apl. Prof. Dr.-Ing. habil. Kai Möhwald
apl. Prof. Dr.-Ing. habil. Kai Möhwald
Telefon
Fax
E-Mail
Adresse
Stockumer Straße 28
58453 Witten
58453 Witten
apl. Prof. Dr.-Ing. habil. Kai Möhwald
Adresse
Stockumer Straße 28
58453 Witten
58453 Witten
Publikationen
Zeitschriften/Aufsätze
-
(2025): Molybdenum APS-Coatings: A Self-regenerative Solution for Wear Resistance in Dry-lubrication Applications, Tribology transactions, 2025, 68, 1036-1051
DOI: 10.1080/10402004.2025.2519334 -
(2025): Novel Alloying Strategy to Improve Brazing Properties on Nickel-Based Superalloys for Aircrafts Turbine Application, Journal of Engineering for Gas Turbines and Power, 2025, 147, 081003
DOI: 10.1115/1.4067248 -
(2025): Increasing the Corrosion Resistances of Arc-Sprayed Aluminium Coatings by Means of Oxygen-Free Process Control, Thermal Spray Bulletin, 2025, 1, 24-30
DOI: 10.53192/TSB20250124 -
(2024): Novel Alloying Strategy to Improve Brazing Properties on Nickel Based Superalloys for Aircrafts, In: Volume 9: Manufacturing Materials and Metallurgy; Microturbines, Turbochargers, and Small Turbomachines; Oil & Gas Applications; Steam Turbine. London, United Kingdom. 24.06.2024 - 28.06.2024. American Society of Mechanical Engineers, 2024
DOI: 10.1115/GT2024-121186 -
(2024): Arc spraying in silane-doped argon: Widening the material spectrum in oxygen-free process zones, Thermal Spray Bulletin, 17, 1, 2024, 56-61
DOI: 10.53192/TSB20240156 -
(2023): Thermal spraying in oxygen-free environment: Meltoff and atomisation behaviour of twin-wire arc spraying processes in silane-doped inert gases, Thermal Spray Bulletin, 16, 1, 2023, 24-30
DOI: 10.53192/TSB20230124 -
(2022): Functionality Investigations of Dry-Lubricated Molybdenum Trioxide Cylindrical Roller Thrust Bearings, Coatings, 2022, 12, 591
DOI: 10.3390/coatings12050591 -
(2022): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin 14 (2), 120-127
-
(2022): Young’s Modulus and Residual Stresses of Oxide-Free Wire Arc Sprayed Copper Coatings, Coatings, 12, 10, 2022, 1482
DOI: 10.3390/coatings12101482 -
(2022): Oxide Free Wire Arc Sprayed Coatings—An Avenue to Enhanced Adhesive Tensile Strength, Metals 12, 2022 (4), 684
DOI: 10.3390/met12040684 -
(2021): Entwicklung von Kupfer-Aluminium-Verbundloten zur In-situ-Bildung von CuAl-Lotlegierungen beim Ofenlöten von CrNi-Stählen, Schweißen und Schneiden 73, 2021 (5), 284-293
-
(2021): Thermally Sprayed Nickel-Based Repair Coatings for High-Pressure Turbine Blades: Controlling Void Formation during a Combined Brazing and Aluminizing Process, Coatings 11, 2021 (6), 725
DOI: 10.3390/coatings11060725 -
(2021): Thermal spraying in silane-doped shielding gases: A new approach for innovative coatings in controlled process atmospheres, Thermal Spray Bulletin, 14, 2, 2021, 120-127
ISSN: 1866–6248 -
(2021): Investigations of hot-dip galvanized dual-phase steel (DP600+Z) sheet metal on selectively oxidized tool steel surfaces under dry deep-drawing conditions, Wear XII, 2021, 203742
DOI: 10.1016/j.wear.2021.203742 -
(2020): Application of a titanium filler metal by cold gas dynamic spraying, Thermal Spray Bulletin 13, 2020 (2), 108-113
-
(2020): Numerical Simulation of the Abrasive Wear Behavior of Selectively Oxidized α-Fe2O3 Oxide Layers on Tool Steel Surfaces, JOM 72, 2020 (7), 2536-2547
DOI: 10.1007/s11837-020-04172-x -
(2020): Characterization of Molybdenum Based Coatings on 100Cr6 Bearing Steel Surfaces, Tribology Online 15, 2020 (3), 181-185
DOI: 10.2474/trol.15.181 -
(2019): Brazing in SiH4-Doped Inert Gases - A New Approach to an Environment Friendly Production Process, Int. J. of Precis. Eng. and Manuf.-Green Tech. 495, 2019 (1), 187
DOI: 10.1007/s40684-019-00109-1 -
(2019): Wear behavior of selectively oxidized α-Fe2O3 oxide low-friction layer systems on PM tool steel surfaces, Wear 426-427, 2019, 1603-1615
DOI: 10.1016/j.wear.2019.01.009 -
(2019): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2018): Magnetic Properties of Thermal Sprayed Tungsten Carbide-Cobalt Coatings, Adv. Eng. Mater. 20, 2018 (9), 1800102
DOI: 10.1002/adem.201800102 -
(2018): Future regeneration processes for high-pressure turbine blades, CEAS Aeronaut J 9, 2018 (1), 85-92
DOI: 10.1007/s13272-017-0277-9 -
(2018): Investigation into the corrosion protection coatings on magnesium alloys by transplanting thermally sprayed coatings, Thermal Spray Bulletin 70, 2018 (2), 104-111
-
(2018): Influence of atmosphere during vacuum heat treatment of stainless steels AISI 304 and 446, Journal of Materials Processing Technology 264, 2019, 1-9
DOI: 10.1016/j.jmatprotec.2018.08.038 -
(2018): Festwalzen gerändelter Oberflächen zur formschlüssigen Substratanbindung von HVOF-Beschichtungen, Unter Span - Das Magazin des Machining Innovations Network e. V., 2018, 19
-
(2017): A Combined Brazing and Aluminizing Process for Repairing Turbine Blades by Thermal Spraying Using the Coating System NiCrSi/NiCoCrAlY/Al, J Therm Spray Tech 26, 2017 (7), 1659-1668
DOI: 10.1007/s11666-017-0612-z -
(2017): Untersuchung der Serientauglichkeit des Schichttransplantationsprozesses zur Herstellung von beschichteten Druckgussbauteilen, Giesserei Special, 2017 (1), 74-89 Weitere Informationen
-
(2017): Wear behaviour of thermally oxidised tool surfaces as low-friction separation layers for dry sheet metal forming, Wear 376-377, 2017, 1789-1803
DOI: 10.1016/j.wear.2017.01.084 -
(2016): Steigerung der Verschleißbeständigkeit von Schmiedegesenken durch PVD-abgeschiedene Hartstoffschichten auf Titanbasis, Forsch. Ingenieurwes. 81, 2017 (1), 1-12
DOI: 10.1007/s10010-016-0209-6 -
(2016): Modelling the Plasma Jet in Multi-Arc Plasma Spraying, J Therm Spray Tech 25, 2016 (6), 1111-1126
DOI: 10.1007/s11666-016-0438-0 -
(2016): Entwicklung von Prozessen zum flussmittelfreien Schutzgas-Hartlöten zwischen 650 und 850 °C durch Einsatz silandotierter Prozessgase, Schweißen und Schneiden 68, 2016 (5)
-
(2016): Prediction and Detection of Wear Mechanisms on an Industry-Oriented Hot Forging Die, Advanced Materials Research 1140, 2016, 91-98
DOI: 10.4028/www.scientific.net/AMR.1140.91 -
(2016): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, Thermal Spray Bulletin 68, 2016 (1), 54-59
-
(2016): Formschlüssige Substratanbindung thermisch gespritzter Schichten durch die Verfahrenskombination Rändelfräsen und Festwalzen, Werkstoffe in der Fertigung, 2016 (4), 27-28
-
(2015): Dry Sliding Wear Behavior and Wear Mechanisms of Thermally Sprayed WCCo-Coatings, Applied Mechanics and Materials 788, 2015, 143-150
DOI: 10.4028/www.scientific.net/AMM.788.143 -
(2015): Determination of failure criteria of mechanically and corrosively loaded brazed joints of sheets made of stainless chromium-nickel steel, Welding and Cutting, 14, 2015 (5), 280-288
-
(2015): Ermittlung von Versagenskriterien mechanisch-korrosiv belasteter Hartlötverbindungen von Blechen aus hochlegiertem nitchtrostendem Chrom-Nickel-Stahl, Schweißen und Schneiden, 67, 2015 (4), 174-182
-
(2015): Transplantation von thermisch gespritzten Schichten, Thermal Spray Bulletin 8, 2015 (1), 50-55.
-
(2015): Combined brazing and alitising process for thermally sprayed Ni-based alloys for the repair of turbine blades, Thermal Spray Bulletin, 2015, 8; S. 56-61.
-
(2015): Selective oxidation of 1.2379 tool steel surfaces: an approach for Dry Metal Forming, Dry Met. Forming OAJ FMT 1, 2015, 72-78
-
(2014): The influence of brazing temperature and surface roughness on the wettability of reactive brazing alloys, IJMR (International Journal of Materials Research), 2014, vol. 105, 240-248
DOI: 10.3139/146.111022 -
(2013): Mikrostrukturieren von thermisch gespritzten Mo-Schichten für Anwendungen im Bereich hoher Reib- und Verschleißbeanspruchungen, In: Materialwissenschaft & Werkstofftechnik 44 (4), S. 304–310. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/mawe.201300054/abstract
-
(2013): Wärmebehandlung thermisch gespritzter Ni-Basislote/NiCrAlY-Schichtsysteme zur Reparatur von Turbinenschaufeln, In: Thermal Spray Bulletin 6 (2), S. 119–123. Online verfügbar unter http://www.thermal-spray-bulletin.info/ index.cfm?objekt=TSPRAY& jahr=2013&ausgabe=2&rubrik=Wissenschaftliche%20Beitr%C3%A4ge.
-
(2013): Comparative in vitro study and biomechanical testing of two different magnesium alloys, Journal of Biomedical Applications 28, 2013 (8), 1264-1273
DOI: 10.1177/0885328213506758 -
(2012): Oberflächenveredelung durch Metall-Kapillardruckgießen, In: Mikroproduktion 2012/03, S. 62–67
-
(2012): Synthesis of Tribologically Favorable Coatings for Hot Extrusion Tools by Suspension Plasma Spraying, Journal of Thermal Spray Technology, http://www.springerlink.com/content/3g824t5166482761/
-
(2012): Processing and Characterization of Injection Moldable Polymer–Particle Composites Applicable in Brazing Processes, In: Journal of applied Polymer Science. Online verfügbar unter http://onlinelibrary.wiley.com/doi/10.1002/app.38862/abstract.
-
(2012): Neue Nickelhartlote für den Schutzgasdurchlaufofen, Schweissen und Schneiden 6 (64), S. 326–330
-
(2012): Entwicklung flussmittelfreier Lote und Prozesse zum Löten von Aluminiumlegierungen, In: Schweißen und Schneiden 64 (8), S. 490–496.
-
(2011): Boron and phosphorous free nickel based filler metals for brazing stainless steel in shielding gas furnaces, International Journal of Materials Research 2011/08, pp. 964-971
DOI: 10.3139/146.110549 -
(2011): Optische Oberflächencharakterisierung von plasmagespritzten stochastischen Strukturen: Optical characterization of the surface of plasma sprayed stochastic structures, Materialwissenschaft und Werkstofftechnik Vol. 42, Nr. 6, S. 519-530, 2011.
-
(2011): Entwicklung eines kostengünstigen korrosionsbeständigen Fe-Basis-Spritzwerkstoffs für die Druckindustrie, In: Thermal Spray Bulletin 4 (2), S. 114–120.
-
(2011): Coating of titanium implant materials with thin polymeric films for binding signalling protein BMP2, Macromolecular Bioscience Vol. 11, Nr. 2, S. 234-244, 2011.
-
(2011): Einsatz aktivgelöteter keramischer Inlays in hoch verschleißbeständigen Umform-, Bohr- und Schneidwerkzeugen, Info-Service Fachgesellschaft Löten, DVS, Ausgabe 24, Dezember 2011, ISSN 1861-6712, S. 11-12
-
(2011): Influence of reactive process gases on zinc solders on aluminium and steel, Welding and Cutting 10 (5), S. 314–317
-
(2011): Synthesis of highly stable magnesium fluoride suspensions and their application in the corrosion protection of a Magnesium alloy, Journal of Materials Science, Doi: 10.1007/s10853-011-5785-0
-
(2010): Physico-chemical aspects of surface activation during fluxless brazing in shielding-gas furnaces, Key Engineering Materials, Nr. 438, S. 73-80, 2010.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System Al-Si-Zn, Schweissen und Schneiden Vol. 62, Nr. 11, S. 632-637, 2010.
-
(2010): Non-contact geometry inspection of workpieces with optically non-cooperative surfaces, Key Engineering Materials, Nr. 438, S. 123-129, 2010.
-
(2010): Transplantation von thermisch gespritzten Verschleißschutzschichten auf Druckgussteile aus Leichtmetalllegierungen, Materialwissenschaft und Werkstofftechnik Vol. 41, Nr. 6, S. 1-8, 2010.
-
(2010): Keramikinlays für Schneidstempel, Bleche Rohre Profile, Nr. 10, S. 16-17, 2010.
-
(2010): Erhöhung der Verschleißfestigkeit beim Scherschneiden durch aktivgelötete Keramik- und Hartmetall-Schneidstempelinlays, UTF science, Nr. III, S. 1-12, 2010.
-
(2010): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Galvanotechnik, Nr. 11, S. 2646-2650, 2010.
-
(2010): Suspension Plasma Spraying of triboactive coatings for high temperature applications, Key Engineering Materials, Nr. 438, S. 139-146, 2010.
-
(2010): Basic principles of reaching triboactive coatings by mixing of nanosized feedstock powders in the suspension plasma spraying process, Materialwissenschaft & Werkstofftechnik Vol. 41, Nr. 7, S. 541-546, 2010.
-
(2010): Untersuchung der injektionsbedingungen beim Suspensionsplasmaspritzen mittels Tomographie, Thermal Spray Bulletin Vol. 3, Nr. 2, S. 116-122, 2010.
-
(2010): In-situ-Untersuchung des Erstarrungsverhaltens titanhaltiger Aktivlote beim Löten von monokristallinen Diamanten, Schweissen und Schneiden Vol. 62, Nr. 6, S. 334-337, 2010.
-
(2009): Zur Problematik des Gasaustausches beim Löten hohler Bauteile im Schutzgasdurchlaufofen, INFO-SERVICE, Nr. 20, S. 16-19, 2009.
-
(2009): Physikalisch-chemische Aspekte der Oberflächenaktivierung beim flussmittelfreien Hartlöten im Schutzgasofen, INFO-SERVICE, Nr. 20, S. 6-11, 2009.
-
(2009): Detektion von Verunreinigungen beim bleifreien Wellen- und Selektivlöten und deren Auswirkungen auf die Lötstelle, Schweißen und Schneiden, Nr. 7, S. 358-368, 2009.
-
(2009): Entwicklung endkonturnaher Beschichtungen für den Verschleiß- und Korrosionsschutz, Thermal Spray Bulletin Vol. 2, Nr. 2, S. 118-125, 2009.
-
(2009): Manufacturing of Reinforced High Precision Forging Dies, Steel Research International, Nr. 12, S. 878-886, 2009.
-
(2008): Untersuchungen der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Schweißen und Schneiden, Nr. 4, S. 192-199, 2008.
-
(2008): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 1, S. 45-47, 2008.
-
(2008): Entwicklung und Charakterisierung von plasma- und hochgeschwindigkeitsflammgespritzten, endkonturnahen, nachbearbeitungsreduzierten Schichten aus feinfraktionierten Pulvern, Schweißen und Schneiden, Nr. 11, S. 625-631, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaften von thermisch gespritzten Schichten, Materialwissenschaft und Werkstofftechnik, Nr. 12, S. 876-882, 2008.
-
(2008): Applikation superabrasiver Hartstoff-Metallmatrix-Verbundsysteme durch Thermisches Spritzen - Application of superabrasive hard material metal matrix composite systems by means of thermal spraying, Thermal Spray Bulletin Vol. 1, Nr. 1, S. 74-79, 2008.
-
(2008): Flussmittelfreies Hartlöten unter reaktiver Prozessgasatmosphäre - ein alternatives Verfahren zum Fügen von Aluminiumwerkstoffen, Materialwissenschaft und Werkstofftechnik, Nr. 9, S. 594-598, 2008.
-
(2008): Investigation of Load Adapted Gears and Shafts Manufactured by Compound-Forging, Journal of Advanced Manufacturing Systems, Nr. 1, S. 175-182, 2008.
-
(2008): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen - Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Schweißen und Schneiden, Nr. 7-8, S. 386-393, 2008.
-
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, Schweissen und Schneiden Vol. 60, Nr. 6, S. 331-336, 2008.
-
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -drähte und -folien, Schweißen und Schneiden, Nr. 2, S. 78-83, 2007.
-
(2007): Modellierung der Stängelkristallitbildung beim Hartlöten von Kohlenstoffstählen mit Kupfer, Materialwissenschaft & Werkstofftechnik, Nr. 2, S. 164-168, 2007.
-
(2007): A PVD Joining Hybrid Process for Manufacturing Complex Metal Composites, The Welding Journal, Nr. 86, S. 373-378, 2007.
-
(2007): Gießen im Mikromaßstab, Schweizer Maschinenmarkt, Nr. 24, S. 119-121, 2007.
-
(2007): Wear Characterization of Forging Dies Using a Large Chamber Scanning Electron Microscope, Microscopy and Microanalysis, S. 104-105, 2007.
-
(2007): Mit neuen Prozessketten zu wirtschaftlicher Mikrofertigung, Mikroproduktion, Nr. 4, S. 18-22, 2007.
-
(2006): Particle Image Velocimetry in Thermal Spraying, Advanced Engineering Materials Vol. 8, Nr. 7, S. 650-653, 2006.
-
(2006): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, Schweißen und Schneiden, Nr. 2, S. 84-90, 2006.
-
(2005): Technik und Potenziale des Verschleißschutzes mittels thermisch gespritzter Beschichtungen, Materialwissenschaft und Werkstofftechnik, Nr. 8, S. 353-359, 2005.
-
(2005): Ultraschallassistiertes Flammlöten von Aluminiumlegierungen, Schweißen und Schneiden, Nr. 9, S. 482-487, 2005.
-
(2004): Substrate preparation by means of dry-ice blasting and coating by means of thermal spraying in one work step, Welding and Cutting, Nr. 2, 2004.
-
(2004): Precision brazing processes for MEMS technology, Welding and Cutting, Nr. 6, S. 340-342, 2004.
-
(2004): Particle Image Velocimetry in Thermal Spraying, Materials Science and Engineering A, S. 146-152., 2004.
-
(2004): Schutzschichten für Lötmaschinen zum bleifreien Löten, Schweißen und Schneiden, Nr. 5, S. 244-248, 2004.
-
(2003): Substratvorbereitung durch Trockeneisstrahlen und Beschichten durch thermisches Spritzen in einem Arbeitsschritt, Schweißen und Schneiden, Nr. 10, S. 560-565, 2003.
-
(2003): Properties of Plasma and D-Gun Sprayed Metal-Matrix-Composite (MMC) Coatings Based on Ceramic Hard Particle Reinforced Al-, Fe-, Ni-aluminide Matrix, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 249-254, 2003.
-
(2003): Influences on the Kinematics of the APS-Process by Means of Particle Image Velocimetry, in, Thermal Spray 2003:Advancing the Science and Applying the Technology, S. 1191-1198, 2003.
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Jahrbuch Schweißtechnik 2003, S. 138-143, 2003.
-
(2003): Präzisionslötverfahren für die MEMS-Technik, Schweißen und Schneiden, Nr. 12, S. 672-674, 2003.
-
(2003): Hartlöten dünner Bauteile aus Titanlegierungen mit partieller Erwärmung, Schweißen und Schneiden, Nr. 8, S. 432-435, 2003.
-
(2003): Partial-heating brazing of thin components made of titanium alloys, Welding and Cutting, Nr. 6, S. 340-342, 2003.
-
(2003): Oberflächentechnik für moderne Lötanlagen für bleifreie Lote, Der Praktiker, Nr. 4, S. 116ff., 2003.
-
(2002): Magnesiumkorrosion - Prozesse, Schutz von Anode und Kathode, Magnesium - Eigenschaften, Anwendungen, Potentiale, S. 244-259, 2002.
-
(2001): Entwicklung einer neuen Metallgießtechnik für die Mikromechanik, Zeitschrift für Metallkunde, Nr. 3, S. 207-211, 2001.
-
(2001): Hartstoffschichten in der Spanenden Fertigung, Spanende Fertigung, S. 287-298, 2001.
-
(2001): Keramik-HM-Bohrer für kleine Durchmesser, Werkstatt und Betrieb, WB, Nr. 11, S. 112-119, 2001.
-
(2000): Beschichtungen aus der Dampfphase, , S. 199-222, 2000.
-
(1999): Löten - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 25-36, 1999.
-
(1999): Gelötete Metall-Keramik-Verbunde, Metallische und metall-keramische Verbundwerkstoffe, S. 204-220, 1999.
-
(1999): Dünnschichttechnologie - Verfahren zur Herstellung von Verbundwerkstoffen, Metallische und metall-keramische Verbundwerkstoffe, S. 60-68, 1999.
-
(1999): Auslegen von Verbundwerkstoffen - Systematik zur Erstellung von Modellsystemen, Metallische und metall-keramische Verbundwerkstoffe, S. 295-347, 1999.
Konferenz
-
(2025): Trockenschmierung von Wälzkontakten durch atmosphärisch plasmagespritzte selbstregenerative Molybdänoxidschichtsysteme, Tagungsband 6. Symposium Materialtechnik, 2025, 20.-21.02.2025, Clausthal-Zellerfeld
DOI: 10.21268/20250506-0 -
(2025): Flux-free melt tinning of aluminum alloys as solder cladding for the realalisation of similar and sisimilar solder joints in aluminium assemblies, Tagungsband LÖT2025, 14, 148-153, 24.06.-26.06.2025, Aachen
DOI: 10.53192/LOET20250148 -
(2025): Reactive brazing composites with sintered framework structures for the production of high temperature resistant brazed joints at soldering conditions, Tagungsband LÖT2025, 2025, 14, 318-326, 24.06.-26.06.25, Aachen
DOI: 10.53192/LOET20250318 -
(2025): Microstructural-mechanical property correlation via nanoindentation mapping in CoCrFeNiMo0.5 high-entropy alloy powder and cold spray coating, Proceedings of the International Thermal Spray Conference, ITSC 2025, 05.-08.05.2025, Vancouver, BC, Kanada
-
(2025): Grundlegende Untersuchungen zur Herstellung magnetischer Skalierungen durch Thermisches Spritzen, 19. Aachener Oberflächentechnik Kolloquium 2025: Schriftenreihe Oberflächentechnik, 05.12.2025, Aachen
ISBN: 978-3-8191-0369-8 -
(2025): Increasing Durability of the Outer Air Seal Coating in the High Pressure Turbine by using a NiCoCrAlY/NiAl Bond Coat, International Thermal Spraying and Hardfacing Conference (ITSHC), 11.-12.09.2025, Breslau, Polen
-
(2025): Functionalized Thermally Sprayed Coatings for Biomedical Applications, International Thermal Spraying and Hardfacing Conference (ITSHC), 11. – 12.09.2025, Breslau, Polen
-
(2024): Thermally Sprayed Coatings for Dynamic Data Storage, Thermal Spray 2024: Proceedings from the International Thermal Spray Conference, 29.04.-01.05.2024, Mailand, Italien
DOI: 10.31399/asm.cp.itsc2024p0034 -
(2024): A new approach for the application of highly reactive metals, International Thermal Spray Conference (ITSC) Proceedings, 2024, 278-283, Mailand, Italien
DOI: 10.31399/asm.cp.itsc2024p0278 -
(2023): Herstellung dichter Yttriumoxidbeschichtungen durch atmosphärisches Plasmaspritzen als Schutzschichten für die Halbleiterindustrie, Tagungsband 5. Symposium Materialtechnik, 2023, 810
ISBN: 978-3-8440-9105-2 -
(2023): Funktionale thermisch gespritzte Schichten für biomedizinische Anwendungen, Schriftenreihe Oberflächentechnik, 17. Aachener Oberflächentechnik Kolloquium 2023, 59-71
ISBN: 978-3-8440-9305-6 -
(2023): Potentiale und Eigenschaften des Lichtbogenspritzens in silandotierten Inertgasen, Tagungsband 5. Symposium Materialtechnik, 2023, 78-86
DOI: 10.21268/20230711-3 -
(2023): Advantages of oxygen-free wire-arc sprayed titanium coatings, DPG-Frühjahrstagung der Sektion Kondensierte Materie, 26.03.-31.03.2023, Dresden
-
(2022): Sauerstofffreie Produktion in fünf von sechs Fertigungshauptgruppen, In: T. Königstein, A. W. (Hrsg.): Tagungsband 8. GTV Kolloquium Thermisches Spritzen & Laser Cladding. GTV Verschleißschutz GmbH, Luckenbach, 2022, S. 31-41
-
(2022): Nickel-braze coated stainless steel sheets for the production of complex brazed assemblies, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 27-31
-
(2022): Development of copper-aluminium composite brazing wires for brazing stainless steels, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 38-43
-
(2022): Yttria Coatings as Wear Protection Layer in the Semiconductor Industry, Thermal Spray 2022: International Proceedings, S 939-944, 04.-06.05.2022, Wien, Österreich
DOI: 10.31399/asm.cp.itsc2022p0939 -
(2022): Yttria coatings as wear protection layer in the semiconductor industry, DVS-Berichte, Band 380, DVS Media GmbH, Düsseldorf, S. 939-944
-
(2022): Potentials of thermal spraying processes in silane-doped inert gases, In: DVS (Hrsg.): Thermal Spray 2022: Proceedings from the International Thermal Spray Conference. Wien. 04.05.2022-06.05.2022. DVS Media, Düsseldorf, 2022, S. 199-204
DOI: 10.31399/asm.cp.itsc2022p0199 -
(2022): Development of an optical inspection method for evaluating the surface condition of metal surfaces to be brazed, In: LÖT 2022, Proceedings of the 13th International Conference Brazing, High Temperature Brazing and Diffusion Bonding. DVS Berichte Band 381, DVS Media GmbH, Düsseldorf, 2022, 235-244
-
(2021): Stoffschlüssige Grenzflächenübergänge beim thermischen Beschichten mit Lichtbogen- und Plasmaspritzprozessen, In: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 4. Symposium Materialtechnik. Clausthal-Zellerfeld (virtuell). 25.02.-26.02.2021. Shaker, Aachen, 2021, S. 258-268
-
(2021): Applikation von Nickel- und Titanbasisloten durch thermisches Spritzen zur Regeneration komplexer Investitionsgüter, Tagungsband 4. Symposium Materialtechnik. Clausthal-Zellerfeld (virtuell), 2021, 245-253
DOI: 10.21268/20210519-22 -
(2021): Sauerstofffreie Produktion: Von der Vision zur Anwendung, In: Bobzin, K. (Hrsg.): Schriftenreihe Oberflächentechnik. 15. Aachener Oberflächentechnik Kolloquium 2021. Aachen. Shaker Verlag, Düren, 2021, S. 17-26
-
(2020): Innovative Verfahrenskombination zur Steigerung der Haftzugfestigkeit thermischer Spritzschichten, In: Manufacturing Innovations Network (Hrsg.): Unter Span. Das Magazin des Manufacturing Innovations Network e. V, 2020, 15
-
(2019): Dry sheet metal forming through selective oxidized tool surfaces, In: TMS 2019, 148th Annual Meeting. San Antonio, USA. 10.03.-14.03.2019, S. 719-731
DOI: 10.1007/978-3-030-05861-6_71 -
(2019): Investigation of residual stresses in high-temperature-brazed hybrid Cr-CrNi-steel joints, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 149-155
-
(2019): In situ Chromium carbide formation in carbon modified brazed NiCrP-coatings, In: Brazing, high temperature brazing and diffusion bonding. In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 228-234
-
(2019): Kinetic investigations for brazing Zn-surfaced AlSi dublex braze metal coatings with NH4Cl-doped process gas, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 306-314
-
(2019): Application of Ni-based filler metal repair coating by thermal spraying for high pressure turbines – A hybrid coating, brazing and aluminizing process, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 71-76
-
(2019): Neue Verfahren der Oberflächenvorbehandlung zur Steigerung der Haftfestigkeit von thermisch gespritzten Schichten, In: K. Bobzin (Hrsg.): Tagungsband 14. Aachener Oberflächentechnik Kolloquium. Aachen. Shaker Verlag, Aachen, 2019, 69-79
-
(2019): Geometrisch bestimmte Oberflächenstrukturen zur formschlüssigen Substratanbindung thermisch gespritzter Schichten, In: Clausthaler Zentrum für Materialtechnik (Hrsg.): Tagungsband 3. Niedersächsisches Symposium Materialtechnik. Clausthal-Zellerfeld. 14.02.-15.02.2019. Shaker, Aachen, 2019, S. 483-494
-
(2019): Development an application of thermoplastic-coated particles for joining with powdered brazing alloys, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Lectures and Posters of the 12th International Conference taking place in Aachen on 21th to 23th May. Aachen. 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 215-221
-
(2019): Surface deoxidation mechanisms of stainless steels in vacuum brazing processes, In: Brazing, high temperature brazing and diffusion bonding - LÖT 2019. Aachen, 21.05.-23.05.2019. DVS Media, Düsseldorf, 2019, S. 247-251
-
(2018): Advanced high pressure turbine blade repair technologies, In: 10th CIRP Conference on Photonic Technologies (LANE 2018), Procedia CIRP 74, 2018, S. 214-217
DOI: 10.1016/j.procir.2018.08.097 -
(2018): Wear investigation of selective α-Fe2O3 oxide layers generated on surfaces for dry sheet metal forming, In: 17th International Conference on Metal Forming. Toyohashi, Japan. 16.09.-19.09.2018, S. 923-930
DOI: 10.1016/j.promfg.2018.07.404 -
(2018): Selective oxidation of tool steel surfaces under a protective gas atmosphere using inductive heat treatment, In: Vollertsen, F. et al. (Hrsg.): 5th International Conference on New Forming Technology, ICNFT 2018. Bremen, 18.09.-21.09.18. MATEC Web Conf. 190, 2018, S. 14003
DOI: 10.1051/matecconf/201819014003 -
(2017): Regeneration of High Pressure Turbine Blades. Development of a Hybrid Brazing and Aluminizing Process by means of Thermal Spraying, The 5th International Conference on Through-Life Engineering Services. Cranfield, England, 01.11.-02.11.2016, Procedia CIRP 59, 2017, 72-76
DOI: 10.1016/j.procir.2016.09.041 -
(2017): Heat treatment of the thermally sprayed coating system NiCrSi/NiCoCrAlY/Al for repair brazing high pressure turbine blades, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 462-466
-
(2017): Enhanced corrosion resistance of magnesium alloys by transplantation of thermally sprayed coatings, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 665–668
-
(2017): Transpiring thermally sprayed alumina layers with integrated fluid flow tubes, In: ITSC 2017. DVS-Berichte, Band: 336. DVS Media GmbH, Düsseldorf, 2017, S. 47-50
-
(2017): Development of a Cu-Sn based brazing system with a low brazing and a high remelting , 19th Chemnitz Seminar on Materials Engineering, IOP Conf. Ser.: Mater. Sci. Eng. 181, 2017, 12005
DOI: 10.1088/1757-899X/181/1/012005 -
(2017): In-situ examination of Cr-Ni steel surfaces heat treated under N2 by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 13th DELTA User Meeting & Annual Report 2017. Dortmund. 29.11.2017, S. 27-28
-
(2016): Commissioning of a high temperature heater cell for in-situ ReflEXAFS studies of steel surfaces under variable reductive gas atmospheres, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 11-13
-
(2016): Material Characterization of Thin Coatings Using High Frequency Eddy Current Technology, Proceedings of the 19th World Conference on Non-Destructive Testing WCNDT, München, 2016
ISBN: 978-3-940283-78-8 -
(2016): Mechanisms of surface deoxidation of stainless steels in vacuum brazing processes, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 181-185
-
(2016): Fluxfree brazing of copper based alloys and steels at temperatures between 650 °C and 850 °C in monosilane-doped nitrogen, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 186-191
-
(2016): Transplantation of Micro- and Nanostructured Coatings by Means of Thermal Spraying and PVD, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 3-11
-
(2016): Development of copper and nickel based brazing solders with a low brazing and a high remelting temperature, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 272-277
-
(2016): Construction of an experimental set-up for brazing stainless steel samples in low vacuum atmosphere consisting monosilane-doped argon, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 311-315
-
(2016): Development of a combined brazing-nitriding process for the production of bipolar plates made of chromium coated metal sheets, In: DVS (Hrsg.): Brazing, high temperature brazing and diffusion bonding - LÖT 2016. Aachen, 07.06. - 09.06.2016. DVS Media, 2016, S. 174-180
-
(2016): Short-time nitridation of electroplated chromium coatings in SiH4-doped N2- atmosphere analysed by GIXRD, In: Sternemann, C.; Wagner, R.; Lützenkirchen-Hecht, D. (Hrsg.): 12th DELTA User Meeting & Annual Report 2016. Dortmund, 30.11.2016, S. 53-54
-
(2016): Selectively Oxidised Tool Steel Surfaces for Sheet Metal Forming, In: K. Bobzin, K.-D. Bouzakis, B. Denkena, H. J. Maier, M. Merklein (Hrsg.): The „A“ Coatings 2016. Conference Proceedings. PZH-Verlag, Garbsen, 2016, S. 179-185
ISBN: 978-3-95900-072-7 -
(2015): Entwicklung einer korrosions- und verschleißbeständigen Eisenbasisschicht, In: Wiche, H.; Wesling, V.; Teichmann, C. (Hrsg.): Tagungsband 1. Niedersächsisches Symposium Materialtechnik, 12. bis 13. Februar 2015. Shaker, Herzogenrath, 2015, S. 101-112
-
(2015): Gelötete Metall-Keramik-Verbunde in Werkzeugen, In: DVS-Berichte Bd. 315, Tagungsband des DVS Congress und Expo in Nürnberg. DVS-Media, Düsseldorf; S. 559-562
-
(2015): Transplantation of Thermal Sprayed Coatings, ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 753-755
ISBN: 978-1-62708-093-4 -
(2015): Development of a two-stage hybrid Technology for repairing Turbine Blades, In: ASM International (Hrsg.): Thermal Spray 2015. Proceedings from the International Thermal Spray Conference and Exposition. ASM International, Materials Park, Ohio, 2015; S. 37-40
-
(2015): Future regeneration processes for high pressure turbine blades, Deutscher Luft- und Raumfahrtkongress, Rostock, 22.09.-24.09.2015 Weitere Informationen
-
(2015): Homogenization of Coating Properties in Three-Cathode Atmospheric Plasma Spraying by Use of Advanced Diagnostics and Numerical Simulation - Investigations of Suspension Plasma Spraying (SPS), In: ASM International (Hrsg.): Proceedings from the International Thermal Spray Conference 2015; S. 452-459
-
(2014): Development and Analysis of Microstructures for the Transplantation of Thermally Sprayed Coatings, Procedia CIRP Vol. 14, 6th CIRP International Conference on High Performance Cutting, HPC2014, S. 245 -250
DOI: 10.1016/j.procir.2014.03.054 -
(2014): Entwicklung und Test eines Prüfverfahrens zur Bewertung von Lötverbindungen bei kombinierter mechanisch-korrosiver Belastung, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 164-171
ISBN: 978-3-00-046877-3 -
(2014): Transfer of Micro-structures by Transplantation of Thermal Sprayed Coatings, ITSC 2014 Conference proceedings, lectures and posters, 21. - 23.5.2014, Barcelona, Spanien, S. 142–145
ISBN: 978-3-87155-574-9 -
(2014): Common application of Ni-based fillermetals and hotgascorrosion protection coatings by means of thermal spraying with subsequent heat treatment for near net shape turbineblade repairing, In: Bouzakis, K.-D. et al. (Hrsg.): Proceedings / 11th International Conference THE "A" Coatings in Manufacturing Engineering, 1 - 3 October 2014, Thessaloniki, Greece. Ed. Ziti, Thessaloniki, 2014, S. 179-184
ISBN: 978-960-98780-8-1 -
(2014): Aufbau einer RF-PVD Anlage zur Abscheidung sauerstoffaffiner Materialien für die Herstellung wärmegenerierender Systeme, Tagungsband zum 17. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (52), Eigenverlag Chemnitz, S. 247–254
ISBN: 978-3-00-046877-3 -
(2013): Nano and Micro Structuring of PVD Surfaces by Using the Thin Film Transplantation Technology, 9th Asian-European International Conference on Plasma Surface Engineering (AEPSE 2013), Jejo (Korea), 25-30.08.2013
-
(2013): Injection molding, characterization and application of polymer bonded nickel based braze metal preforms for high temperature brazing processes, Proceedings of 10th International Conference on Brazing, High Temperature Brazing and Diffusion Brazing, Aachen, Juni 2013, S. 11-16
-
(2013): Evaluating a novel class of biomaterials: Magnesium-containing layered double hydroxides, BMT 2013, 3-Ländertagung D-A-CH, Graz, 19-21.09.2013
-
(2013): Injection molding and application of ring-shaped polymer-bonded braze metal preforms, Tagungsband: Design of/with composites, Composites Week @ Leuven, Leuven (Belgien), September 2013
-
(2013): Transfer of Micro-structures by Transplantation of Thermal Sprayed Coatings, In: Proceedings of the 10th International Conference THE “A“ Coatings (K.-D. Bouzakis, K. Bobzin, B. Denkena und M. Merklein (Hg.)), Shaker, Aachen, 2013, S. 193–204
-
(2013): Development of flux free filler metals and processes for brazing of aluminum, In: Brazing, high temperature brazing and diffusion bonding. LÖT 2013, lectures and posters of the 10th international conference taking place in Aachen on 18th to 20th June 2013. Als Ms. gedr. Düsseldorf: DVS Media (DVS-Berichte, 293), 2013, S. 205–211
-
(2013): Untersuchung der mikro- und makroskopischen Abbildungsgenauigkeit von im Schichttransplantationsprozess übertragenden Oberflächenbeschichtungen, In: Verbundwerkstoffe. 19. Symposium Verbundwerkstoffe und Werkstoffverbunde (A. Wanner und K. A. Weidemann (Hg.)), Karlsruher Institut für Technologie (KIT), 2013, S. 10
-
(2012): Herstellung von nachbearbeitungsarmen Innenbeschichtungen auf Druckgussteilen durch Transplantation thermischer Spritzschichten, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 129–139.
-
(2012): Thermische Spritzschichten zur dynamischen Datenspeicherung auf technischen Bauteilen, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen. Chemnitz: Eigenverlag (Vol. 47), S. 110–119.
-
(2012): Bauteilpanzerung und Oberflächenstrukturierung durch PVD-Schichttransplantation, In: B. Wielage (Hg.): Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Chemnitz: Eigenverlag, S. 452–457.
-
(2012): Physikalisch-chemische Betrachtungen zur Oxidschichtauflösung beim Hartlöten von Stählen mit Cu- und AgCu-Loten, In: Tagungsband zum 15. Werkstofftechnischen Kolloquium in Chemnitz. Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen (Vol. 47). Unter Mitarbeit von B. Wielage. Chemnitz: Eigenverlag, S. 465–472.
-
(2012): A New Hybrid Process for Repair Brazing and Coating of Turbine Blades, In: R.S Lima, A. Agarwal, M.M Hyland, Y.-C Lau, C. Li, A. McDonald und F.-L Toma (Hg.): International Thermal Spray Conference and Exposition (ITSC 2012). Conference Proceedings, 20.05. – 24.05.2012, Houston, TX, USA. ASM International. Novelty, OH, USA: ASM International, S. 110–113.
-
(2011): Herstellung von Druckgussteilen mit mikrostrukturierten Funktionsschichten, durch die Transplantation von thermischen Spritzschichten, In: Tagungsband zum Werkstofftechnischen Kolloquium (14. Werkstofftechnisches Kolloquium), S. 24–33
-
(2011): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Wielage (Hg.) 2010 – Tagungsband 13. Werkstofftechnisches Kolloquium Chemnitz
-
(2011): Tribological behaviour of suspension plasma sprayed coatings for hot extrusion tools, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
-
(2011): Three anodes compared to three cathodes: Evaluation of gun concepts for high performance plasma spraying operation, In: ITSC 2011. International Thermal Spray Conference & Exposition; abstracts (including manuscripts on CD-ROM) of the conference in Hamburg on September 27 - 29, 2011 in the context of DVS Congress and DVS Expo / [CD-ROM]. ITSC; Deutscher Verband für Schweißen und Verwandte Verfahren; Thermal Spray Society; International Institute of Welding. Düsseldorf: DVS Media (DVS-Berichte, 276).
-
(2011): Achieving new thermal spray coatings by usage of multielectrode plasma guns, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 353–360.
-
(2011): Suspension Plasma Spraying of oxide ceramic coatings on massive forming tools, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 337–346.
-
(2011): Repair Brazing of Turbine Blades using Thermal Spraying, In: Konstantinos-Dionysios Bouzakis (Hg.): Proceedings. International Conference THE "A" Coatings in Manufacturing Engineering (9, 2011, Thessalonikē). Thessaloniki: Ed. Ziti, S. 347–352.
-
(2011): Reparaturlöten von Turbinenschaufeln mittels Thermischen Spritzens, Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen, Bd. 43, pp. 231–236, Chemnitz, Eigenverlag, ISBN 978-3-00-035117-8
-
(2011): Joining and coating by the combination of welding and plasma spraying to define metallurgical conditions and produce protective layers with powder and nanoscale materials., 2nd International Symposium on Functional Surfaces in Aachen. Aachen, 13.09.2011.
-
(2010): Mechanical Surface Treatment to Obtain Optically Cooperative Surfaces vis-à-vis Fringe Projection, Reflection, scattering, and diffraction from surfaces II Proceedings of SPIE Vol. 7792, S. 77920V-77920V-9. Bellingham, Wash.: SPIE, 2010.
ISBN: 9780819482884 -
(2010): Berührungslose Geometrieprüfung endbearbeiteter Bauteile mit optisch nicht kooperativen Oberflächen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 313-317. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Beitrag zum Auftraglöten und -schweißen von Panzerungen mit hoher Verschleißreserve, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 55-63. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Qualitative Vorausberechnungen der Benetzungsvorgänge beim Löten mittels Methoden der klassischen Molekulardynamik (MD), Hart- und Hochtemperaturlöten und Diffusionsschweißen. LÖT 2010 ; Vorträge und Posterbeiträge des 9. internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2010 & Brazing, high temperature brazing and diffusion bonding. Löt; Deutscher Verband für Schweißen und Verwandte Verfahren. Düsseldorf: DVS Media (DVS-Berichte, 263), S. 248–254.
-
(2010): Niedrig schmelzende Aluminiumhartlote aus dem System AlSiZn, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 117-121. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Hartlöten von Edelstahl im Schutzgasdurchlaufofen mit modifizierten Ni-Hartloten, Hart- und Hochtemperaturlöten und Diffusionsschweißen DVS-Berichte Vol. 263, S. 266-271. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-589-3 -
(2010): Fügen von Aluminium-Stahl-Hybridwerkstoffen mit zinkhaltigen Loten unter Einsatz reaktiver Gaszusätze im Schutzgasofen, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 318-324. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Neue Lösungswege für das Reparaturlöten und -beschichten von Turbinenschaufeln: Machining Innovations Conference Tagungsband 23. und 24. November 2010 Hannover, Neue Fertigungstechnologien in der Luft- und Raumfahrt Berichte aus dem IFW Vol. 2010,8, S. 435-447. Garbsen: PZH Produktionstechn. Zentrum, 2010.
ISBN: 978-3-941416-78-9 -
(2010): Entwicklung einer Fertigungstechnik für Metall-Kapillardruckgießprozesse, Maschinen-, Werkzeug- und Prozessentwicklung für neue Verfahren zur Herstellung von Mikrobauteilen über flüssige Phasen, S. 3-8. Erlangen-Tennenlohe: Lehrstuhl für Kunststofftechnik Univ. Erlangen-Nürnberg, 2010.
ISBN: 978-3-931864-49-1 -
(2010): Metall-Kapillardruckgießen - Gießen im Mikrometermaßstab, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 307-312. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): Homogenization of Coating Properties in Atmospheric Plasma Spraying - Current Results of a DFG (German Research Foundation)-Funded Research Group, Thermal spray: global solutions for future application DVS-Berichte Vol. 264. Düsseldorf: DVS Media, 2010.
ISBN: 978-3-87155-590-9 -
(2010): Prozesskettenverkürzte Fertigung von Leichtmetall-Druckgussverbundbauteilen durch Transplantation thermisch gespritzter Schichten, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 110-120. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2010): PVD-Schichttransplantation - hochgenaue, strukturierte Oberflächen & Mikrobauteil-Oberflächen-Veredelung, Tagungsband zum 13. Werkstofftechnischen Kolloquium in Chemnitz Schriftenreihe Werkstoffe und werkstofftechnische Anwendungen Vol. 37, S. 86-91. Chemnitz: Eigenverl., 2010.
ISBN: 978-3-00-032471-0 -
(2009): Herstellung von beschichteten Druckgussbauteilen durch prozessintegrierte Applikation thermisch gespritzter Schichten in Gussformen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 36, S. 79-86. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Hochgenaue Prägewerkzeuge mit optischer Qualität durch abgeformte PVD-Schichten, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 397-402. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): PVD-Schichtabformung im µm-Bereich, Tagungsband des zweiten Workshops für Optische Technologien, 17.11.2008, S. 167-169. Garbsen: Verlag PZH Produktionstechnisches Zentrum GmbH, 2009.
ISBN: 978-3-941416-17-8 -
(2009): Suspensionsplasmaspritzen thermisch aktivierbarer triboaktiver Schichtverbunde, Tagungsband zum 17. Symposium Verbundwerkstoffe und Werkstoffverbunde, 01.-03.04.2009, Bayreuth, S. 627-634. Bayreuth, 2009.
-
(2009): Achieving Thin Functional Coatings by Mixing of Nanosized Feedstock Powders in the Suspension Plasma Spraying Process, Proceedings of the 4´th International conference on Spray Deposit in and Melt Atomization, 2009.
-
(2009): Basic Principles to Obtain Oxide Ceramic Coating Systems with Reduced Sliding Wear by Suspension Plasma Spraying, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 200-206, 2009.
ISBN: -13978-1-61503-004-0 -
(2009): Werkstoffkundliche und Prozesstechnische Aspekte zum Hartlöten im Schutzgasdurchlaufofen, Tagungsband des 4. Aachener Oberflächenkolloquium Schriftenreihe Oberflächentechnik, S. 29-44. Aachen: Shakerverlag, 2009.
ISBN: 1864-0796 -
(2009): Schutzgasofenlöten von Aluminium und Stahl in reaktiven Prozessgasen, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 418-423. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsverfahren, Beiträge zum Abschlusskolloquium des SPP 1138, Bonn 11.-12.02.2009, S. 79-95. Bremen: BIAS Verlag, 2009.
ISBN: 978-3-933762-29-0 -
(2009): Löten von hochlegierten Stählen, Nickel- und Titanlegierungen unter Ausbildung stängelkristallitverstärkter Lötnähte, Tagungsband 12. Werkstofftechnisches Kolloquium Chemnitz Vol. 35, S. 403-409. Chemnitz: Eigenverlag, 2009.
ISBN: 978-3-00-029007-7 -
(2009): Homogenization of Coating Properties in Atmospheric Plasma Spraying - New Results of a DFG (German Research Foundation)-Funded Research Group, Thermal Spray 2009 Proceedings of the International Thermal Spray Conference, S. 762-767, 2009.
ISBN: -13978-1-61503-004-0 -
(2009): Größeneinflüsse bei der Herstellung von elektronenstrahlgelöteten Umformmatrizen für die Mikroumformtechnik, Größeneinflüsse bei Fertigungsprozessen, S. 79-95, 2009.
ISBN: 978-3-933762-29-0 -
(2009): Compound Casting of Aluminium and Magnesium-Alloy by High Pressure Die Casting, 8th International Conference on Magnesium Alloys and their Applications, S. 390-397. Weinheim: Wiley-VCH, 2009.
ISBN: 3-527-32732-0 -
(2008): Thermally sprayed coatings with stochastic microstructures for thermomechanically high stressed surfaces, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Verarbeitung von feinen Spritzwerkstoffen zur Verbesserung von Korrosions- und Verschleißschutzeigenschaf-ten von thermisch gespritzten Schichten, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 66-72. Chemnitz: Eigenverlag, 2008. Online verfügbar unter http://www.worldcat.org/oclc/318648539 Weitere Informationen
ISBN: 978-3-00-025648-6 -
(2008): Oberflächenbehandlungen von Polymeren und Werkzeugen zur Polymerbearbeitung, Fahlbusch, Pfalz (Hg.) 2008 – Tagungsband Hannoversches Zentrum für Optische Technologien; Workshop Optische Technologien
-
(2008): Development of near net shape coatings for wear and corrosion protection, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Characterisation of thermally sprayed near net shape oxide ceramic and cermet coatings by acoustic emission analysis, Tagungsband International Thermal Spray Conference Maastricht 2008: CD-ROM, 2008.
-
(2008): Optimierung von Eisenbasisfülldrähten für das Lichtbogenspritzen mittels statistischer Methoden, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 73-79. Chemnitz: Eigenverlag, 2008.
ISBN: 978-3-00-025648-6 -
(2008): Homogenization of coating properties in Atmospheric Plasma Spraying - technical objectives and first results of a DFG funded research group, Proc. International Thermal Spray Conference, June 2-4, 2008, Maastricht, The Netherlands, 2008.
-
(2008): Neue Entwicklungen beim Hartlöten im Schutzgasdurchlaufofen, Tagungsband 11. Werkstofftechnisches Kolloquium Chemnitz 2008 Vol. 31, S. 209-214. Chemnitz: Eigenverlag, 2008.
ISBN: 978-3-00-025648-6 -
(2008): Verfahrenskombinationen und Hybride aus thermischem Beschichten und Fügen, 3. Aachener Oberflächentechnik-Kolloquium 12.12.2008, S. 31-50. Aachen: Shaker Verlag, 2008.
ISBN: 978-3-8322-7831-1 -
(2008): Entwicklung einer Online-Schichtdickenmessung für das Plasmaspritzen von Keramik auf Basis einer Wirbelstromsensorik, DGZfP-Jahrestagung 2008 Zerstörungsfreie Materialprüfung "ZfP in Forschung, Entwicklung und Anwendung". St. Gallen, 2008.
-
(2007): Wear reducing measures on forging dies by application of technical surfaces, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 23-32, 2007.
ISBN: 978-3-939026-64-8 -
(2007): Untersuchung der Einflüsse von Substratrauheit und Spritzwerkstofffraktionierung auf die Haftung thermisch gespritzter Schichten, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 125-129. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Keramik-Metall-Verbundwerkzeuge für die Metallbearbeitung, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 52-58. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Thermally Sprayed Coatings with Stochastic Microstructure for Improved Lubricant Retention, Proceedings of 6th international Conference THE-Coatings 2007, Hannover, 25.-26. Oktober 2007, S. 317-322, 2007.
ISBN: 978-3-939026-64-8 -
(2007): Diamantimprägnieren durch Thermisches Spritzen als Verfahren zur Schleifwerkzeugbeschichtung, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 286-291. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Metall-Kapillardruckgießen und Dampfphasen-Schmelzinfiltration: Zwei innovative Verfahren für das Herstellen metallischer Mikrobauteile, Thomas Gessner (Hg.): Proceedings / Mikrosystemtechnik-Kongress 2007. 15. - 17. Oktober 2007 in Dresden ; gemeinsame Veranstaltung von: Bundesministerium für Bildung und Forschung (BMBF), VDE Verband der Elektrotechnik Elektronik Informationstechnik. Berlin, Offenbach: VDE-Verl, S. 123–126
ISBN: 978-3-8007-3061-2 -
(2007): Flammlöten von Aluminiumschmiedeteilen, Bernhard Wielage (Hg.): Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 202-212. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Gas/Solid-TLP-Bonding Ein neues Verfahren zum Herstellen und Fügen von Miniatur- und Mikrobauteilen, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 319-324. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Entwicklung eines neuen Produktionsverfahrens für die Fertigung komplexer Metallverbunde- Gas/Solid-TLP-Bonding, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 231-236. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Entwicklung galvanisch hergestellter Hochtemperaturlotbeschichtungen, -Drähte und -Folien, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 393-397. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): SCIB - Self-Cleaning Inert-Gas Brazing? Ein neues Verfahren zum flussmittelfreien Hartlöten korrosionsbeständiger Konstruktionswerkstoffe, Tagungsband zum 8. Internationalen Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen (LÖT 2007, Aachen, 19. - 21. Juni 2007), DVS-Berichte, Nr. 243, S. 235-241. Düsseldorf: DVS-Verlag, 2007.
ISBN: 978-3-87155-799-6 -
(2007): Elektrochemische Messmethoden zur Online-Bestimmung des Kupfergehaltes in bleifreien Sn-Basis-Lotbädern, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz, Nr. 26, S. 261-267. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Untersuchungen zur Spritzwerkstoffeinbringung beim Dreikathoden-Plasmaspritzprozess, Tagungsband zum 10. Werkstofftechnischen Kolloquium - WTK Chemnitz Vol. 26, S. 136-142. Chemnitz: Eigenverlag, 2007.
ISBN: 978-3-00-021586-5 -
(2007): Use of a TiBN multilayer coating for wear reduction, Proceedings of 9th International Conference on Numerical Methods in Industrial Forming Processes - numiform'07, S. 1047-1052. Porto, Portugal, 2007.
ISBN: 978-0-7354-0416-8 -
(2007): Reduction of Wear by a TiBN Multilayer Coating, 31st Int. Cocoa Beach Conference ICACC Jan. 2007 // Proceedings of the 31st International Conference on Advanced Ceramics and Composites, January 21-26, 2007, Daytona Beach, Florida, USA. Westerville, Ohio: American Ceramic Soc
ISBN: 978-0-470-24679-5 -
(2007): Manufacturing of ceramic reinforced high precision forging dies, Proceedings of 4th International Conference and Exhibition on Design and Production of Machines and Dies/Molds, Cesme, Turkey, June 21-23, 2007, 2007.
-
(2007): Heißrisse beim gepulsten Laserstrahlschweißen von CrNi-Stählen? Heißrisstests und Vermeidung durch vordeponierte Spritzschichten, Vortragsband zu 7. Int. Konf. Strahltechnik 17.-19.4.2007 in Halle (Saale). SLV Halle, GSI: DVS, 2007.
-
(2006): Ceramic-Metal Composites in Forging Applications in, Proceedings of the 3rd International Soldering and Brazing Conference IBSC2006, S. 73-78. Materials Park, OH 44073-0002: ASM International, 2006.
ISBN: 0-87170-838-8 -
(2006): Maßnahmen zur Erhöhung der Verschleißresistenz von Gesenkmatrizen zum Präzisionsschmieden von Zahnrädern, Bernhard Wielage (Hg.): Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 // Verbundwerkstoffe und Werkstoffverbunde. Tagungsband zum 9. Werkstofftechnischen Kolloquium in Chemnitz, 7. bis 8. September 2006, Bd. 24. Chemnitz: TU, Lehrstuhl für Verbundstoffe, S. 505–511
ISBN: -10-3-00-019101-1 -
(2006): Untersuchungen zum Hochgeschwindigkeitsflammspritzen von MCrAlY-Schichtsystemen mit angepasster Oberflächenrauheit, Tagungsband zum 3. GTV Kolloquium "Thermisches Spritzen", 09.06.2006, Luckenbach, 2006, S. 24-32, 2006.
-
(2006): Thermal Spray Joining - Soldering and Filling of Aluminum Substrates under Atmospheric Conditions by a Combined Thermal Spray / Fusing Technique, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
ISBN: 0-87170-836-1 -
(2006): Roughness Enhancement of HVOF Sprayed MCrAlY Bond Coatings for Adhesion Improvement of Ceramic Top Layers, Tagungsband (als CD) zur ITSC 2006 Seattle. Materials Park, OH, USA: ASM International: CD, 2006.
ISBN: 0-87170-836-1 -
(2006): Niedrig schmelzende Glaslote auf Phosphatbasis zum Fügen von Aluminium-Keramik-Verbunden, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 430-435. Chemnitz: Eigenverlag, 2006.
ISBN: -10-3-00-019101-1 -
(2006): Heating behaviour of differently tempered forged aluminium alloy components in a flame brazing process, Tagungsband zum "4. International Congress Aluminium Brazing, 16t - 18th May 2006". Düsseldorf: Aluminium-Verlag, 2006.
-
(2006): Modellierung der Stängelkristallitbildung beim Hartlöten am Beispiel des Werkstoffsystems Fe-C-Cu, Tagungsband zum 9. Werkstofftechnischen Kolloquium der TU Chemnitz - WTK Chemnitz, 2006 Vol. 24, S. 400-406. Chemnitz: Eigenverlag, 2006.
ISBN: -10-3-00-019101-1 -
(2005): Development of a technique for hard coating of component parts by synthesis of silicon carbide in thermal spray processes, Erich Lugscheider (Hg.): Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Verbindungsspritzen - ein hybrides Fügeverfahren aus thermischem Spritzen und Umschmelzen, Univ.-Prof. Dr.-Ing. habil. B. Wielage (Hg.): Neue Materialien und Verfahren in der Beschichtungstechnik. Tagungsband zum 8. Werkstofftechnischen Kolloquium in Chemnitz. 29.-30.09.2005. TU Chemnitz, Fakultät für Maschinenbau, Lehrstuhl für Verbundwerkstoffe. Chemnitz: Eigenverlag (Werkstoffe und Werkstofftechnische Anwendungen, 22), S. 157–163
-
(2005): Properties of thermally sprayed coatings on magnesium parts for enhancement of wear and corrosion resistance, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Qualification of a Modified Triplex II Plasma Gun for Processing of Liquid Precursors and Wire- or Powder Shaped Spray Materials under Controlled Atmosphere, Conference Proceedings ITSC 2005. Düsseldorf: DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): Self propagating high temperature synthesis of aluminium-matrix-composite coatings by means of atmospheric plasma spraying, Conference Proceedings ITSC 2005. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH, 2005.
ISBN: 3-87155-793-5 -
(2005): New approaches concerning the enhancement of wear and corrosion resistance of magnesium parts by thermally sprayed coating systems, K.-D Bouzakis (Hg.): Tagungsband zur Konferenz THE Coatings, 5.-7. Oktober 2005, Thessaloniki, Griechenland // 5th International Conference "the coatings" on Manufacturing Engineering and Eureka partnering event. Thessaloniki: Ed. Ziti, S. 241–248
-
(2004): Neue Lotapplikationstechniken mittels Thermischer Spritzverfahren, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 35-37. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Hochleistungswerkzeuge aus Keramik-Metall-Werkstoffverbunden, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 300-303. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Thermally Sprayed Coatings on Mg Alloys for Improved Wear and Corrosion Resistance, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 425-434. Friedrich-Alexander-Universität Erlangen-Nürnberg: Verlag, 2004.
ISBN: 3-87525-201-2 -
(2004): State of the Art and Future Trends in Thermal Spraying, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 41-55. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
ISBN: 3-87525-201-2 -
(2004): Thermally sprayed filler metal coatings for high temperature brazing, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004 // Thermal spray 2004. Advances in technology and application, 10-12 May 2004, Osaka, Japan : proceedings of the International Thermal Spray Conference. Materials Park, Ohio: ASM International
-
(2004): Beschichtungsverfahren als leistungsfähige Alternative zu konventionellen Lotapplikationstechniken, Tagungsband zu "Oberflächentage 2004", 7. Mehrländertagung der Deutschen Gesellschaft für Galvano- und Oberflächentechnik e. V. am 22.-24.09.2004 in Dresden, S. 13-19, 2004.
ISBN: 3-9806061-2-0 -
(2004): An Alternative Coating Process Underwater Plasma Spraying, Tagungsband zum 12. Plasma Technik Workshop Ilmenau, S. 81-88, 2004.
-
(2004): Thermisch gespritzte Schichtsysteme zur Erhöhung des Verschleiß- und Korrosionsschutzes von Magnesiumbasis-Legierungen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18, S. 17-23. Chemnitz: Eigenverlag, 2004.
ISBN: 3000135537 -
(2004): Weiterentwicklung des Hochtemperaturlötens mit Ledeburitloten, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 353-357. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Flussmittelfreies Hartlöten dünnwandiger Titanlegierungen mit partieller Erwärmung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 362-364. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Flussmittelfreies Flammlöten von Aluminiumlegierungen durch Ultraschallunterstützung, DVS-Berichte, Hart- und Hochtemperaturlöten und Diffusionsschweißen, Vorträge und Posterbeiträge des 7. Internationalen Kolloquiums in Aachen vom 15. bis 17. Juni 2004, Nr. 231, S. 358-361. Düsseldorf: DVS-Verlag GmbH, 2004.
ISBN: 3-87155-685-8 -
(2004): Corrosion Protective Coatings by Modified Underwater Plasma Spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
-
(2004): Aspects of PVD-Coatings of Plasma Nitratet Tool Steels, 4th International Conference THE Coatings, Proceedings of the international conference, Erlangen, Germany, 05.-07. April 2004, S. 103-109. Friedrich-Alexander-Universität Erlangen-Nürnberg, 2004.
ISBN: 3-87525-201-2 -
(2004): Verarbeiten von kolloidal gelösten Nanopartikeln durch Thermisches Spritzen, Tagungsband zum 7. Werkstofftechnischen Kolloquium "Neue Materialien und Verfahren in der Beschichtungstechnik", 30.Sept. - 01.Okt. 2004, Chemnitz Vol. 18. Chemnitz: Eigenverlag, 2004.
ISBN: 3000135537 -
(2004): Manufacturing diamond impregnated tools for stone machining through thermal spraying, Proceedings of the International Thermal Spraying Conference 2004, (als CD), Osaka, Japan, (ITSC 2004): CD, 2004.
-
(2003): Wlasnosci warstw kompozytowych natryskiwanych gazowo-detonacyjnie na podloza stopów lekkich na osnowie Al i Mg, Proc. Conf. "Modern Wear and Corrosion Resistant Coatings Obtained by Thermal Spraying", Warschau, 2003, 2003.
-
(2003): Advantages of reactive spraying by simultaneous self-propagating high temperature synthesis (SHS), IWW Annual Assembly 2003.
-
(2003): Particle Image Velocimetry Thermal Spraying, SDMA/ICSF 2003 2nd Spray deposition and melt atomization / 5th International Conference on Spray Forming, Proceedings of the international conference, Bremen, Germany, 22. - 25. June, S. Kapitel 7, S. 115-126. Bremen: Deutsche Forschungsgemeinschaft, Universität Bremen, 2003.
ISBN: 3-8330-0571-8 -
(2003): Aspekte der PVD-Beschichtung plasmanitrierter Werkzeugstähle, Tagungsband zur 5. Industriefachtagung "Oberflächen- und Werkstofftechnik" und zum 6. Werkstofftechnischen Kolloquium in Chemnitz, Schriftenreihe Werkstoffe und Werkstofftechnische Anwendungen Vol. 16, S. 265-270. Chemnitz: Eigenverlag, 2003.
-
(2003): Themenschwerpunkt "Urformen", Mikromechanische Produktionstechnik, Abschlusskolloquium zum DFG-Schwerpunktprogramm 1012, S. 115-147, 2003.
-
(2002): Partikeldiagnostik mittels Particle Image Velocimetry (PIV) beim Hochgeschwindigkeitsflammspritzen, Tagungsband des GTV-Kolloquiums 2002, Luckenbach, S. 21-32, 2002.
-
(2001): Untersuchungen zum industriellen Weichlöten von Kupfer an Rotguß, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 5-10. Düsseldorf: DVS-Verlag, 2001.
-
(2001): Flußmittelfreies Löten von Aluminiumlegierungen mit Schutzgasaktivatoren, DVS (Hg.): Tagungsband zur “Löt 2001”, 6. Internationales Kolloquium, Bd. 212. Düsseldorf: Verlag für Schweißen und verwandte Verfahren DVS-Verlag GmbH (212), S. 375–379
-
(2001): Neue Lösungsansätze zum Löten von Aluminiumlegierungen mit artgleichen und nicht artgleichen Fügepartnern, Tagungsband zur "Löt 2001", 6. Internationales Kolloquium Hart- und Hochtemperaturlöten und Diffusionsschweißen, 8.-10. Mai, Aachen, DVS-Berichte, Nr. 212, S. 231-235. Düsseldorf: DVS-Verlag, 2001.
-
(2000): Metall-Kapillardruckgießen: Ein neues Urformverfahren für die Mikromechanik, E. Lugscheider (Hg.): 7. Werkstoffwissenschaftliches Kolloquium - Innovative Werkstofftechnologie 1999, Werkstoffwissenschaftliche Schriftenreihe. Aachen: Shaker Verlag (41), S. 67–73
-
(1999): Investigations on Capillary Action Microcasting of Metals, 1st International Conference and General Meeting of the European Society for Precision Engineering and Nanotechnology, Bremen, Germany, S. 490-493, 1999.
-
(1998): Anwendungsorientierte Lotentwicklung, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 48-51, 1998.
-
(1998): Fluß-mittelfreies Löten von Leichtmetall/Stahl-Verbindungen, Tagungsband zum 5. Internationalen Kolloquium "Hart- und Hochtemperaturlöten und Diffusionsschweißen, LÖT'98", Aachen, 16.-18. Juni 1998, S. 206-210, 1998.
Beiträge in Büchern
-
(2024): Near Net Shape Turbine Blade Repair Using a Joining and Coating Hybrid Process, Regeneration of Complex Capital Goods, 1. Auflage, Springer, Cham, 2025
DOI: 10.1007/978-3-031-51395-4_7 -
(2024): Improving Repair Braze Gap Strength Through the Development of a Novel Superalloy Filler, Superalloys 2024: The Minerals, Metals & Materials Series, 1. Auflage, Springer, Cham, 2024
DOI: 10.1007/978-3-031-63937-1_90 -
(2018): Fluiddurchströmbare, transpirierende thermisch gespritzte Schichten, In: Clausthaler Zentrum für Materialtechnik, C. Z. f. (Hrsg.): Berichtsband Clausthaler Zentrum für Materialtechnik. Shaker, Herzogenrath, 2018, S. 137-147
-
(2016): Verfahren und Methoden zur Transplantation thermisch gespritzter Schichten für Druckgussteile, In: Biermann, D. (Hrsg.): Spanende Fertigung. Prozesse, Innovationen, Werkstoffe. Vulkan, Essen, 2016, S. 88-93
ISBN: 978-3-8027-2989-8 -
(2014): Microstructured thermally sprayed surfaces, B. Denkena, A. Rienäcker, G. Knoll, F.-W. Bach, H. J. Maier, E. Reithmeier und F. Dinkelacker (Hg.): Microstructuring of thermo-mechanically highly stressed surfaces. Final report of the DFG Research Group 576, Springer-Verlag, Heidelberg New York Dordrecht London, S. 58–92
-
(2014): Werkzeugtechnologie, Bach, Fr.-W.; Kerber, K. (Hg.): Prozesskette Präzisionsschmieden, Springer-Verlag Berlin Heidelberg, S. 53-125
ISBN: 978-3-642-34663-7 -
(2005): Einsatz von Beschichtungsverfahren in der Löttechnik, Fr.-W. Bach (Hg.): Moderne Beschichtungsverfahren. Weinheim: Wiley-VCH, S. 277–286
-
(2003): Neue Entwicklungstendenzen zum Löten von Aluminiumwerkstoffen, Deutscher Verband für Schweißtechnik e.V. (DVS) (Hg.): Jahrbuch Schweißtechnik 2003. Düsseldorf: Verl. für Schweißen und Verwandte Verfahren, DVS-Verl. (Jahrbücher), S. 138–143
-
(2000): Oberflächenbehandlung und thermochemische Stabilität von Magnesiumlegierungen, Magnesium-Taschenbuch, S. 308-311,
ISBN: ISBN-10: 3870172649