InstitutUnser Team
Apl. Prof. Dr.-Ing. habil. Kai Möhwald

apl. Prof. Dr.-Ing. habil. Kai Möhwald

apl. Prof. Dr.-Ing. habil. Kai Möhwald
Stockumer Straße 28
58453 Witten
Stockumer Straße 28
58453 Witten



  • Schöler, S.; Langohr, A.; Özkaya, F.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2021): Investigations of hot-dip galvanized dual-phase steel (DP600+Z) sheet metal on selectively oxidized tool steel surfaces under dry deep-drawing conditionsWear XII, 2021, 203742
    DOI: 10.1016/j.wear.2021.203742
  • Schöler, S.; Kock, C.; Özkaya, F.; Nowak, C.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2020): Numerical Simulation of the Abrasive Wear Behavior of Selectively Oxidized α-Fe2O3 Oxide Layers on Tool Steel SurfacesJOM 72, 2020 (7), 2536-2547
    DOI: 10.1007/s11837-020-04172-x
  • Schöler, S.; Schmieding, M.; Heimes, N.; Pape, F.; Behrens, B.-A.; Poll, G.; Möhwald, K. (2020): Characterization of Molybdenum Based Coatings on 100Cr6 Bearing Steel SurfacesTribology Online 15, 2020 (3), 181-185
    DOI: 10.2474/trol.15.181
  • Holländer, U.; Wulff, D.; Langohr, A.; Möhwald, K.; Maier, H. J. (2019): Brazing in SiH4-Doped Inert Gases - A New Approach to an Environment Friendly Production ProcessInt. J. of Precis. Eng. and Manuf.-Green Tech. 495, 2019 (1), 187
    DOI: 10.1007/s40684-019-00109-1
  • Schöler, S.; Schmieding, M.; Yilkiran, D.; Özkaya, F.; Nowak, C.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2019): Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfacesWear 426-427, 2019, 1603-1615
    DOI: 10.1016/j.wear.2019.01.009
  • Strauß, C.; Gustus, R.; Maus-Friedrichs, W.; Schöler, S.; Holländer, U.; Möhwald, K. (2019): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446Journal of Materials Processing Technology 264, 2019, 1-9
    DOI: 10.1016/j.jmatprotec.2018.08.038
  • Angrisani, G. L.; Taptimthong, P.; Thürer, S. E.; Klose, C.; Maier, H. J.; Wurz, M. C.; Möhwald, K. (2018): Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt CoatingsAdv. Eng. Mater. 20, 2018 (9), 1800102
    DOI: 10.1002/adem.201800102
  • Nicolaus, M.; Rottwinkel, B.; Alfred, I.; Möhwald, K.; Nölke, C.; Kaierle, S.; Maier, H. J.; Wesling, V. (2018): Future regeneration processes for high-pressure turbine bladesCEAS Aeronaut J 9, 2018 (1), 85-92
    DOI: 10.1007/s13272-017-0277-9
  • Rodriguez Diaz, M.; Knödler, P.; Möhwald, K.; Freiburg, D.; Biermann, D. (2018): Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatingsThermal Spray Bulletin 70, 2018 (2), 104-111
  • Strauß, C.; Gustus, R.; Maus-Friedrichs, W.; Schöler, S.; Holländer, U.; Möhwald, K. (2018): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446Journal of Materials Processing Technology 264, 2019, 1-9
    DOI: 10.1016/j.jmatprotec.2018.08.038
  • Vogel, F.; Biermann, D.; Rodriguez, M.; Nicolaus, M.; Möhwald, K. (2018): Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-BeschichtungenUnter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017): A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/AlJ Therm Spray Tech 26, 2017 (7), 1659-1668
    DOI: 10.1007/s11666-017-0612-z
  • Otten, M.; Klose, C.; Möhwald, K.; Knödler, P.; Maier, H. J. (2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten DruckgussbauteilenGiesserei Special, 2017 (1), 74-89 Weitere Informationen
  • Yilkiran, D.; Wulff, D.; Almohallami, A.; Özkaya, F.; Bouguecha, A.; Hübner, S.; Möhwald, K.; Maier, H. J.; Behrens, B.-A. (2017): Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal formingWear 376-377, 2017, 1789-1803
    DOI: 10.1016/j.wear.2017.01.084
  • Behrens, B.-A.; Lippold, L.; Puppa, J.; Hübsch, C.; Langen, D.; Möhwald, K. (2016): Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf TitanbasisForsch. Ingenieurwes. 81, 2017 (1), 1-12
    DOI: 10.1007/s10010-016-0209-6
  • Bobzin, K.; Öte, M.; Schein, J.; Zimmermann, S.; Möhwald, K.; Lummer, C. (2016): Modelling the Plasma Jet in Multi-Arc Plasma SprayingJ Therm Spray Tech 25, 2016 (6), 1111-1126
    DOI: 10.1007/s11666-016-0438-0
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2016): Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter ProzessgaseSchweißen und Schneiden 68, 2016 (5)
  • Lippold, L.; Kazhai, M.; Bouguecha, A.; Vucetic, M.; Hübsch, C.; Möhwald, K. (2016): Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging DieAdvanced Materials Research 1140, 2016, 91-98
    DOI: 10.4028/
  • Nicolaus, M.; Möhwald, K.; Maier, H. J.; Abrahams, H.; Vogel, F.; Biermann, D. (2016): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter SchichtenThermal Spray Bulletin 68, 2016 (1), 54-59
  • Vogel, F.; Abrahams, H.; Biermann, D.; Nicolaus, M.; Rodriguez Diaz, M.; Möhwald, K.; Maier, H. J. (2016): Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und FestwalzenWerkstoffe in der Fertigung, 2016 (4), 27-28
  • Gontarenko, A.; Möhwald, K.; Deißer, T. A.; Maier, H. J. (2015): Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-CoatingsApplied Mechanics and Materials 788, 2015, 143-150
    DOI: 10.4028/
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2015): Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steelWelding and Cutting, 14, 2015 (5), 280-288
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2015): Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-StahlSchweißen und Schneiden, 67, 2015 (4), 174-182
  • Knödler, P.; Otten, M.; Möhwald, K.; Maier, H. J.; Freiburg, D.; Peuker, A.; Biermann, D. (2015): Transplantation von thermisch gespritzten SchichtenThermal Spray Bulletin 8, 2015 (1), 50-55.
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2015): Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine bladesThermal Spray Bulletin, 2015, 8; S. 56-61.
  • Wulff, D.; Yilkiran, D.; Holländer, U.; Lützenkirchen-Hecht, D.; Wagner, R.; Hübner, S.; Möhwald, K.; Maier, H. J.; Behrens, B.-A. (2015): Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal FormingDry Met. Forming OAJ FMT 1, 2015, 72-78
  • Wulf, E.; Bachmann, H.; Möhwald, K.; Eifler, R.; Maier, H. J. (2014): The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloysIJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
    DOI: 10.3139/146.111022
  • Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Abo-Namous, O.; Kästner, M.; Reithmeier, E. (2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und VerschleißbeanspruchungenIn: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Maier, H. J. (2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von TurbinenschaufelnIn: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
  • Weizbauer, A. ; Modrejewski, C. ; Behrens, S. ; Klein, H. ; Helmecke, P. ; Seitz, J.-M. ; Windhagen, H. ; Möhwald, K. ; Reifenrath, J. ; Waizy, H. (2013): Comparative in vitro study and biomechanical testing of two different magnesium alloysJournal of Biomedical Applications 28, 2013 (8), 1264-1273
    DOI: 10.1177/0885328213506758
  • Bach, Fr.-W.; Dellinger, P.; Holländer, U.; Möhwald, K.; Prehm, J. (2012): Oberflächenveredelung durch Metall-KapillardruckgießenIn: Mikroproduktion 2012/03, S. 62–67
  • Erne, M.; Kolar, D.; Hübsch, C.; Möhwald, K.; Bach, Fr.-W.: (2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma SprayingJournal of Thermal Spray Technology,
  • Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, Fr.-W. (2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing ProcessesIn: Journal of applied Polymer Science. Online verfügbar unter
  • Schaup, J.; Holländer, U.; Roxlau, C.; Langohr, A.; Möhwald, K.; Bach, Fr.-W. (2012): Neue Nickelhartlote für den SchutzgasdurchlaufofenSchweissen und Schneiden 6 (64), S. 326–330
  • Swider, M. A.; Langohr, A.; Möller, F.; Möhwald, K.; Bach, Fr-W; Hassel, T. (2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von AluminiumlegierungenIn: Schweißen und Schneiden 64 (8), S. 490–496.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C.; Langohr, A. (2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnacesInternational Journal of Materials Research 2011/08, pp. 964-971
    DOI: 10.3139/146.110549
  • Hübsch, C.; Erne, M.; Möhwald, K.; Bach, Fr.-W.; Bretschneider, M.; Kästner, M.; Reithmeier, E. (2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structuresMaterialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
  • Lie, L.; Langohr, A.; Erne, M.; Möhwald, K.; Bach, Fr.-W. (2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die DruckindustrieIn: Thermal Spray Bulletin 4 (2), S. 114–120.
  • Lorenz, C.; Hoffmann, A.; Gross, G.; Windhagen, H.; Dellinger, P.; Möhwald, K.; Dempwolf, W.; Menzel, H. (2011): Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
  • Schaup, J.; Möhwald, K.; Bach, Fr.-W.; Deißer, T.A. (2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und SchneidwerkzeugenInfo-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
  • Tiemann, S.; Lie, L.; Holländer, U.; Möhwald, K.; Bach, Fr.-W. (2011): Influence of reactive process gases on zinc solders on aluminium and steelWelding and Cutting 10 (5), S. 314–317
  • Waltz, F.; Swider, M. A.; Hoyer, P.; Hassel, T.; Erne, M.; Möhwald, K.; Adlung, M.; Feldhoff, A.; Wickleder, C.; Bach, Fr.-W. (2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloyJournal of Materials Science, Doi: 10.1007/s10853-011-5785-0
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnacesKey Engineering Materials, Nr. 438, S. 73-80, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-ZnSchweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Reithmeier, E.; Kästner, M.; Abo-Namous, O. (2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfacesKey Engineering Materials, Nr. 438, S. 123-129, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus LeichtmetalllegierungenMaterialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
  • Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010): Keramikinlays für SchneidstempelBleche Rohre Profile, Nr. 10, S. 16-17, 2010.
  • Behrens, B.-A.; Krimm, R.; Pielka, T.; Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-SchneidstempelinlaysUTF science, Nr. III, S. 1-12, 2010.
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-SchichtenGalvanotechnik, Nr. 11, S. 2646-2650, 2010.
  • Erne, M.; Kolar, D.; Bach, Fr.-W.; Möhwald, K. (2010): Suspension Plasma Spraying of triboactive coatings for high temperature applicationsKey Engineering Materials, Nr. 438, S. 139-146, 2010.
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying processMaterialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
  • Kirner, S.; Hartz-Behrend, K.; Forster, G.; Marques, J.-L.; Schein, J.; Erne, M.; Prehm, J.; Möhwald, K.; Bach, Fr.-W. (2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels TomographieThermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
  • Wulf, E.; Seitz, J.-M.; Bormann, D.; Becker, J.-A.; Feldhoff, A.; Möhwald, K.; Bach, Fr.-W. (2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen DiamantenSchweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im SchutzgasdurchlaufofenINFO-SERVICE, Nr. 20, S. 16-19, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im SchutzgasofenINFO-SERVICE, Nr. 20, S. 6-11, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Schaup, J.; Holländer, U.; Wolter, K.-J.; Herzog, T.; Wohlrabe, H.; Wielage, B.; Lampke, T.; Weber-Nestler, D.; Bobzin, K.; Schlegel, A. (2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die LötstelleSchweißen und Schneiden, Nr. 7, S. 358-368, 2009.
  • Bause, T.; Bach, Fr.-W.; Möhwald, K.; Erne, M. (2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und KorrosionsschutzThermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
  • Behrens, B.-A.; Bach, Fr.-W.; Denkena, B.; Möhwald, K.; Deißer, T. A.; Kramer, N.; Bistron, M. (2009): Manufacturing of Reinforced High Precision Forging DiesSteel Research International, Nr. 12, S. 878-886, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenMaterialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T. (2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenSchweißen und Schneiden, Nr. 4, S. 192-199, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Erne, M. (2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten PulvernSchweißen und Schneiden, Nr. 11, S. 625-631, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten SchichtenMaterialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Tillmann, W.; Vogli, E.; Nebel, J. (2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal sprayingThermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S. (2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von AluminiumwerkstoffenMaterialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
  • Behrens, B.-A.; Bistron, M.; Kueper, A.; Möhwald, K. (2008): Investigation of Load Adapted Gears and Shafts Manufactured by Compound-ForgingJournal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
  • Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte SpritzschichtenSchweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
  • Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer WirbelstromsensorikSchweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
  • Bach, Fr.-W.; Holländer, U.; Möhwald, K.; Nicolaus, M. (2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folienSchweißen und Schneiden, Nr. 2, S. 78-83, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit KupferMaterialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M.; Deißer, T. A. (2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal CompositesThe Welding Journal, Nr. 86, S. 373-378, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Roxlau, C.; Hartz, K. (2007): Gießen im MikromaßstabSchweizer Maschinenmarkt, Nr. 24, S. 119-121, 2007.
  • Heidenblut, T.; Möhwald, K.;Deißer, T. A.; Bistron, M.;Behrens, B.-A.;Bach, Fr.-W. (2007): Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron MicroscopeMicroscopy and Microanalysis, S. 104-105, 2007.
  • Michaeli, W.; Kamps, T.; Schmachtenberg, E.; Lurz, A.; Vetter, K.; Schmiederer, D.; Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Piotter, V.; Prokop, J. (2007): Mit neuen Prozessketten zu wirtschaftlicher MikrofertigungMikroproduktion, Nr. 4, S. 18-22, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Drößler, B.; Hartz, K. (2006): Particle Image Velocimetry in Thermal SprayingAdvanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2006): Weiterentwicklung des Hochtemperaturlötens mit LedeburitlotenSchweißen und Schneiden, Nr. 2, S. 84-90, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Engl, L. (2005): Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter BeschichtungenMaterialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2005): Ultraschallassistiertes Flammlöten von AluminiumlegierungenSchweißen und Schneiden, Nr. 9, S. 482-487, 2005.
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2004): Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work stepWelding and Cutting, Nr. 2, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2004): Precision brazing processes for MEMS technologyWelding and Cutting, Nr. 6, S. 340-342, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2004): Particle Image Velocimetry in Thermal SprayingMaterials Science and Engineering A, S. 146-152., 2004.
  • Wielage, B.; Lampke, T.; Lugscheider, E.; Ernst, F.; Janssen, H.; Bach, Fr.-W.; Schäpers, M.; Möhwald, K. (2004): Schutzschichten für Lötmaschinen zum bleifreien LötenSchweißen und Schneiden, Nr. 5, S. 244-248, 2004.
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Josefiak, L. A. (2003): Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem ArbeitsschrittSchweißen und Schneiden, Nr. 10, S. 560-565, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T.; Formanek, B. (2003): Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide MatrixThermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Droessler, B.; Prehm, J.; Rothardt, T.; Copitzky, T. (2003): Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, inThermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003): Neue Entwicklungstendenzen zum Löten von AluminiumwerkstoffenJahrbuch Schweißtechnik 2003, S. 138-143, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2003): Präzisionslötverfahren für die MEMS-TechnikSchweißen und Schneiden, Nr. 12, S. 672-674, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003): Hartlöten dünner Bauteile aus Titanlegierungen mit partieller ErwärmungSchweißen und Schneiden, Nr. 8, S. 432-435, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2003): Partial-heating brazing of thin components made of titanium alloysWelding and Cutting, Nr. 6, S. 340-342, 2003.
  • Wielage, B.; Lugscheider, E.; Bach, Fr.-W.; Möhwald, K. (2003): Oberflächentechnik für moderne Lötanlagen für bleifreie LoteDer Praktiker, Nr. 4, S. 116ff., 2003.
  • Haferkamp, H.; Bach, Fr.-W.; Bußmann, M.; Kaese, V.; Möhwald, K.; Niemeyer, M.; Schreckenberger, H.; Phan-tan, T. (2002): Magnesiumkorrosion - Prozesse, Schutz von Anode und KathodeMagnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nakhosteen, B. (2001): Entwicklung einer neuen Metallgießtechnik für die MikromechanikZeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.
  • Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Weinert, K. (2001): Hartstoffschichten in der Spanenden FertigungSpanende Fertigung, S. 287-298, 2001.
  • Bach, Fr.-W.; Weinert, K.; Möhwald, K.; Nakhosteen, B.; Peters, C.; Schulte, M. (2001): Keramik-HM-Bohrer für kleine DurchmesserWerkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.
  • Bußmann, M.; Möhwald, K. (2000): Beschichtungen aus der Dampfphase, S. 199-222, 2000.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999): Löten - Verfahren zur Herstellung von VerbundwerkstoffenMetallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M. (1999): Gelötete Metall-Keramik-VerbundeMetallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Bußmann, M. (1999): Dünnschichttechnologie - Verfahren zur Herstellung von VerbundwerkstoffenMetallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Reusch, B.; Möhwald, K.; Fathi, M.; Hildebrandt, L. (1999): Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von ModellsystemenMetallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.


  • M. Rodriguez Diaz, M. Nicolaus, T. Hassel, K. Möhwald (2021): Stoffschlüssige Grenzflächenübergänge beim thermischen Beschichten mit Lichtbogen- und PlasmaspritzprozessenIn: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 4. Symposium Materialtechnik. Clausthal-Zellerfeld (virtuell). 25.02.-26.02.2021. Shaker, Aachen, 2021, S. 258-268
  • Vogel, F.; Biermann, D.; Rodriguez, M.; Möhwald, K. (2020): Innovative Verfahrenskombination zur Steigerung der Haftzugfestigkeit thermischer SpritzschichtenIn: Manufacturing Innovations Network (Hrsg.): Unter Span. Das Magazin des Manufacturing Innovations Network e. V, 2020, 15
  • Behrens B.-A., Yilkiran, D.; Schöler, S.; Hübner, S.; Möhwald, K.; Özkaya, F. (2019): Dry sheet metal forming through selective oxidized tool surfacesIn: TMS 2019, 148th Annual Meeting. San Antonio, USA. 10.03.-14.03.2019, S. 719-731
    DOI: 10.1007/978-3-030-05861-6_71
  • Holländer, U.; Kresnik, S.; Swider, M. A.; Möhwald, K.; Zinn, W.; Magnier, A.; Scholtes, B.; Niendorf, T. (2019): Investigation of residual stresses in high-temperature-brazed hybrid Cr-CrNi-steel jointsIn: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 149-155
  • Holländer, U.; Möhwald, K. (2019): In situ Chromium carbide formation in carbon modified brazed NiCrP-coatingsIn: Brazing, high temperature brazing and diffusion bonding. In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 228-234
  • Langohr, A.; Holländer, U.; Möhwald, K.; Groß-Bölting, S. (2019): Kinetic investigations for brazing Zn-surfaced AlSi dublex braze metal coatings with NH4Cl-doped process gasIn: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 306-314
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2019): Application of Ni-based filler metal repair coating by thermal spraying for high pressure turbines – A hybrid coating, brazing and aluminizing processIn: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 71-76
  • Nicolaus, M.; Rodriguez, M.; Möhwald, K.; Vogel, F.; Biermann, D. (2019): Neue Verfahren der Oberflächenvorbehandlung zur Steigerung der Haftfestigkeit von thermisch gespritzten SchichtenIn: K. Bobzin (Hrsg.): Tagungsband 14. Aachener Oberflächentechnik Kolloquium. Aachen. Shaker Verlag, Aachen, 2019, 69-79
  • Rodriguez Diaz, M.; Nicolaus, M.; Möhwald, K.; Vogel, F.; Biermann, D. (2019): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter SchichtenIn: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 3. Niedersächsisches Symposium Materialtechnik. Clausthal-Zellerfeld. 14.02.-15.02.2019. Shaker, Aachen, 2019, S. 483-494
  • Schmieding, M.; Holländer, U.; Weber, F.; Schmidt, E.; Möhwald, K.; Maier, H. J. (2019): Development an application of thermoplastic-coated particles for joining with powdered brazing alloysIn: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Lectures and Posters of the 12th International Conference taking place in Aachen on 21th to 23th May. Aachen. 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 215-221
  • Strauß, C.; Wegewitz, L.; Gustus, R.; Maus-Friedrichs, W.; Schöler, S.; Holländer, U.; Möhwald, K. (2019): Surface deoxidation mechanisms of stainless steels in vacuum brazing processesIn: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 247-251
  • Alfred, I.; Nicolaus, M.; Hermsdorf, J.; Kaierle, S.; Möhwald, K.; Maier, H.-J.; Wesling, V. (2018): Advanced high pressure turbine blade repair technologiesIn: 10th CIRP Conference on Photonic Technologies (LANE 2018), Procedia CIRP 74, 2018, S. 214-217
    DOI: 10.1016/j.procir.2018.08.097
  • Behrens, B.-A.; Yilkiran, D.; Schöler, S.; Özkaya, F.; Hübner, S.; Möhwald, K. (2018): Wear investigation of selective α-Fe2O3 oxide layers generated on surfaces for dry sheet metal formingIn: 17th International Conference on Metal Forming. Toyohashi, Japan. 16.09.-19.09.2018, S. 923-930
    DOI: 10.1016/j.promfg.2018.07.404
  • Schöler, S.; Yilkiran, D.; Wulff, D.; Özkaya, F.; Möhwald, K.; Behrens, B.-A.; Maier, H. J. (2018): Selective oxidation of tool steel surfaces under a protective gas atmosphere using inductive heat treatmentIn: Vollertsen, F. et al. (Hrsg.): 5th International Conference on New Forming Technology, ICNFT 2018. Bremen, 18.09.-21.09.18. MATEC Web Conf. 190, 2018, S. 14003
    DOI: 10.1051/matecconf/201819014003
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017): Regeneration of High Pressure Turbine Blades. Development of a Hybrid Brazing and Aluminizing Process by means of Thermal SprayingThe 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 72-76
    DOI: 10.1016/j.procir.2016.09.041
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2017): Heat treatment of the thermally sprayed coating system NiCrSi/NiCoCrAlY/Al for repair brazing high pressure turbine bladesIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 462-466
  • Rodriguez Diaz, M.; Knödler, P.; Otten, M.; Möhwald, K.; Freiburg, D.; Kersting, P.; Biermann, D. (2017): Enhanced corrosion resistance of magnesium alloys by transplantation of thermally sprayed coatingsIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 665–668
  • Rodriguez Diaz, M.; Möhwald, K.; Loftfield, N.; Kästner, M.; Reithmeier, E.; Knigge, S.; Glasmacher, B.; Maier, H. J. (2017): Transpiring thermally sprayed alumina layers with integrated fluid flow tubesIn: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 47-50
  • Schmieding, M.; Holländer, U.; Möhwald, K. (2017): Development of a Cu-Sn based brazing system with a low brazing and a high remelting 19th Chemnitz Seminar on Materials Engineering, IOP Conf. Ser.: Mater. Sci. Eng. 181, 2017, 12005
    DOI: 10.1088/1757-899X/181/1/012005
  • Wulff, D.; Bornmann, B.; Wagner, R.; Holländer, U.; Lützenkirchen-Hecht, D.; Möhwald, K.; Frahm, R.; Maier, H. J. (2017): In-situ examination of Cr-Ni steel surfaces heat treated under N2 by GIXRDIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 13th DELTA User Meeting & Annual Report 2017. Dortmund. 29.11.2017, S. 27-28
  • Bornmann, B.; Wulff, D.; Wagner, R.; Lützenkirchen-Hecht, D.; Möhwald, K.; Frahm R. (2016): Commissioning of a high temperature heater cell for in-situ ReflEXAFS studies of steel surfaces under variable reductive gas atmospheresIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 11-13
  • Bruchwald, O.; Nicolaus, M.; Frackowiak, W.; Möhwald, K.; Reimche, W.; Maier, H. J. (2016): Material Characterization of Thin Coatings Using High Frequency Eddy Current TechnologyProceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
    ISBN: 978-3-940283-78-8
  • C. Kunz, M. Marschewski, W. Maus-Friedrichs, S. Schöler, U. Holländer, K. Möhwald (2016): Mechanisms of surface deoxidation of stainless steels in vacuum brazing processesIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 181-185
  • F. Weber, U. Holländer, J. Schaup, K. Möhwald, H. J. Maier (2016): Fluxfree brazing of copper based alloys and steels at temperatures between 650 °C and 850 °C in monosilane-doped nitrogenIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 186-191
  • Knödler, P.; Otten, M.; Freiburg, D.; Möhwald, K.; Maier, H. J.; Biermann, D. (2016): Transplantation of Micro- and Nanostructured Coatings by Means of Thermal Spraying and PVDIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 3-11
  • M. Schmieding, U. Holländer, K. Möhwald, H. J. Maier (2016): Development of copper and nickel based brazing solders with a low brazing and a high remelting temperatureIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 272-277
  • S. Schöler, E. Marin Zimmermann, K. Möhwald, C. Kunz, W. Maus-Friedrichs (2016): Construction of an experimental set-up for brazing stainless steel samples in low vacuum atmosphere consisting monosilane-doped argonIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 311-315
  • U. Holländer, F. Weber, D. Wulff, K. Möhwald, H.J. Maier, M. Müller, I. Scharf, T. Lampke (2016): Development of a combined brazing-nitriding process for the production of bipolar plates made of chromium coated metal sheetsIn: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 174-180
  • Wulff, D.; Holländer, U.; Lützenkirchen-Hecht, D.; Langohr, A.; Möhwald, K.; Maier, H. J. (2016): Short-time nitridation of electroplated chromium coatings in SiH4-doped N2- atmosphere analysed by GIXRDIn: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 53-54
  • Yilkiran, D.; Wulff, D.; Almohallami, A.; Holländer, U.; Hübner, S.; Möhwald, K.; Behrens, B.-A., Maier, H. J. (2016): Selectively Oxidised Tool Steel Surfaces for Sheet Metal FormingIn: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 179-185
    ISBN: 978-3-95900-072-7
  • Holländer, U.; Frank, J.; Möhwald, K.; Maier, H. J. (2015): Entwicklung einer korrosions- und verschleißbeständigen EisenbasisschichtIn: Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Tagungsband 1. Niedersächsisches Symposium Materialtechnik, 12. bis 13. Februar 2015. Shaker, Herzogenrath, 2015, S. 101-112
  • Holländer, U.; Möhwald, K. (2015): Gelötete Metall-Keramik-Verbunde in WerkzeugenIn: DVS-Berichte Bd. 315, Tagungsband des DVS Congress und Expo in Nürnberg. DVS-Media, Düsseldorf; S. 559-562
  • Knödler, P.; Otten, M.; Möhwald, K.; Maier, H. J.; Freiburg, D.; Peuker, A.; Biermann, D. (2015): Transplantation of Thermal Sprayed CoatingsASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 753-755
    ISBN: 978-1-62708-093-4
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2015): Development of a two-stage hybrid Technology for repairing Turbine BladesIn: ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 37-40
  • Nicolaus, M.; Rottwinkel, B.; Möhwald, K.; Nölke, C.; Kaierle, S.; Maier, H. J.; Wesling, V. (2015): Future regeneration processes for high pressure turbine bladesDeutscher Luft- und Raumfahrtkongress, Rostock, 22.09.-24.09.2015 Weitere Informationen
  • Zimmermann, S.; Schmettlach, S.; Weber, S.; Marques, J.; Forster, G.; Landes, K.; Schein, J.; Lummer, C.; Knödler, P.; Kresnik, S.; Prehm, J.; Möhwald, K.; Maier, H. J. (2015): Homogenization of Coating Properties in Three-Cathode Atmospheric Plasma Spraying by Use of Advanced Diagnostics and Numerical Simulation - Investigations of Suspension Plasma Spraying (SPS)In: ASM International (Hrsg.): Proceedings from the International Thermal Spray Conference 2015; S. 452-459
  • Freiburg, D.; Biermann, D.; Peuker, A.; Kersting, P.; Maier, H. J.; Möhwald, K.; Knödler, P.; Otten, M. (2014): Development and Analysis of Microstructures for the Transplantation of Thermally Sprayed CoatingsProcedia CIRP Vol. 14, 6th CIRP International Conference on High Performance Cutting, HPC2014, S. 245 -250
    DOI: 10.1016/j.procir.2014.03.054
  • Holländer, U.; Weber, F.; Möhwald, K.; Maier, H. J. (2014): Entwicklung und Test eines Prüfverfahrens zur Bewertung von Lötverbindungen bei kombinierter mechanisch-korrosiver BelastungTagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 164-171
    ISBN: 978-3-00-046877-3
  • Knödler, P.; Peuker, A.; Freiburg, D.; Otten, M.; Möhwald, K.; Biermann, D. (2014): Transfer of Micro-structures by Transplantation of Thermal Sprayed CoatingsITSC 2014 Conference proceedings, lectures and posters, 21. - 23.5.2014, Barcelona, Spanien, S. 142–145
    ISBN: 978-3-87155-574-9
  • Nicolaus, M.; Möhwald, K.; Maier, H. J. (2014): Common application of Ni-based fillermetals and hotgascorrosion protection coatings by means of thermal spraying with subsequent heat treatment for near net shape turbineblade repairingIn: Bouzakis, K.-D. et al. (Hrsg.): Proceedings / 11th International Conference THE "A" Coatings in Manufacturing Engineering, 1 - 3 October 2014, Thessaloniki, Greece. Ed. Ziti, Thessaloniki, 2014, S. 179-184
    ISBN: 978-960-98780-8-1
  • Wulff, D.; Langohr, A.; Dellinger, P.; Holländer, U.; Möhwald, K. (2014): Aufbau einer RF-PVD Anlage zur Abscheidung sauerstoffaffiner Materialien für die Herstellung wärmegenerierender SystemeTagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 247–254
    ISBN: 978-3-00-046877-3
  • Dellinger, P.; Möhwald, K.; Maier, H. J.; Bach, Fr.-W. (2013): Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013
  • Holländer, U.; Bach, Fr.-W.; Möhwald, K.; Kirchberg, S.; Ziegmann, G. (2013): Injection molding, characterization and application of polymer bonded nickel based braze metal preforms for high temperature brazing processesProceedings of 10th International Conference on Brazing, High Temperature Brazing and Diffusion Brazing, Aachen, Juni 2013, S. 11-16
  • Kieke, M. D. K.; Weizbauer, A.; Duda, F.; Badar, M.; Budde, S.; Flörkemeier, T.; Diekmann, J.; Prenzler, N.; Rahim, M. I.; Müller, P. P.; Hauser, H.; Behrens, S.; Dellinger, P.; Möhwald, K.; Lenarz, T.; Windhagen, H.; Behrens, P. (2013): Evaluating a novel class of biomaterials: Magnesium-containing layered double hydroxidesBMT 2013, 3-Ländertagung D-A-CH, Graz, 19-21.09.2013
  • Kirchberg, S.; Holländer, U.; Möhwald, K.; Ziegmann, G.; Bach, F.-W. (2013): Injection molding and application of ring-shaped polymer-bonded braze metal preformsTagungsband: Design of/with composites, Composites Week @ Leuven, Leuven (Belgien), September 2013
  • Knödler, P.; Peuker, A.; Erne, M.; Maier, H. J.; Möhwald, K.; Biermann, D.; Kerber, K.; Otten, M. (2013): Transfer of Micro-structures by Transplantation of Thermal Sprayed CoatingsIn: Proceedings of the 10th International Conference THE “A“ Coatings (K.-D. Bouzakis, K. Bobzin, B. Denkena und M. Merklein (Hg.)), Shaker, Aachen, 2013, S. 193–204
  • Langohr A.; Swider M.A; Möller F.; Wulf E.; Möhwald K.; Hassel T.; Maier H. J. (2013): Development of flux free filler metals and processes for brazing of aluminumIn: Brazing, high temperature brazing and diffusion bonding. LÖT 2013, lectures and posters of the 10th international conference taking place in Aachen on 18th to 20th June 2013. Als Ms. gedr. Düsseldorf: DVS Media (DVS-Berichte, 293), 2013, S. 205–211
  • Otten, M.; Möhwald, K.; Kerber, K.; Erne, M.; Knödler, P.; Maier, H. J.; Biermann, D.; Zabel, A.; Peuker, A. (2013): Untersuchung der mikro- und makroskopischen Abbildungsgenauigkeit von im Schichttransplantationsprozess übertragenden OberflächenbeschichtungenIn: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 10
  • Bach, Fr.-W.; Möhwald, K.; Kerber, K.; Erne, M.; Knödler, P.; Otten, M. (2012): Herstellung von nachbearbeitungsarmen Innenbeschichtungen auf Druckgussteilen durch Transplantation thermischer SpritzschichtenIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 129–139.
  • Bach, Fr.-W.; Möhwald, K.; Kerber, K.; Erne, M.; Lüdeker, J.; Freytag, P.; Angrisani, G. L. (2012): Thermische Spritzschichten zur dynamischen Datenspeicherung auf technischen BauteilenIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 110–119.
  • Dellinger, P.; Möhwald, K. (2012): Bauteilpanzerung und Oberflächenstrukturierung durch PVD-SchichttransplantationIn: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Chemnitz: Eigenverlag, S. 452–457.
  • Holländer, U.; Möhwald, K.; Bach, Fr.-W. (2012): Physikalisch-chemische Betrachtungen zur Oxidschichtauflösung beim Hartlöten von Stählen mit Cu- und AgCu-LotenIn: Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Unter Mitarbeit von B. Wielage. Chemnitz: Eigenverlag, S. 465–472.
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2012): A New Hybrid Process for Repair Brazing and Coating of Turbine BladesIn: R.S Lima, A. Agarwal, M.M Hyland, Y.-C Lau, C. Li, A. McDonald und F.-L Toma (Hg.): International Thermal Spray Conference and Exposition (ITSC 2012). Conference Proceedings, 20.05. – 24.05.2012, Houston, TX, USA. ASM International. Novelty, OH, USA: ASM International, S. 110–113.
  • Bach, Fr.-W., Möhwald, K., Zhang, Yi, Freytag, P.; Erne, M.; Kerber, K.; Biermann, D.; Zabel, A., Peuker, A. (2011): Herstellung von Druckgussteilen mit mikrostrukturierten Funktionsschichten, durch die Transplantation von thermischen Spritzschichten In: Tagungsband zum Werkstofftechnischen Kolloquium (14. Werkstofftechnisches Kolloquium), S. 24–33
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2011): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-VeredelungWielage (Hg.) 2010 – Tagungsband 13. Werkstofftechnisches Kolloquium Chemnitz
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Tribological behaviour of suspension plasma sprayed coatings for hot extrusion toolsIn: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Three anodes compared to three cathodes: Evaluation of gun concepts for high performance plasma spraying operationIn: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Achieving new thermal spray coatings by usage of multielectrode plasma gunsIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 353–360.
  • Erne, M.; Kolar, D.; Möhwald, K.; Bach, Fr.-W. (2011): Suspension Plasma Spraying of oxide ceramic coatings on massive forming toolsIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 337–346.
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011): Repair Brazing of Turbine Blades using Thermal SprayingIn: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 347–352.
  • Nicolaus, M.; Möhwald, K.; Bach, Fr.-W. (2011): Reparaturlöten von Turbinenschaufeln mittels Thermischen SpritzensSchriftenreihe Werkstoffe und werkstofftechnische Anwendungen, Bd. 43, pp. 231–236, Chemnitz, Eigenverlag, ISBN 978-3-00-035117-8
  • Swider, M. A.; Waltz, F.; Hoyer, P.; Hassel, Th.; Erne, M.; Möhwald, K. (2011): Joining and coating by the combination of welding and plasma spraying to define metallurgical conditions and produce protective layers with powder and nanoscale materials.2nd International Symposium on Functional Surfaces in Aachen. Aachen, 13.09.2011.
  • Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Gu, Z.-H. (Hrsg.) (2010): Mechanical Surface Treatment to Obtain Optically Cooperative Surfaces vis-à-vis Fringe ProjectionReflection, scattering, and diffraction from surfaces II Proceedings of SPIE Vol. 7792, S. 77920V-77920V-9. Bellingham, Wash.: SPIE, 2010.
    ISBN: 9780819482884
  • Abo-Namous, O.; Kästner, M.; Reithmeier, E.; Nicolaus, M.; Möhwald, K.; Bach, Fr.-W.; Wielage, B.; Wielage, B. (Hrsg.) (2010): Berührungslose Geometrieprüfung endbearbeiteter Bauteile mit optisch nicht kooperativen OberflächenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 313-317. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Neumann, M. (2010): Beitrag zum Auftraglöten und -schweißen von Panzerungen mit hoher VerschleißreserveHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 55-63. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Hartz-Behrend, K.; Prehm, J. (2010): Qualitative Vorausberechnungen der Benetzungsvorgänge beim Löten mittels Methoden der klassischen Molekulardynamik (MD)Hart- und Hochtemperaturlöten und Diffusionsschweißen. LÖT 2010 ; Vorträge und Posterbeiträge des 9. internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2010 & Brazing, high temperature brazing and diffusion bonding. Löt; Deutscher Verband für Schweißen und Verwandte Verfahren. Düsseldorf: DVS Media (DVS-Berichte, 263), S. 248–254.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Langohr, A. (2010): Niedrig schmelzende Aluminiumhartlote aus dem System AlSiZnHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 117-121. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2010): Hartlöten von Edelstahl im Schutzgasdurchlaufofen mit modifizierten Ni-HartlotenHart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 266-271. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-589-3
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2010): Fügen von Aluminium-Stahl-Hybridwerkstoffen mit zinkhaltigen Loten unter Einsatz reaktiver Gaszusätze im SchutzgasofenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 318-324. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M. (2010): Neue Lösungswege für das Reparaturlöten und -beschichten von Turbinenschaufeln: Machining Innovations Conference Tagungsband 23. und 24. November 2010 HannoverNeue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 435-447. Garbsen: PZH Produktionstechn. Zentrum, 2010.
    ISBN: 978-3-941416-78-9
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C. (2010): Entwicklung einer Fertigungstechnik für Metall-KapillardruckgießprozesseMaschinen-, Werkzeug- und Prozessentwicklung für neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, S. 3-8. Erlangen-Tennenlohe: Lehrstuhl für Kunststofftechnik Univ. Erlangen-Nürnberg, 2010.
    ISBN: 978-3-931864-49-1
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Roxlau, C.; Wielage, B. (Hrsg.) (2010): Metall-Kapillardruckgießen - Gießen im MikrometermaßstabTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 307-312. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Xin, L.; Schein, J.; Forster, G.; Hartz-Behrend, K.; Zimmermann, S.; Marques, J.-L.; Kirner, S.; Bobzin, K.; Bagcivan, N.; Petkovic, I. (2010): Homogenization of Coating Properties in Atmospheric Plasma Spraying - Current Results of a DFG (German Research Foundation)-Funded Research GroupThermal spray: global solutions for future application DVS-Berichte Vol. 264. Düsseldorf: DVS Media, 2010.
    ISBN: 978-3-87155-590-9
  • Bach, Fr.-W.; Möhwald, K.; Zhang, I.; Kerber, K.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2010): Prozesskettenverkürzte Fertigung von Leichtmetall-Druckgussverbundbauteilen durch Transplantation thermisch gespritzter SchichtenTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 110-120. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K.; Wielage, B. (Hrsg.) (2010): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-VeredelungTagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 86-91. Chemnitz: Eigenverl., 2010.
    ISBN: 978-3-00-032471-0
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Biermann, D.; Zabel, A.; Peuker, A.; Wielage, B. (Hrsg.) (2009): Herstellung von beschichteten Druckgussbauteilen durch prozessintegrierte Applikation thermisch gespritzter Schichten in GussformenTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 36, S. 79-86. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 397-402. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2009): PVD-Schichtabformung im µm-BereichTagungsband des zweiten Workshops für Optische Technologien, 17.11.2008, S. 167-169. Garbsen: Verlag PZH Produktionstechnisches Zentrum GmbH, 2009.
    ISBN: 978-3-941416-17-8
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D. (2009): Suspensionsplasmaspritzen thermisch aktivierbarer triboaktiver SchichtverbundeTagungsband zum 17. Symposium Verbundwerkstoffe und Werkstoffverbunde, 01.-03.04.2009, Bayreuth, S. 627-634. Bayreuth, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Kolar, D.; Uhlenwinkel, V. (Hrsg.) (2009): Achieving Thin Functional Coatings by Mixing of Nanosized Feedstock Powders in the Suspension Plasma Spraying ProcessProceedings of the 4´th International conference on Spray Deposit in and Melt Atomization, 2009.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009): Basic Principles to Obtain Oxide Ceramic Coating Systems with Reduced Sliding Wear by Suspension Plasma SprayingThermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 200-206, 2009.
    ISBN: -13978-1-61503-004-0
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J.; Roxlau, C. (2009): Werkstoffkundliche und Prozesstechnische Aspekte zum Hartlöten im SchutzgasdurchlaufofenTagungsband des 4. Aachener Oberflächenkolloquium Schriftenreihe Oberflächentechnik, S. 29-44. Aachen: Shakerverlag, 2009.
    ISBN: 1864-0796
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Tiemann, S.; Wielage, B. (Hrsg.) (2009): Schutzgasofenlöten von Aluminium und Stahl in reaktiven ProzessgasenTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 418-423. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Hoyer, P.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T. (2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die MikroumformtechnikGrößeneinflüsse bei Fertigungsverfahren, Beiträge zum Abschlusskolloquium des SPP 1138, Bonn 11.-12.02.2009, S. 79-95. Bremen: BIAS Verlag, 2009.
    ISBN: 978-3-933762-29-0
  • Bach, Fr.-W.; Möhwald, K.; Nicolaus, M.; Wielage, B. (Hrsg.) (2009): Löten von hochlegierten Stählen, Nickel- und Titanlegierungen unter Ausbildung stängelkristallitverstärkter LötnähteTagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 403-409. Chemnitz: Eigenverlag, 2009.
    ISBN: 978-3-00-029007-7
  • Bach, Fr.-W.; Möhwald, K.; Prehm, J.; Hartz, K.; Schein, J.; Forster, G.; Zimmermann, S.; Marques, J.-L.; Bobzin, K.; Bagcivan, N.; Parkot, D.; Petkovic, I.; Marple, B. (Hrsg.) ; Hyl(Hrsg.) ;, Y. (Hrsg.) ; Lau, Y. (Hrsg.) ; Li, C. (Hrsg.) ; Lima, R. (Hrsg.) ; Montavon, G. (Hrsg.) (2009): Homogenization of Coating Properties in Atmospheric Plasma Spraying - New Results of a DFG (German Research Foundation)-Funded Research GroupThermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 762-767, 2009.
    ISBN: -13978-1-61503-004-0
  • Hoyer, P.; Möhwald, K.; Bach, Fr.-W.; Hassel, T.; Krause, M.; Jendras, M.; Heidenblut, T.; Vollertsen, F. (Hrsg.) (2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die MikroumformtechnikGrößeneinflüsse bei Fertigungsprozessen, S. 79-95, 2009.
    ISBN: 978-3-933762-29-0
  • Kerber, K.; Bormann, D.; Möhwald, K.; Holländer, U.; Bach, Fr.-W.; Kainer, K. U. (Hrsg.) (2009): Compound Casting of Aluminium and Magnesium-Alloy by High Pressure Die Casting8th International Conference on Magnesium Alloys and their Applications, S. 390-397. Weinheim: Wiley-VCH, 2009.
    ISBN: 3-527-32732-0
  • Bach, Fr.-W.; Drößler, B.; Möhwald, K. (2008): Thermally sprayed coatings with stochastic microstructures for thermomechanically high stressed surfaces Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Erne, M.; Möhwald, K.; Wielage, B. (Hrsg.) (2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaf-ten von thermisch gespritzten SchichtenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 66-72. Chemnitz: Eigenverlag, 2008. Online verfügbar unter Weitere Informationen
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Dellinger, P. (2008): Oberflächenbehandlungen von Polymeren und Werkzeugen zur PolymerbearbeitungFahlbusch, Pfalz (Hg.) 2008 – Tagungsband Hannoversches Zentrum für Optische Technologien; Workshop Optische Technologien
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T. (2008): Development of near net shape coatings for wear and corrosion protectionTagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Bause, T.; Scheer, C. (2008): Characterisation of thermally sprayed near net shape oxide ceramic and cermet coatings by acoustic emission analysisTagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Wielage, B. (Hrsg.) (2008): Optimierung von Eisenbasisfülldrähten für das Lichtbogenspritzen mittels statistischer MethodenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 73-79. Chemnitz: Eigenverlag, 2008.
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Hartz, K.; Bobzin, K.; Bagcivan, N.; Petkovic, I.; Schein, J.; Forster, G.; Zimmermann, S. (2008): Homogenization of coating properties in Atmospheric Plasma Spraying - technical objectives and first results of a DFG funded research group Proc. International Thermal Spray Conference, June 2-4, 2008, Maastricht, The Netherlands, 2008.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C.; Wielage, B. (Hrsg.) (2008): Neue Entwicklungen beim Hartlöten im SchutzgasdurchlaufofenTagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 209-214. Chemnitz: Eigenverlag, 2008.
    ISBN: 978-3-00-025648-6
  • Bach, Fr.-W.; Möhwald, K.; Schaup, J. (2008): Verfahrenskombinationen und Hybride aus thermischem Beschichten und Fügen3. Aachener Oberflächentechnik-Kolloquium 12.12.2008, S. 31-50. Aachen: Shaker Verlag, 2008.
    ISBN: 978-3-8322-7831-1
  • Scheer, C.; Reimche, W.; Möhwald, K.; Bach, Fr.-W. (2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer WirbelstromsensorikDGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
  • Bach, Fr.-W.; Behrens, B.-A.; Möhwald, K.; Bistron, M.; Deißer, T. A. (2007): Wear reducing measures on forging dies by application of technical surfaces Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 23-32, 2007.
    ISBN: 978-3-939026-64-8
  • Bach, Fr.-W.; Möhwald, K.; Bause, T.; Wielage, B. (Hrsg.) (2007): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter SchichtenTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 125-129. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.-A.; Kamps, T.; Bistron, M. (2007): Keramik-Metall-Verbundwerkzeuge für die MetallbearbeitungTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 52-58. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2007): Thermally Sprayed Coatings with Stochastic Microstructure for Improved Lubricant RetentionProceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 317-322, 2007.
    ISBN: 978-3-939026-64-8
  • Bach, Fr.-W.; Möhwald, K.; Erne, M. (2007): Diamantimprägnieren durch Thermisches Spritzen als Verfahren zur SchleifwerkzeugbeschichtungBernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 286-291. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Hartz, K. (2007): Metall-Kapillardruckgießen und Dampfphasen-Schmelzinfiltration: Zwei innovative Verfahren für das Herstellen metallischer MikrobauteileThomas Gessner (Hg.): Proceedings / Mikrosystemtechnik-Kongress 2007. 15. - 17. Oktober 2007 in Dresden ; gemeinsame Veranstaltung von: Bundesministerium für Bildung und Forschung (BMBF), VDE Verband der Elektrotechnik Elektronik Informationstechnik. Berlin, Offenbach: VDE-Verl, S. 123–126
    ISBN: 978-3-8007-3061-2
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2007): Flammlöten von AluminiumschmiedeteilenBernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 202-212. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Hartz, K.; Nicolaus, M. (2007): Gas/Solid-TLP-Bonding Ein neues Verfahren zum Herstellen und Fügen von Miniatur- und MikrobauteilenTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 319-324. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Entwicklung eines neuen Produktionsverfahrens für die Fertigung komplexer Metallverbunde- Gas/Solid-TLP-BondingTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 231-236. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -Drähte und -Folien Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 393-397. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2007): SCIB - Self-Cleaning Inert-Gas Brazing? Ein neues Verfahren zum flussmittelfreien Hartlöten korrosionsbeständiger KonstruktionswerkstoffeTagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 235-241. Düsseldorf: DVS-Verlag, 2007.
    ISBN: 978-3-87155-799-6
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Schaup, J. (2007): Elektrochemische Messmethoden zur Online-Bestimmung des Kupfergehaltes in bleifreien Sn-Basis-LotbädernTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 261-267. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Drößler, B. (2007): Untersuchungen zur Spritzwerkstoffeinbringung beim Dreikathoden-PlasmaspritzprozessTagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 136-142. Chemnitz: Eigenverlag, 2007.
    ISBN: 978-3-00-021586-5
  • Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Bistron, M. (2007): Use of a TiBN multilayer coating for wear reductionProceedings of 9th International Conference on Numerical Methods in Industrial Forming Processes - numiform'07, S. 1047-1052. Porto, Portugal, 2007.
    ISBN: 978-0-7354-0416-8
  • Behrens, B.-A.; Bach, Fr.-W.; Möhwald, K.; Küper, A.; Deißer, T. A.; Bistron, M. (2007): Reduction of Wear by a TiBN Multilayer Coating31st Int. Cocoa Beach Conference ICACC Jan. 2007 // Proceedings of the 31st International Conference on Advanced Ceramics and Composites, January 21-26, 2007, Daytona Beach, Florida, USA. Westerville, Ohio: American Ceramic Soc
    ISBN: 978-0-470-24679-5
  • Denkena, B.; Kramer, N.; Behrens, B.-A.; Bistron, M.; Bach, Fr.-W.; Möhwald, K.; Deißer, T. A. (2007): Manufacturing of ceramic reinforced high precision forging diesProceedings of 4th International Conference and Exhibition on Design and Production of Machines and Dies/Molds, Cesme, Turkey, June 21-23, 2007, 2007.
  • Haferkamp, H.; Engelbrecht, L.; Boese, B.; Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2007): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen? Heißrisstests und Vermeidung durch vordeponierte Spritzschichten Vortragsband zu 7. Int. Konf. Strahltechnik 17.-19.4.2007 in Halle (Saale). SLV Halle, GSI: DVS, 2007.
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A. (2006): Ceramic-Metal Composites in Forging Applications inProceedings of the 3rd International Soldering and Brazing Conference IBSC2006, S. 73-78. Materials Park, OH 44073-0002: ASM International, 2006.
    ISBN: 0-87170-838-8
  • Bach, Fr.-W.; Möhwald, K.; Deißer, T. A.; Behrens, B.- A.; Bistron, M. (2006): Maßnahmen zur Erhöhung der Verschleißresistenz von Gesenkmatrizen zum Präzisionsschmieden von ZahnrädernBernhard Wielage (Hg.): Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 // Verbundwerkstoffe und Werkstoffverbunde. Tagungsband zum 9. Werkstofftechnischen Kolloquium in Chemnitz, 7. bis 8. September 2006, Bd. 24. Chemnitz: TU, Lehrstuhl für Verbundstoffe, S. 505–511
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Duda, T.; Engl, L. (2006): Untersuchungen zum Hochgeschwindigkeitsflammspritzen von MCrAlY-Schichtsystemen mit angepasster Oberflächenrauheit Tagungsband zum 3. GTV Kolloquium "Thermisches Spritzen", 09.06.2006, Luckenbach, 2006, S. 24-32, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B.; Kolar, D. (2006): Thermal Spray Joining - Soldering and Filling of Aluminum Substrates under Atmospheric Conditions by a Combined Thermal Spray / Fusing TechniqueTagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
    ISBN: 0-87170-836-1
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Duda, T. (2006): Roughness Enhancement of HVOF Sprayed MCrAlY Bond Coatings for Adhesion Improvement of Ceramic Top LayersTagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
    ISBN: 0-87170-836-1
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2006): Niedrig schmelzende Glaslote auf Phosphatbasis zum Fügen von Aluminium-Keramik-Verbunden Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 430-435. Chemnitz: Eigenverlag, 2006.
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Ditz, R. (2006): Heating behaviour of differently tempered forged aluminium alloy components in a flame brazing process Tagungsband zum "4. International Congress Aluminium Brazing, 16t - 18th May 2006". Düsseldorf: Aluminium-Verlag, 2006.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Nicolaus, M. (2006): Modellierung der Stängelkristallitbildung beim Hartlöten am Beispiel des Werkstoffsystems Fe-C-CuTagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 400-406. Chemnitz: Eigenverlag, 2006.
    ISBN: -10-3-00-019101-1
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2005): Verbindungsspritzen - ein hybrides Fügeverfahren aus thermischem Spritzen und UmschmelzenUniv.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 157–163
  • Bach, Fr.-W.; Möhwald, K.; Drößler, B. (2005): Development of a technique for hard coating of component parts by synthesis of silicon carbide in thermal spray processesErich Lugscheider (Hg.): Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Lugscheider, E.; Parco, M. (2005): Properties of thermally sprayed coatings on magnesium parts for enhancement of wear and corrosion resistanceConference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Lugscheider, E. (2005): Qualification of a Modified Triplex II Plasma Gun for Processing of Liquid Precursors and Wire- or Powder Shaped Spray Materials under Controlled AtmosphereConference Proceedings ITSC 2005. Düsseldorf: DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Lugscheider, E. (2005): Self propagating high temperature synthesis of aluminium-matrix-composite coatings by means of atmospheric plasma sprayingConference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
    ISBN: 3-87155-793-5
  • Lugscheider, E.; Bach, Fr.-W.; Bobzin, K.; Möhwald, K.; Parco, M.; Richardt, K.; Engl, L. (2005): New approaches concerning the enhancement of wear and corrosion resistance of magnesium parts by thermally sprayed coating systemsK.-D Bouzakis (Hg.): Tagungsband zur Konferenz THE Coatings, 5.-7. Oktober 2005, Thessaloniki, Griechenland // 5th International Conference "the coatings" on Manufacturing Engineering and Eureka partnering event. Thessaloniki: Ed. Ziti, S. 241–248
  • Bach, Fr.-W.; Demmler, A.; Möhwald, K.; Bach, C. (2004): Neue Lotapplikationstechniken mittels Thermischer Spritzverfahren DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 35-37. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Kutku, I.; Möhwald, K.; Deißer, T. A.; Weinert, K.; Peters, C. (2004): Hochleistungswerkzeuge aus Keramik-Metall-Werkstoffverbunden DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 300-303. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Lugscheider, E.; Parco, M.; Dicks, R. (2004): Thermally Sprayed Coatings on Mg Alloys for Improved Wear and Corrosion Resistance 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 425-434. Friedrich-Alexander-Universität Erlangen-Nürnberg: Verlag, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Prehm, J.; Engl, L.; Rothardt, T.; Bouzakis, K. D.; Denkena, B.; Geiger, M.; Toenshoff, H. K.; Popp, U. (2004): State of the Art and Future Trends in Thermal Spraying4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 41-55. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004): Beschichtungsverfahren als leistungsfähige Alternative zu konventionellen LotapplikationstechnikenTagungsband zu "Oberflächentage 2004", 7. Mehrländertagung der Deutschen Gesellschaft für Galvano- und Oberflächentechnik e. V. am 22.-24.09.2004 in Dresden, S. 13-19, 2004.
    ISBN: 3-9806061-2-0
  • Bach, Fr.-W.; Möhwald, K.; Bach, C.; Holländer, U. (2004): Thermally sprayed filler metal coatings for high temperature brazingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004 // Thermal spray 2004. Advances in technology and application, 10-12 May 2004, Osaka, Japan : proceedings of the International Thermal Spray Conference. Materials Park, Ohio: ASM International
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Kolar, D. (2004): An Alternative Coating Process Underwater Plasma SprayingTagungsband zum 12. Plasma Technik Workshop Ilmenau, S. 81-88, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Engl, L.; Labod, B.; Lugscheider, E.; Parco, M. (2004): Thermisch gespritzte Schichtsysteme zur Erhöhung des Verschleiß- und Korrosionsschutzes von Magnesiumbasis-LegierungenTagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18, S. 17-23. Chemnitz: Eigenverlag, 2004.
    ISBN: 3000135537
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Laarmann, A. (2004): Weiterentwicklung des Hochtemperaturlötens mit LedeburitlotenDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 353-357. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Roxlau, C. (2004): Flussmittelfreies Hartlöten dünnwandiger Titanlegierungen mit partieller ErwärmungDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 362-364. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Stoll, P. (2004): Flussmittelfreies Flammlöten von Aluminiumlegierungen durch UltraschallunterstützungDVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 358-361. Düsseldorf: DVS-Verlag GmbH, 2004.
    ISBN: 3-87155-685-8
  • Bach, Fr.-W.; Möhwald, K.; Kolar, D.; Engl, L. (2004): Corrosion Protective Coatings by Modified Underwater Plasma SprayingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
  • Bach, Fr.-W.; Möhwald, K.; Schäpers, M.; Bouzakis, K. D. (Hrsg.) ; Denkena, B. (Hrsg.) ; Geiger, M. (Hrsg.) ; Toenshoff, H. K. (Hrsg.) ; Bach, Fr.-W. (Hrsg.) ; Popp, U. (Hrsg.) (2004): Aspects of PVD-Coatings of Plasma Nitratet Tool Steels4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 103-109. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
    ISBN: 3-87525-201-2
  • Bach, Fr.-W.; Möhwald, K.; Wenz, T.; Horstmann, R. (2004): Verarbeiten von kolloidal gelösten Nanopartikeln durch Thermisches SpritzenTagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18. Chemnitz: Eigenverlag, 2004.
    ISBN: 3000135537
  • Tillmann, W.; Vogli, E.; Rechlin, R.; Bach, Fr.-W.; Möhwald, K.; Babiak, Z.; Rothardt, T. (2004): Manufacturing diamond impregnated tools for stone machining through thermal sprayingProceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
  • Bach, Fr.-W.; Babiak, Z.; Möhwald, K.; Rothardt, T. (2003): Wlasnosci warstw kompozytowych natryskiwanych gazowo-detonacyjnie na podloza stopów lekkich na osnowie Al i MgProc. Conf. "Modern Wear and Corrosion Resistant Coatings Obtained by Thermal Spraying", Warschau, 2003, 2003.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Babiak, Z. (2003): Advantages of reactive spraying by simultaneous self-propagating high temperature synthesis (SHS) IWW Annual Assembly 2003.
  • Bach, Fr.-W.; Möhwald, K.; Rothardt, T.; Prehm, J.; Engl, L.; Hartz, K.; Drößler, B. (2003): Particle Image Velocimetry Thermal SprayingSDMA/ICSF 2003 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June, S. Kapitel 7, S. 115-126. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
    ISBN: 3-8330-0571-8
  • Bach, Fr.-W.; Möhwald, K.; Schäpers, M. (2003): Aspekte der PVD-Beschichtung plasmanitrierter WerkzeugstähleTagungsband zur 5. Industriefachtagung "Oberflächen- und Werkstofftechnik" und zum 6. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und Werkstofftechnische Anwendungen Vol. 16, S. 265-270. Chemnitz: Eigenverlag, 2003.
  • Haußelt, J.; Michaeli, W.; Schinköthe, W.; Ehrfeld, W.; Gatzen, H.-H.; Piotter, V.; Ruprecht, R.; Hülsenberg, D.; Möhwald, K. (2003): Themenschwerpunkt "Urformen"Mikromechanische Produktionstechnik, Abschlusskolloquium zum DFG-Schwerpunktprogramm 1012, S. 115-147, 2003.
  • Bach, Fr.-W.; Engl, L.; Möhwald, K.; Rothardt, T.; Josefiak, L. A. (2002): Partikeldiagnostik mittels Particle Image Velocimetry (PIV) beim HochgeschwindigkeitsflammspritzenTagungsband des GTV-Kolloquiums 2002, Luckenbach, S. 21-32, 2002.
  • Bach, Fr.-W.; Möhwald, K.; Berthold, M.; Gundlfinger, K. (2001): Untersuchungen zum industriellen Weichlöten von Kupfer an RotgußTagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 5-10. Düsseldorf: DVS-Verlag, 2001.
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2001): Flußmittelfreies Löten von Aluminiumlegierungen mit SchutzgasaktivatorenDVS (Hg.): Tagungsband zur “Löt 2001”, 6. Internationales Kolloquium, Bd. 212. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH (212), S. 375–379
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U.; Duda, T. (2001): Neue Lösungsansätze zum Löten von Aluminiumlegierungen mit artgleichen und nicht artgleichen FügepartnernTagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 231-235. Düsseldorf: DVS-Verlag, 2001.
  • Bach, Fr.-W.; Möhwald, K.; Gatzen, H.-H.; Morsbach, C.; Lugscheider, E. (Hrsg.) (2000): Metall-Kapillardruckgießen: Ein neues Urformverfahren für die MikromechanikE. Lugscheider (Hg.): 7. Werkstoffwissenschaftliches Kolloquium - Innovative Werkstofftechnologie 1999, Werkstoffwissenschaftliche Schriftenreihe. Aachen: Shaker Verlag (41), S. 67–73
  • Möhwald, K.; Morsbach, C.; Bach, Fr.-W.; Gatzen, H.-H. (1999): Investigations on Capillary Action Microcasting of Metals1st International Conference and General Meeting of the European Society for Precision Engineering and Nanotechnology, Bremen, Germany, S. 490-493, 1999.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Berthold, M.; Meininghaus, T. (1998): Anwendungsorientierte LotentwicklungTagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 48-51, 1998.
  • Bach, Fr.-W.; Steffens, H.-D.; Möhwald, K.; Meininghaus, T.; Berthold, M. (1998): Fluß-mittelfreies Löten von Leichtmetall/Stahl-VerbindungenTagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 206-210, 1998.


  • Bobzin, K.; Öte, M.; Linke, T. F.; Schein, J.; Zimmermann, S.; Maier, H. J.; Möhwald, K.; Lummer, C. (2014): Investigation of three-cathode atmospheric plasma spraying by use of advanced diagnostics and numerical simulationOral Presentation ITSC: International Thermal Spray Conference, May 21st-23rd, 2014, Barcelona, Spain
  • Möller, F.; Swider, M. A.; Langohr, A.; Hassel, T.; Möhwald, K.; Bach, Fr.-W.; Vollertsen, F. (2012): Developments of brazing solder and processes for flux less joining of aluminum 65th Annual Assembly Commission XVII of the International Institute of Welding. International Institute Of Welding (IIW). IIW. Denver, Colorado, USA, 09.07.2012.
  • Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011): Schichttransplantation - Prozessintegrierte Beschichtung von DruckgussteilenWerkstoff Forum - Intelligenter Leichtbau. Hannover Messe 2011
  • Kerber, K.; Freytag, P.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2011): Transplantierte Funktionsschichten auf DruckgussteilenMaterials Café,. Hannover Messe 2011
  • Freytag, P.; Kerber, K.; Otten, M.; Bach, Fr.-W.; Möhwald, K.; Zhang, Y.; Erne, M.; Biermann, D.; Zabel, A.; Peuker, A. (2010): Funktionsintegrierte Druckgussteile durch VerbundgussClausthaler Metallurgie-Kolloquium, 2010.
  • Dellinger, P.; Bach, Fr.-W.; Möhwald, K. (2009): Verschleißschutzoberflächen für Präzisions-UmformwerkzeugeOberflächentag (Hannover-Messe)
  • Bach, Fr.-W.; Holländer, U.; Kruzhanov, V.; Möhwald, K.; Nicolaus, M. (2006): Formation of columnar microstructure when brazing steels of different carbon content with copper filler metal - a thermodynamic modelHannover-Messe 2006, Werkstoffforum: CD, 2006.
  • Bach, Fr.-W.; Kruzhanov, V.; Möhwald, K.; Zeitz, V. (2000): Joining of metal foams using foamable filler metalsProceedings of materials week 2000, 25-28 Sept. 2000, Munich, 2000.

Beiträge in Büchern

  • Rodriguez Diaz, M.; Nicolaus, M.; Möhwald, K. (2018): Fluiddurchströmbare, transpirierende thermisch gespritzte SchichtenIn: Clausthaler Zentrum für Materialtechnik, C. Z. f. (Hrsg.): Berichtsband Clausthaler Zentrum für Materialtechnik. Shaker, Herzogenrath, 2018, S. 137-147
  • Knödler, P.; Bathe, T.; Möhwald, K.; Maier, H. J.; Biermann, D. (2016): Verfahren und Methoden zur Transplantation thermisch gespritzter Schichten für DruckgussteileIn: Biermann, D. (Hrsg.): Spanende Fertigung. Prozesse, Innovationen, Werkstoffe. Vulkan, Essen, 2016, S. 88-93
    ISBN: 978-3-8027-2989-8
  • Bach, Fr.-W.; Möhwald, K.; Erne, M.; Hübsch, C.; Maier, H. J. (2014): Microstructured thermally sprayed surfacesB. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92
  • Klassen, A.; Bistron, M.; Dellinger, P.; Schaup, J.; Deißer, T. A.; Behrens, L.; Köhler, J.; Bouguecha, A.; Möhwald, K.; Denkena B.; Behrens, B.-A. (2014): WerkzeugtechnologieBach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 53-125
    ISBN: 978-3-642-34663-7
  • Möhwald, K.; Holländer, U.; Laarmann, A. (2005): Einsatz von Beschichtungsverfahren in der LöttechnikFr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286
  • Bach, Fr.-W.; Möhwald, K.; Holländer, U. (2003): Neue Entwicklungstendenzen zum Löten von AluminiumwerkstoffenDeutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143
  • Bach, Fr.-W.; Versemann, R.; Möhwald, K.; Bußmann, M.; Holländer, U. (2000): Oberflächenbehandlung und thermochemische Stabilität von MagnesiumlegierungenMagnesium-Taschenbuch, S. 308-311,
    ISBN: ISBN-10: 3870172649