of Biomaterials, Nr. 56-57, S. 54-58, 2006.

Krause, C.; Scheer, C.; Nürnberger, F.; Reimche, W.; Bach, Fr.-W. (2006): Annealing of the edge-layer of precision forged gears of 42CrMo4 by a two-phase spray cooling, Vestnik NTUU KPI, Nr. 48, S. 33-36, 2006.

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Jendras, M.; Windhagen, H.; Hackenbroich, C.; Krause, A.; Meyer-Lindenberg, A. (2006): Resorbowalne, metaliczne implanty kostne/Resorbing Metallic Bone Implants, Orthopedic Quarterly, Nr. 2, S. 105-110, 2006.

Patentschriften

Bach, Fr.-W.; Bautsch, T.; Guenther, A.; Olfe, J.; Tai Phan-Tan; Wilk, P. (2006): Verfahren zum elektrochemischen Entschichten von Bauteilen, Veröffentlichungs-Nummer EP000001706522A1

Weber, J.; Schaper, M.; Bach, Fr.-W. (2006): Schaumgiessverfahren sowie eine druckdicht verschliessbare Giessform zur Herstellung von Formteilen , Veröffentlichungs-Nummer EP000001482062B1

Vortrag

Bach, Fr.-W.; Holländer, U.; Kruzhanov, V.; Möhwald, K.; Nicolaus, M. (2006): Formation of columnar microstructure when brazing steels of different carbon content with copper filler metal - a thermodynamic model, Hannover-Messe 2006, Werkstoffforum: CD, 2006.

Bach, Fr.-W.; Biskup, C.; Kremer, G.; Kirsch, L.; Schmolke, S. (2006): P88 Möglichkeiten und Grenzen der Wasserstrahltechnik zur Bearbeitung von spongiösem Hartgewebe, Institut für Werkstoffkunde, Universität Hannover; Medizinische Hochschule Hannover, Orthopädische Klinik; Orthopädisches Rehabilitationszentrum Annastift e.V., Orthopädische Klinik, 2006.

2005

Konferenz

Bach, Fr.-W.; Nürnberger, F.; Krause, Ch.; Schaper, M.; Grydin, O.  (2005): Simulation von Gefügeumwandlungen beim Abschreckhärten aus der Schmiedewärme mittels Zweiphasenströmung, Univ.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 117–122

Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Lugscheider, E. (2005): Qualification of a Modified Triplex II Plasma Gun for Processing of Liquid Precursors and Wire- or Powder Shaped Spray Materials under Controlled Atmosphere, Conference Proceedings ITSC 2005. Düsseldorf: DVS-Verlag GmbH, 2005.

Biskup, C.; Krömer, S.; Höver, M.; Versemann, R.; Bach, Fr.-W.; Kirsch, L.; Andreae, A.; Pude, F.; Schmolke, S.; (2005): Heat generation during abrasive water jet oesteotomies measuered by thermocouples, 8th International Conference on Management of Innovative Technologies, Fiesa, Slovenia, 2005

Biskup, C.; Pude, F.; Schenk, A.; Schmolke, S.; Kuhlmann, C.; Krömer, S.; Andreae, A.; Kirsch, L. (2005): Erste klinische Überprüfung der Andwendbarkeit des Wasserabrasivstrahls als Osteotomiewerkzeug im Tierversuch, Biomechanica 2005, Hamburg, Deutschland, März 2005, S. 173

Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Lugscheider, E. (2005): Self propagating high temperature synthesis of aluminium-matrix-composite coatings by means of atmospheric plasma spraying, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.

Lugscheider, E.; Bach, Fr.-W.; Bobzin, K.; Möhwald, K.; Parco, M.; Richardt, K.; Engl, L. (2005): New approaches concerning the enhancement of wear and corrosion resistance of magnesium parts by thermally sprayed coating systems, K.-D Bouzakis (Hg.): Tagungsband zur Konferenz THE Coatings, 5.-7. Oktober 2005, Thessaloniki, Griechenland // 5th International Conference "the coatings" on Manufacturing Engineering and Eureka partnering event. Thessaloniki: Ed. Ziti, S. 241–248

Bach, Fr.-W.; Schaper, M.; Bosse, M.; Gershteyn, G.; Nowak, M.  (2005): Casting of Magnesium alloys with magnetic properties, First International Conference and Exhibition Magnesium - Broad Horizons, S. 16-19. Moscow, Russia, 2005.

Bach, Fr.-W.; Schaper, M.; Krause, Ch.; Nürnberger, F.  (2005): Heat treatment of precision forged steel gears by usage of the forging heat, Sučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 488–493

Bach, Fr.-W.; Schaper, M.; Nürnberger, F.; Grydin, O. (2005): Simulation of the microstructure transformation during quenching, Sučasni problemy metalurhiï. Naukovi visti. Plastyčna deformacija metaliv. Nacional'na metalurhijna akademija Ukraïny. Dnipropetrovs'k (8), S. 27–31

Bach, Fr.-W.; Möhwald, K.; Engl, L.; Lugscheider, E.; Parco, M. (2005): Properties of thermally sprayed coatings on magnesium parts for enhancement of wear and corrosion resistance, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.

Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R.  (2005): Non- vakuum Elektronenstrahlschweißen von dünnwandigen Strukturbauteilen, DVM Tag 2005 "Dünnwandige Strukturbauteile" Berlin. DVM.

Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005): Nonvakuum-Elektronenstrahlfügen von Stahl-Aluminium-Hybridstrukturen, Berichtskolloquium der DFG-Forschergruppe 505 Hochleistungsfügetechnik für Hybridstukturen. Forschergruppe Grundlagen der Warmblechumformung von Höchstfesten Vergütungsstählen. Garbsen: PZH, Produktionstechnisches Zentrum

Bach, Fr.-W.; Jäger, S.; Konja, R.; Lau, K.; Versemann, R.  (2005): Elektronenstrahlschweißen von Feinblechen an Atmosphäre, : Heinz Palkowski (Hg.): Fünftes Industriekolloquium SFB 362 "Fertigen in Feinblech". Abschlusskolloquium Werkstoffe - Verfahren - Konzepte, 23. und 24. November 2005, Aula der Technischen Universität Clausthal. Industriekolloquium Fertigen in Feinblech. Clausthal-Zellerfeld: Techn. Univ. Clausthal.

Bach, Fr.-W.; Versemann, R.; Schenk, A.; Schuster, B.  (2005): Bearbeitung von Hybridmaterialien mit dem Wasserstrahl, Congress Intelligente Leichtbau Systeme

Hassel, Th.; Bach, Fr.-W.; Krause, C.; Wilk, P.  (2005): Corrosion protection and repassivation after the deformation of magnesium alloys coated with a protective magnesium fluoride layer, Neal R. Neelameggham, Howard I. Kaplan und Bob Ross Powell (Hg.): Magnesium technology 2005. Proceedings of the symposium. Warrendale, Pa: TMS, S. 485–490.

Scheer, Ch.; Reimche, W.; Peter, D.; Bach, Fr.-W.; Südmersen, U.  (2005): Qualitätssicherung und Produktivitätssteigerung in Produktionsanlagen am Beispiel Wasserabrasivstrahlschneiden, 15. Kolloquium Schallemission. DGZfP

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P.  (2005): Production and Properties of Foamed Magnesium, R. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 77–80

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P.; Lugscheider, E. (Hrsg.) (2005): Herstellung und Eigenschaften von Magnesiumschäumen, E. Lugscheider (Hg.): Innovative Werkstofftechnologie. 12. Werkstoffwissenschaftliches Kolloquium. Aachen 10.12.2004. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie. Aachen, S. 72–77

Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2005): Development of a technique for hard coating of component parts by synthesis of silicon carbide in thermal spray processes, Erich Lugscheider (Hg.): Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.

Bach, Fr.-W.; Bormann, D.; Kucharski, R.; Wilk, P.  (2005): Detachable Fasteners for Aluminium Foams, R. -Fr Singer, C. Körner, V. Altstädt und H. Münstedt (Hg.): Cellular metals and polymers. Proceedings of the Symposium on Cellular Metals and Polymers. Fürth 12. - 14.10.2004. Symposium on Cellular Metals and Polymers: Uetikon-Zürich; Trans Tech Publications, S. 181–184

Bach, Fr.-W.; Möhwald, K.; Drößler, B.  (2005): Verbindungsspritzen - ein hybrides Fügeverfahren aus thermischem Spritzen und Umschmelzen, Univ.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 157–163

Beiträge in Büchern

Möhwald, K.; Holländer, U.; Laarmann, A.  (2005): Einsatz von Beschichtungsverfahren in der Löttechnik, Fr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286

Bach, Fr.-W.; Hassel, Th.  (2005): Herstellung und Deformationsanalyse zur Qualifizierung einer Schutzschicht aus Magnesiumfluorid zur gesteuerten Degration von Implantatlegierungen auf Magnesiumbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).

Verschiedenes

Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005): Non Vacuum Electron Beam Welding of zinc coated high-strength steels, , 2005.

Bach, Fr.-W.; Beniyash, A.; Lau, K.; Versemann, R. (2005): Joining of steel-aluminium hybrid structures with electron beam on atmosphere, , 2005.

Zeitschriften/Aufsätze

Bach, Fr.-W.; Nürnberger, F.; Philipp, K.; Schaper, M. (2005): Statistische Beschreibung der Tropfengrößenverteilung bei stationären Zerstäubungsprozessen., Forschung im Ingenieurwesen Vol. 69, Nr. 3, S. 181-186, 2005.

Bach, Fr.-W.; Nürnberger, F.; Krause, C. (2005): Außen hart und Innen weich - Randschichtvergüten durch Zweiphasenspray, phi - Produktionstechnik Hannover informiert Vol. 6, Nr. 4, S. 10-11, 2005.

Bach, Fr.-W.; Nürnberger, F.; Broer, O.; Schaper, M.; Grydin, O. (2005): Simulation of the microstructure transformation in quenched gears after precision forging of the tempering steel 42CrMo4, Metallurgiceskaja i gornorudnaja promyvlennost' Vol. 232, Nr. 4, S. 48-51, 2005.

Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Engl, L. (2005): Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter Beschichtungen, Materialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.

Bach, Fr.-W.; Hassel, Th.; Golovko, O.; Hackenbroich, A.; Meyer-Lindenberg, A.  (2005): Resorbierbare Implantate aus Magnesium durch Mikrolegieren mit Calcium, deren Verarbeitung und Eigenschaften, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).

Peuster, M.; Hassel, Th.; Bormann, D.; Wilk, P.; Heinze, T.; Bach, Fr.-W. (2005): Ionen-Leakage aus Implantaten führt zu Materialversagen und Inflammation des peri-Implantat Gewebes, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).

Peuster, M.; Hassel, Th.; Mueller, P.; Bormann, D.; Hauser, H.; Bach, Fr.-W. (2005): Korrosion kardiovaskulärer Implantate auf Wolframbasis, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6).

Bach, Fr.-W.; Behrens, B.-A.; Rodman, M.; Rossberg, A.; Kurz, G. (2005): Macroscopic damage by the formation of shear bands during the rolling and deep drawing of magnesium sheets, JOM Journal of the Minerals, Metals and Materials Society 57 (5), S. 57–61.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2005): Ultraschallassistiertes Flammlöten von Aluminiumlegierungen, Schweißen und Schneiden, Nr. 9, S. 482-487, 2005.

Bach, Fr.-W.; Hassel, T.; Bormann, D.; Kucharski, R. (2005): Elektrochemisch induzierte Abscheidung von Calciumphosphat auf der Oberfläche von kompakten und zellularen Strukturen aus Magnesiumlegierungen, R. Thull und R. Gradinger (Hg.): Bio materialien - Interdisciplinary Journal of Functional Meterials, Biomechanics and Tissue Engineering. DGBM (6)

Bach, Fr.-W.; Kremer, G.; Versemann, R.; Chlipik, J. (2005): Calculation of the flow field during contact arc metal cutting under water, Welding and Cutting Vol. 4, Nr. 4, 2005.

Vortrag

Bach, Fr.-W.; Brüggemann, P.; Schenk, A. (2005): Water Jet Cutting and Dry Ice Blasting as Tools in the Automotive Industry, ,2005

2004

Konferenz

Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Engl, L. (2004): Corrosion Protective Coatings by Modified Underwater Plasma Spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.

Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Horstmann, R. (2004): Verarbeiten von kolloidal gelösten Nanopartikeln durch Thermisches Spritzen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18. Chemnitz: Eigenverlag, 2004.

Bach, Fr.-W.; Möhwald, K.; Schäpers, M.; Bouzakis, K. D. (Hrsg.) ; Denkena, B. (Hrsg.) ; Geiger, M. (Hrsg.) ; Toenshoff, H. K. (Hrsg.) ; Bach, Fr.-W. (Hrsg.) ; Popp, U. (Hrsg.) (2004): Aspects of PVD-Coatings of Plasma Nitratet Tool Steels, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 103-109. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.

Tillmann, W.; Vogli, E.; Rechlin, R.; Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T. (2004): Manufacturing diamond impregnated tools for stone machining through thermal spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.

Bach, Fr.-W.; Möhwald, K.; Engl, L.; Kolar, D. (2004): An Alternative Coating Process Underwater Plasma Spraying, Tagungsband zum 12. Plasma Technik Workshop Ilmenau, S. 81-88, 2004.

Bach, Fr.-W.; Möhwald, K.; Engl, L.; Labod, B.; Lugscheider, E.; Parco, M. (2004): Thermisch gespritzte Schichtsysteme zur Erhöhung des Verschleiß- und Korrosionsschutzes von Magnesiumbasis-Legierungen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18, S. 17-23. Chemnitz: Eigenverlag, 2004.

Haferkamp, H.; Bach, Fr.-W.; Bunte, J.; Versemann, R.; Flade, K.; Meier, O.; Bormann, A. (2004): Laser- und Nonvakuum-Elektronenstrahlschweißen von höherfesten Stahlwerkstoffen., 4. Industriekolloquium SFB 362. DFG

Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004): Thermally sprayed filler metal coatings for high temperature brazing, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004 // Thermal spray 2004. Advances in technology and application, 10-12 May 2004, Osaka, Japan : proceedings of the International Thermal Spray Conference. Materials Park, Ohio: ASM International

Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Rothardt, T.; Bouzakis, K. D.; Denkena, B.; Geiger, M.; Toenshoff, H. K.; Popp, U. (2004): State of the Art and Future Trends in Thermal Spraying, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 41-55. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.

Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Lugscheider, E.; Parco, M.; Dicks, R. (2004): Thermally Sprayed Coatings on Mg Alloys for Improved Wear and Corrosion Resistance, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 425-434. Friedrich-Alexander-Universität Erlangen-Nürnberg: Verlag, 2004.

Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004): Beschichtungsverfahren als leistungsfähige Alternative zu konventionellen Lotapplikationstechniken, Tagungsband zu "Oberflächentage 2004", 7. Mehrländertagung der Deutschen Gesellschaft für Galvano- und Oberflächentechnik e. V. am 22.-24.09.2004 in Dresden, S. 13-19, 2004.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2004): Flussmittelfreies Flammlöten von Aluminiumlegierungen durch Ultraschallunterstützung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 358-361. Düsseldorf: DVS-Verlag GmbH, 2004.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2004): Flussmittelfreies Hartlöten dünnwandiger Titanlegierungen mit partieller Erwärmung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 362-364. Düsseldorf: DVS-Verlag GmbH, 2004.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2004): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 353-357. Düsseldorf: DVS-Verlag GmbH, 2004.

Bach, Fr.-W.; Demmler, A.; Möhwald, K.; Bach, C. (2004): Neue Lotapplikationstechniken mittels Thermischer Spritzverfahren, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 35-37. Düsseldorf: DVS-Verlag GmbH, 2004.

Bach, Fr.-W.; Kutku, I.; Möhwald, K.; Deißer, T. A.; Weinert, K.; Peters, C. (2004): Hochleistungswerkzeuge aus Keramik-Metall-Werkstoffverbunden, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 300-303. Düsseldorf: DVS-Verlag GmbH, 2004.

Verschiedenes

Bach, Fr.-W.; Biena, H.; Rümenapp, T.; Versemann, R. (2004): Forschungs- und Entwicklungsarbeiten im Bereich der Schneid- und Abragetechnik, , 2004.

Zeitschriften/Aufsätze

Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2004): Particle Image Velocimetry in Thermal Spraying, Materials Science and Engineering A, S. 146-152., 2004.

Wielage, B.; Lampke, T.; Lugscheider, E.; Ernst, F.; Janssen, H.; Bach, Fr.-W.; Schäpers, M.; Möhwald, K. (2004): Schutzschichten für Lötmaschinen zum bleifreien Löten, Schweißen und Schneiden, Nr. 5, S. 244-248, 2004.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2004): Precision brazing processes for MEMS technology, Welding and Cutting, Nr. 6, S. 340-342, 2004.

Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2004): Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work step, Welding and Cutting, Nr. 2, 2004.

Bach, Fr.-W.; Kremer, G.; Versemann, R.; Redeker, C.; Lindemaier, J. (2004): Brechnung des Strömungsfelds beim Kontakt-Lichtbogen-Metallschneiden unter Wasser, Welding and Cutting Vol. 56, Nr. 11, S. 586-592, 2004.

Bach, Fr.-W.; Beniyash, A.; Flade, K.; Versemann, R. (2004): Non-Vacuum-Electron-Beam-Welding - A BEAM PROCESS FOR WELDING ZINC COATED HIGH-STRENGTH STEELS AND STEEL-ALUMINIUM HYBRID STRUCTURES, Laser Assisted Net Shape Engineering Vol. 4, 2004.

Patentschriften

Wirth, C. J.; Windhagen, W.; Schmolke, S.; Witte, F.; Kirsch, L.; Bach, Fr.-W.; Louis, H.; Pude, F.; Kaese, V.; Wilk, P. (2004): Verfahren und Vorrichtung zum Strahlschneiden von Gewebe, Veröffentlichungs-Nummer EP000001460949A1

Bach, Fr.-W.; Phan-Tan Tai; Haferkamp, H.; Kaese, V. (2004): Magnesium-Werkstück und Verfahren zur Ausbildung einer Korrosionsschützenden Deckschicht eines Magnesium Werkstücks, Veröffentlichungs-Nummer EP000001458900A1

Vortrag

Bach, Fr.-W.; Nürnberger, F.; Schaper, M. (2004): Gefügemodellierung beim Abschreckhärten mittels Spraykühlung., Werkstoffwoche. {DKG, DGM und VDI}. München, 21.-23.09.2004.

2003

Konferenz

Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2003): Particle Image Velocimetry Thermal Spraying, SDMA/ICSF 2003 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June, S. Kapitel 7, S. 115-126. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.

Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Babiak, Z. (2003): Advantages of reactive spraying by simultaneous self-propagating high temperature synthesis (SHS), IWW Annual Assembly 2003.

Bach, Fr.-W.; Möhwald, K.; Schäpers, M. (2003): Aspekte der PVD-Beschichtung plasmanitrierter Werkzeugstähle, Tagungsband zur 5. Industriefachtagung "Oberflächen- und Werkstofftechnik" und zum 6. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und Werkstofftechnische Anwendungen Vol. 16, S. 265-270. Chemnitz: Eigenverlag, 2003.

Bach, Fr.-W.; Tegeder, G.; Babiak, Z.; Prehm, J.; Rothardt, T. (2003): State of the Art of Thermal Spraying, 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.

Bach, Fr.-W.; Wilk, P.; Bormann, D. (2003): Cellular Magnesium: Magnesium mit zellenförmiger Struktur, MetFoam. Cellular Metals: Manufacture, Properties, Applications. International Conference Berlin 23. - 25.06.2003. Berlin: Metall Innovation Technologie MIT, S. 255–258

Bach, Fr.-W.; Versemann, R.; Biena, H.; Kremer, G.  (2003): CAMX - A High Performance Cutting Technique for Underwater Use. , WM´03 Conference

Bach, Fr.-W.; Babiak, Z.; Möhwald, K.; Rothardt, T. (2003): Wlasnosci warstw kompozytowych natryskiwanych gazowo-detonacyjnie na podloza stopów lekkich na osnowie Al i Mg, Proc. Conf. "Modern Wear and Corrosion Resistant Coatings Obtained by Thermal Spraying", Warschau, 2003, 2003.

Beiträge in Büchern

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Deutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143

Verschiedenes

Bach, Fr.-W.; Szelagowski, A.; Versemann, R.; Zelt, M. (2003): Non vacuum electron beam welding of light sheet metals and steel sheets, , 2003.

Zeitschriften/Aufsätze

Wielage, B.; Lugscheider, E.; Bach, Fr.-W.; Möhwald, K. (2003): Oberflächentechnik für moderne Lötanlagen für bleifreie Lote, Der Praktiker, Nr. 4, S. 116ff., 2003.

Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T.; Formanek, B. (2003): Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide Matrix, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.

Bach, Fr.-W.; Möhwald, K.; Droessler, B.; Prehm, J.; Rothardt, T.; Copitzky, T. (2003): Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, in, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003): Partial-heating brazing of thin components made of titanium alloys, Welding and Cutting, Nr. 6, S. 340-342, 2003.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003): Hartlöten dünner Bauteile aus Titanlegierungen mit partieller Erwärmung, Schweißen und Schneiden, Nr. 8, S. 432-435, 2003.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2003): Präzisionslötverfahren für die MEMS-Technik, Schweißen und Schneiden, Nr. 12, S. 672-674, 2003.

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Jahrbuch Schweißtechnik 2003, S. 138-143, 2003.

Bach, Fr.-W.; Schaper, M.; Jaschick, C. (2003): Influence of lithium on hcp magnesium alloys, Trans Tech Publ Materials Science Forum (419-422), S. 1037–1042.

Bach, Fr.-W.; Beniyash, A.; Flade, K.; Szelagowski, A.; Versemann, R. (2003): Nonvakuum-Elektronenstrahlschweißen - Ein Hochleistungsverfahren zum Fügen von Magnesium- und Aluminiumwerkstoffen, Metall 57, 2003.

Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2003): Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem Arbeitsschritt, Schweißen und Schneiden, Nr. 10, S. 560-565, 2003.

Patentschriften

Kaese, V.; Haferkamp, H.; Pinkvos, A.; Niemeyer, M.; Bach, Fr.-W. (2003): Verfahren zur Herstellung von bioresorbierbaren röhrenförmigen Metallimplantaten, Veröffentlichungs-Nummer EP000001338293A1

2002

Haferkamp, H.; Bach, Fr.-W.; Goede, Martin; Versemann, R.; Bormann, D.; Szelagowski, A.; Zelt, M. (2002): Hochleistungsstrahlverfahren für das Fügen von Feinblechen, Drittes Industriekolloquim SFB 362. DFG. Clausthal-Zellerfeld, 06.02.2002.

Konferenz

Rother, B.; Bach, Fr.-W.; Bormann, D.; Baumgärtner, F.; Balzer, H. (2002): Oxide Coated Transparent Aluminum Foaming Moulds, Proceedings of Materials Week 2002. München 30.09. - 02.10.2002: Werkstoff-Informationsgesellschaft

Haferkamp, H.; Bach, Fr.-W.; Goede, Martin; Versemann, R.; Bunte, J.; Bormann, D. et al.  (2002): Hochleistungsstrahlverfahren für moderne Schweißkonstruktionen, 2. Intensivseminar Elektronenstrahltechnik. mi information center. Landsberg: verlag moderne industrie.

Bach, Fr.-W. (Hg.). Unter Mitarbeit von St. Brandt, P.-T. Chuong, H. Louis, M. Mohamed, F. Pude, Christoph von Rad und A. Schenk.  (2002): Internationale Schneidtechnische Tagung 2002. Wasserstrahltechnologie im 21. Jahrhundert - ein Ausblick auf Forschritt und künftige Entwicklungsfelder, Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation

Bach, Fr.-W.; Versemann, R. (Hg.)  (2002): Abrasive waterjet technology in aerospace and aircraft manufacturing industries. Wasserabrasivstrahltechnologie für die Luft- und Raumfahrtindustrie., Internationale Schneidtechnische Tagung 2002. Unter Mitarbeit von Ch. Biskup, F. Pude, E. Zheng, F. Chen und E. Siores. Leibzig Universität Hannover, Institut für Werkstoffkunde, Hannover. Hamburg: Kontec Gesellschaft für technische Kommunikation.

Bach, Fr.-W.; Engl, L.; Möhwald, K.; Rothardt, T.; Josefiak, L. A. (2002): Partikeldiagnostik mittels Particle Image Velocimetry (PIV) beim Hochgeschwindigkeitsflammspritzen, Tagungsband des GTV-Kolloquiums 2002, Luckenbach, S. 21-32, 2002.

Zeitschriften/Aufsätze

Haferkamp, H.; Bach, Fr.-W.; Bußmann, M.; Kaese, V.; Möhwald, K.; Niemeyer, M.; Schreckenberger, H.; Phan-tan, T. (2002): Magnesiumkorrosion - Prozesse, Schutz von Anode und Kathode, Magnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.

2001

Konferenz

Bach, Fr.-W.; Versemann, R.; Niemeyer, M.; Zeit, M.; Szelagowski, A. (2001): Non-Vakuum-Elektronenstrahlschweißen an Al- und Mg-Feinblechen, Tagungsband zur 5. Konferenz „Strahltechnik“ am 27. und 28. November 2001, S. 46–53

Bach, Fr.-W.; Möhwald, K.; Berthold, M.; Gundlfinger, K. (2001): Untersuchungen zum industriellen Weichlöten von Kupfer an Rotguß, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 5-10. Düsseldorf: DVS-Verlag, 2001.

Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2001): Flußmittelfreies Löten von Aluminiumlegierungen mit Schutzgasaktivatoren, DVS (Hg.): Tagungsband zur “Löt 2001”, 6. Internationales Kolloquium, Bd. 212. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH (212), S. 375–379

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Duda, T. (2001): Neue Lösungsansätze zum Löten von Aluminiumlegierungen mit artgleichen und nicht artgleichen Fügepartnern, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 231-235. Düsseldorf: DVS-Verlag, 2001.

Bach, Fr.-W.; Szelagowski, A.; Versemann, R.; Zelt, M. (2001): Non-Vakuum-Elektronenstrahlschweißen: Ein Verfahren zum Fügen von Feinblechen, E. Lugscheider (Hg.): 9. Werkstoffwissenschaftliches Kolloquium Innovative Werkstofftechnologie 2001. VDI. Aachen: VDI-Gesellschaft Werkstofftechnik, S. 59–67

Bach, Fr.-W.; Haferkamp, H.; Niemeyer, M.; Bormann, D.  (2001): Casting Process for Foamed Magnesium, J. Banhart, M. F. Ashby und N. A. Fleck (Hg.): Cellular Metals and Metal Foaming Technology. Bremen 18. - 20.06.2001. Bremen: Metall Innovation Technologie MIT, S. 175–180

Bach, Fr.-W.; Berthold, M.; Crostack, H.-A.; Yanik, A. (2001): Prozessdiagnose und -regelung beim Löten mittels Ultraschall, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, S. 329-334. Düsseldorf: DVS-Verlag, 2001.

Zeitschriften/Aufsätze

Bach, Fr.-W.; Weinert, K.; Möhwald, K.; Nakhosteen, B.; Peters, C.; Schulte, M. (2001): Keramik-HM-Bohrer für kleine Durchmesser, Werkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.

Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Weinert, K. (2001): Hartstoffschichten in der Spanenden Fertigung, Spanende Fertigung, S. 287-298, 2001.

Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2001): Entwicklung einer neuen Metallgießtechnik für die Mikromechanik, Zeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.

Patentschriften

Feinler, S.; Moehwald, K.; Bach, Fr.-W. (2001): Einhand-Lötgerät mit integriertem Lötdepot und dosierbarem Lötangebot , Veröffentlichungs-Nummer EP000001162020A2

Haferkamp, H.; Bach, Fr.-W.; Niemeyer, M.; Lindner, P.; Bohling, P.; Juchmann, P. (2001): Verfahren und Vorrichtung zur Handhabung von Metallschmelzen, insbesondere von Magnesium und Magnesiumlegierungen, Veröffentlichungs-Nummer EP000001068036A1

2000

Konferenz

Bach, Fr.-W.; Möhwald, K.; Gatzen, H.-H.; Morsbach, C.; Lugscheider, E. (Hrsg.) (2000): Metall-Kapillardruckgießen: Ein neues Urformverfahren für die Mikromechanik, E. Lugscheider (Hg.): 7. Werkstoffwissenschaftliches Kolloquium - Innovative Werkstofftechnologie 1999, Werkstoffwissenschaftliche Schriftenreihe. Aachen: Shaker Verlag (41), S. 67–73

Bach, Fr.-W.; Haferkamp, H.; Bormann, D.; Niemeyer, M.; Clyne, T. W. (Hrsg.) (2000): Casting Process for the Production of Foamed Magnesium Structural Parts, T. W. Clyne (Hg.): Metal matrix composites and metallic foams. Euromat 1999 European Congress on Advanced Materials and Processes, München 27. - 30.09.1999. Weinheim: Wiley-VCH (5), S. 46–50

Beiträge in Büchern

Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Holländer, U. (2000): Oberflächenbehandlung und thermochemische Stabilität von Magnesiumlegierungen, Magnesium-Taschenbuch, S. 308-311,

Vortrag

Bach, Fr.-W.; Kruzhanov, V.; Möhwald, K.; Zeitz, V. (2000): Joining of metal foams using foamable filler metals, Proceedings of materials week 2000, 25-28 Sept. 2000, Munich, 2000.

1999

Konferenz

Möhwald, K.; Morsbach, C.; Bach, Fr.-W.; Gatzen, H.-H. (1999): Investigations on Capillary Action Microcasting of Metals, 1st International Conference and General Meeting of the European Society for Precision Engineering and Nanotechnology, Bremen, Germany, S. 490-493, 1999.

Zeitschriften/Aufsätze

Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Bußmann, M. (1999): Dünnschichttechnologie - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.

Bach, Fr.-W.; Steffens, H.-D.; Reusch, B.; Möhwald, K.; Fathi, M.; Hildebrandt, L. (1999): Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von Modellsystemen, Metallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.

Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999): Löten - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.

Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999): Gelötete Metall-Keramik-Verbunde, Metallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.

1998

Konferenz

Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Meininghaus, T.; Berthold, M. (1998): Fluß-mittelfreies Löten von Leichtmetall/Stahl-Verbindungen, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 206-210, 1998.

Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M.; Meininghaus, T. (1998): Anwendungsorientierte Lotentwicklung, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 48-51, 1998.

1997

Konferenz

Haferkamp, H.; Bach, Fr.-W.; Burmeister, I.; Kreutzburg, K.; Niemeyer, M.  (1997): Nd: YAG laser beam welding of magnesium constructions, G. W. Lorimer (Hg.): Proceedings of the Third International Magnesium Conference. 10-12 April 1996, Manchester, UK. London: Institute of Materials, S. 89–98.

1990

Patentschriften

Eschnauer, H.; Meinhardt, H.; Lugscheider, E.; Eichhorn, F.; Bach, Fr.-W. (1990): Multi-Komponenten-Verbund-Schweisspulver sowie Vefahren zu seiner Herstellung. , Veröffentlichungs-Nummer EP000000411380A1